,PP @ @ @ھ 08h3n @   3Vnh$PP @9/mntk(k*@`dT 08h3V @   3Vnh$PP @Y@`dT U3n @9 X XU(hؾgHA 3V3l+E3l+EpȡA3V+E3\3\iLA3i+E3i3i jN$A3V+x3liN3liNk* A3V-3V-;3V-;ln3[A3V.@3V.@3V.@m@A3V.@3^!#3^!#n-iA3V/q3l463l46owA3V0 3V33V4Iq,A3V0,3_(3_(rl3fA3m1;€3n3ns 3WA3V1Y3_33_3t@"A3V33V33V46um2A3V33i5g3i5gvF0%3W-3Y463^!#xM:/3^(㇀3^(㇀3^(㇀w)3^1;€3^1;€3^1;€ `#.3^7:3^7:3^7: ay3_V~3_V~3_V~ bU3_ 3_ 3_ cAu3_sm3_ 3_  dm3_{3_{3_{ ea3e L_3e L_3g A&2!3e 3e 3g AcXa3eր3eր3g AwҜ!3e=03e=03g Aa3eiN3eiN3g Az;s5!3e˨3e˨3g AQa3eŀ3eŀ3g A^!3eZ3eZ3g Ah$Na3e$Ӏ3e$Ӏ3g A@ !3e%3e%3g AQ`{a3e*K3e*K3g AҌ!3e,w3e,w3g A#y"a3e1;€3e1;€3g A /!3e33e33g A Na3e7:3e7:3g AW!3e93e93g A.a3f3f3g Al!3f3f3g Aza3f L_3f L_3g A OX(!3f "3f "3g A ja3fր3fր3g A @m !3f3f3g A |б(a3fiN3fiN3g A !3f33f33g A 'a3fŀ3fŀ3g A  !3f3f3g A qa3f#=3f#=3g A 61!3f%P3f%P3g A VCa3f*3f*3g A!3f+x3f+x3g A_za3f0,3f0,3g ABn!3f2l3f2l3g Aa3g3g3ic!3g3g3ia3g33g33io!!3gk3gk3i+K!a3gZ3gZ3i}iT!3g!#3g!#3i<a3g%3g%3it~!3g'Z3g'Z3i4~a3g,w3g,w3iT!!3g.@3g.@3ihJa3g33g33iu|!3g5g3g5g3ia3g93g93i"s!3h[3h[3ima3h3h3i!3h3h3ira3h "3h "3iM!3h x|3h x|3ir'a3h=03h=03iXU!3h3h3iH$ a3h˨3h˨3i!3hk3hk3ia3hZ3hZ3i] !3h!#3h!#3iN.a3h%3h%3iY!3h(J3h(J3ivw<a3h,w3h,w3i :!3h.h3h.h3i a3h33h33i!3h5g3h5g3iŝna3h93h93i4!3i[3i[3iRCz3id>3i3ijY3i3i!y3i!y 3i'3i(㇀3i(㇀ I3i/q3i0,3i0, ̕7p 3i5g3lր3lր <03liN3l{3l{ mN3l\3l(3l( #0R`S3l$Ӏ3l%3l% IL#3l+E3l.@3nȀ 'qC3l463l4I3l4I Q m333m5g    ( 0 8 @X^@m&b333n H P  em 333nV~ X 9c{%}a- Lc1)5l=I\pAd/?Mݐܜ kG[!:1yP#%[&HaB3PgE@$]BX쪉5. rtV)4V\IkpjJ,`یDO|(ok0ꁭpMyn<o 6ρJOO0=w[ Am1d/9.$-=9 . .. catchmod cp dd df edexpr ln lsmkdir mv pwd rm shsttysync tartest[wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: nobody:*:32767:  . ..zgroup[0{ protocols[,|services[,disktab.preinstall ... ... . .. disklabelfsckfsck_ffshaltifconfiginitmknodmount mount_cd9660r@ mount_ffs mount_nfs mount_kernfsr@newfspingrebootrouteumount . .. .hdprofile, . .. bin dev etckerni mntsbini tmp usrinstbin} .commonutilsn.profile[, .instutils,0install . .. bin mdeci sbinishare . ..chgrp ftplessngetoptgzipnmoren sedtsetn . ..bootbootxx0binstall, . ..chownchroot installboot . ..misc . ..~termcap/bin/cat   @D, @'>$Ⱌ+#@  /@@g / "% % @<@q@!`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!r"0`$   ǖ ? $      r b8       ?@ ?# @!  ?r؀! ?@ ?# @  r؀       r0?"  #\#`?@?# @!  09@ ! 4? ?c @ ̀@ 0'@@@ ̀@ ? ?c @! @ 0@@@! @ #d#h0   #d#h0  #d#h  Ŕ  ' r? "b0  (    r"0"0ܘ@#\#`?@?# @؀! ?@ ?# @  ?Q@؀ K?@ ?# @! 2 9@ ! 3? ?c @ ̀@2 %@@@ ̀@? ?c @! @"  @@@! @# #?B ?@ ?# @!  6 @ ! /? ?c @ ̀@ # @@@ ̀@? ?c @! @  @@@! @    #d#h  Ŕ  c ?   (]  Z 䀢 "rb0b0#\#`  #d#h  Ŕ  ?`?2 r  (9  6 rb0$ >"$  $ @ $ b0 ` ?r  @ ! ` ? r  h   r "bXrbP""X@`㿘r"X€ 㿘r"X "? @㿘r"X  € 㿘r"X  ?Service unavailable㿐r"X     ?1 !@D *`:`J "J %s: %s not compiled in instbin-krb㿘@;@ J 2@@K@@y. /  @@   "@[ "    € p"` b8 P@-@ 㿘 ?@?`Usage: %s ..., where is one of: %s㿘p"` cp @P@    'p+ ) @@  O4`@c`#@@`@ p"` @c@& gzipumounttset[testsyncsttysedroutermhaltrebootpwdping-shshpdkshtarpaxnewfsmvmount_kernfsmount_nfsmount_ffsmount_cd9660mountmknodmkdirlslnmorelessinstallbootinitifconfiggetoptftpfsckfsck_ffsexpreddisklabeldfddcpchgrpchownchmodcat㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@,-r  @+bX #%r +r#r)r'r @z`?:? 81p* /d///p/////////|////////$%h$bt%b$%"x$bt$pp"@r  $btp "`@bh@K a!(* @r"h r" r" r"x  r"p r"t @p@p@" "r  @wpb@"|stdin-r%s㿘p!r  "bl/ - + )r'p%rp! @͒ࠀ @ 2 `@ %"|  $l @"@ڢ 2%6d 㿘   'pp" ^ ? & @ݐ`& @?` 9 )rr"x  2 ?` " "* `@y ? Ңr" r"h   "   a@J` @2  r" ?`"@&  $ " $* $@B ?"  +rr"p ?`"@& ^`"*@ ^@$ ??`"@& I " I* I"t c ,?`"@&  M " M* M@ ?j?`"@&  - " -* -@ ?U q   0?`"@& ^`"*@ ^@ɒ ?:  ? @?` "@ *:  "  "   ?` "@ , :  "  "* ` @?"  @ r  @blr "b| ?6 p" @  @ub㿘pR!r  "bl+ ) 'rp!%r @b`  @ݔ 6  @g $| T`$l @T`"@E 2buffer8pR"r"d  %r@ "rr  `@ul؀d"`$"!rr@"` $"d  @uc@%r+r) d@b` d@ @ 6 @u"@ r  @ blr "b|㿘@"HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@     /!h!a@^ 0W* :,::::8::::D::P::::::h::::::::::::::X:h:`:::::::h:::h:h:h:h::h:h         !(*?J@ -aJ`  aJ` $!(@a!(*`& @@  ` @JU`2 "@ ? @ @?А !%>$@ϔ > "$>"  `@tJ   `@J*  @4q  `@J`@C   @t  P'@DxH> 4? -* <<<<<<<<<<<<< @E  @ @   @ @ڒͲ   <@3`* .2 @Nq `@  "  @t9`@usage: chmod [-R [-H | -L | -P]] mode file ... 㿘p"`@ax@ΐ 㿘@*$Id: chown.c,v 1.4 1997/01/26 05:54:28 downsj Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@1r"@@t, /  @$rr"J  o`?"b   /#0+r )r@q(?E? )>* @@@@@@@@@?@@@?@@@?@?@@@@@@@@@@@@@@@@@@@@@@  Ȣ  Š    %b%" @ a!(*`& @@r"    @Hb02 `r? rr?"b"r" @@ƾ . 2 *@@Ƹ : *@v @@`@p@`@BK   @sD !)3r%r@C,N> 4? 0* AB,B,AB,B,AB,B,AB,B B r" @D? 0 @F "h@  @= "h@͠  b @L  r0 @M r" "p@~  "  @rbx@group㿘N r""r"@?H 2 @"b$$user㿘N r"@d 2 @ c $$%s: illegal %s name㿐!>$"@ "  bp@rJ  cx@H usage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]㿘r"r" " 0"p"``@@ 㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@w ""  9!5 %p!-+@Ĕ ?O? *H* FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF  ƨ   ¦    &$@ U$%%b@]a!(&*  @@R"  "  @GA`   " @G6a" 2  @KQ!"b̢"@J * 2 $"@J`?. @@$#A aP@G` @4!A@` `  $ $  .,` *A `   AA !J /"* A  $ . &@ @S >"  ah@qP <  3  @@ * " 2 @"  @@$8@@@/8@<  2  "  "  @?@%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8@?Ҕ  @p˒ )AA +AA !/<-@@>4   ` `!@""@& L V2 2`"$@pْ / " @b0 "$"A L / L? / /, $$,"8H @ %`,`A !`J /%`*` ` @J?2<- @2<@2<"` @<  y @AX 0s      " @ 0c <  @" @[@Oa@I(@[@]`?Y "  "  "@}@A 4 <  @I~a 6 ah@o  > "" ah@oڔ "  <@ 2    <@I`0" <@p`? " <@@`? @2  "  @ob4   @4     ?`?%soverwrite %s? 8  @z ` ( D <"Ā :p"``0A@ϔ p!`? "`@ p!"!  p#p! y`? &`@a`$a @`  y YA@z A $ A & @'?   (A@` @a r"+-A@X@@:@2`(`(@  `  (@   @s@q8 " @̒ 2# , "̀@@ Œ @ o"ʐ@Hђ*@  (A@X`  @C@A  (A` @K readlink: %sunlink: %ssymlink: %s㻘 @$#`  ` *<3A@` #p ` A@G` #@ 0 "  @ <mkfifo: %s㿘` 3A@ې`  #p3A` @G   X@`   "  @8 mknod: %s㿘` 3A@۵`  #p3A`  @G   @˒`   "  @ utimes: %schown: %schflags: %s㿘   -6 b "b @ R#$  $  $@ L#$ #A` @Fܒ !@`  `  @G   >`A  @H  >" !A@x`    36 ` @G   >A @H  !A@_`  >` ""@G D  >0A @G D >" - D !A@@`  lchown: %s㿘!A  @GM   >" #@)   %s %s usage: cp [-R [-H | -L | -P] [-fip] src target cp [-R [-H | -L | -P] [-fip] src1 ... srcN directory㿘p"`c@ז(@ 㿘@Y_Y_<YbY_XY_@@Y_Y_Y_Y` Yx`@@Yp`8skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈""`x"  G"b#'%@bЀ $b @B2ab@ =2, @B(bР L b a@Bb'`  @#X @B @"X b@B $X@  "bX`@"@ "X X` @@"@ X @` @Aגb`"耢  @Aϒb ` X #h","@X`#`!` @"X""```X "`X#h"`` @Ab"耢   @Ab""``#   x ! @AbȢ# ?#@c # 4  !` 8   ?#@c  4    `   ?@AZc㿘@K@㿘@"`x"㿘@"b㿘@ "c(@ 㿘@B"aȁ㿘 X @ܐ"c 㿘 X @͐"`x 㿘@h: 㿘@: a paa qa raaaa max nap oaha`aXaPaHunblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 .'D#!1D@nfa' X  @P"ܔ X a@@y@ X a@@p & X `D" \D ڐD㿘@T@%s%s: illegal numeric value%s: %s㿐@ ? b@jЀ c@@5J k m b".  w . . .  'J x   *2  @Z!@ " c @?"А c@?Ё㿐@&  #   b@jVЀ c@?J k6` m b 6`. w6`(.  .` .  .` 6` .  .`.  .` 4,!@&! 'J x % ' *2!   @ 4!@!@  " c @?s"А c@?nЁ㿘 \"`"" *@`2 @ h#bb$ $  @ @  $b $ p㿘"؀ %?"`  "  2  ""`""`?@ "@ ""b"` ?"`""`" ` l)/+""#0 h"@8\ ` `   +   ` `  +  ` "b*?" ` $?$"耢 \`" ` " @֔" %b " b %b  b  ? $b 2 "bؐ?$" $@ $@ @ސ  l """ "㿘#b"bc0` "`! l@c"@  lb@ \`" ` !"" @v" `h`" "`㿘 \ "" @ ,@??""`"耢@ <' l h+"@? " :  " l@l$l% $`$ *@@ b@Z b@  " %  ϔ""@"@ "" "%s: short input record㿘!" 1" @`"@?  2? : " $  #`l`l@`l$`l$`h` "``"` *    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@@73B  @ a  @ a @3 a@yaȐ??&a@@ A stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘c c "c"#cc @c $   6 `@f[c@"B!Ȁ  # 2 @;ђ`` ` " H/"`  X@"&@2!`h "`` X@"&@"!`h"`` "`  6 `@f@ h X @c xc @? $? @e`Pb" h#b耢*#b@  "b x xb@ܐ@ $? @eڒ``""" h h"` $ @  ` @  X  2!  @B   @\  X"@K`!&b #Xl \ ,*  * ( \3#Xk \ *  * ( \" X" #Xl,*@ `* (,#Xk*@ `* (#X"`\@ #P @5` h `@eG <     a@      @ 1 ?  >"   & 㿘 X%#0 5"# 3/#'"+#(0`  2   @  # ?@ 8?m&?+$` `@d@r@S X   @ Ֆ  ``X@]X@ $  @ $ ##2 X" "0 $0@"$  $  @$  $ ` $`X b"`p@o %bX@@ b` $`@   $  `w㿘 `"@ `#h@q  `"쀢@ X@ #`p`p   ?@ "  $`p p @ %s: end of device%s: short write on character device%s: short write on tape device㿘 h  h` x3 #0- |)`@F4 > a @9"   `@d> `@ B  <` x2,` ` $``  $` |  "  | %"!8@c`| "$ a`@9^``h`""``   $`  p p@ 5"@  h h "%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @F#P"@`' '0 #\ dh0 @ @ @    ##  d@@ސ @#@#@  ##  d@@Đ @k%< @H#\#` dHL@Ț@ @T㿘㿘@̐ %sskip reached end of input㿘## ? @     @ ?JH  a@b ##`9 # # @1  * D?%  BaȀ ?"a  @8Wa X$   !@Tc5    a@b `ƒ# 㿐 | | ? @=     @ ?  a@b  | |  7 '  a@ v  a@b     4  g` c  @ 4L    a@be7 '   a@?  a@bS `D  4  4` 0  @i   a@b4 `D  4 ` 0`D   4`㿘@7hiklnt:only one -t option may be specified.retrieving information on mounted file systems%s/tmp/df.XXXXXXXXXXffs%s is not a local file system%s mounted as a %s file system0@/!!#H% #+)'@k ?2? +* |$$`%`$`$% $B" >! @7$b(@"А@̐a!(&* @@- 2@ !@abP @3@y. '@  %!)<'@@i  @@N,`u  '  2A@@@=,`!@|"@@$А@:ߒ! W!" @:Ѐ ,`@:,`@@ߒ 2G`D`@:1 * L`@@@9 @:r0`,`@: $ ",` @,`!"@@`@R < 2` !"@@z<`@@`@ z  .  @f 4 &.   . @@ . @~ 㿐@,ƒ  6 , @ @<  @ L,  㿘B"  B  `?"@     @ empty type list㿘  N  n #@6` N  o  "`"   @ϒ ,``!B`@c* $"2$ @`a   @ ,,`*@`$`$㿘 2B" 2 @,: /- ( +)'` ,` ,`w < ༀ ,@! ,`, L@9 `@`B B5  9 B)B 9 BB 9 BB 9 B B( B   : 0B %5.0f%cBKMGTPE %5.1f%c㿐?B0 B#@#0B8?##(#  #(##0@H 㿐   B?'  B?   B? Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐` $ `  @"` #$ P$`@!$ $ X$ ` ̀  $"`$ "`@! $  @-`"`$ $ @M Ā "$$@E $@B $ @<   "@  ON `  @6 @@    @ `@  ` @6 @@   @`@ ` @6 @@   @`@| $ @ B'' c@ Bc@$?@ϐ! Ā $  ` "@'' Bc@ BBc@$! ?@$@!0$!8@ L㿘`  "`@7D@O  "`!"@גO? @O 26@@ A?6`  &`?&`?&`  @  @&` d " @?@] d?"@" &`&`  @ &` &`&` &`$C2`L% А`L@{ Z`@w Z`<!b@w @w Ȱ  df: %qd: %s 㿘! Ȓ@  Ȓ@-@>" `4 @ p"`%@=bh  usage: df [-ikln] [-t type] [file | file_system ...] 㿘p"`%@$c@h 㿘@bvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffsBNRWb:ers:wnv%srioctl DIOCWLABEL㿐@ᓬ &!`!C  '%#&@Ȁ?}? 8v* $$$$$$$$$$$$$$$D$$$h$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ ؀ "'@ '$  ؀  @  $  ؀ "'@ '$  ؀ "$ @ $ L $L ؀  @  $ T $TaD $aD@ &a!(&* @C`؀   "`@ @"a@C`ؒ` ` ` !@,!HC &`@\!H ؒ?`v&#*`@0p, @ j@@a @ _@p"@C@ Q? @ NÐ!H˒aX@o`&@` & `@\^`@ϒ 4.aH!T , `m@ % &@\G`?  @   ``!@!X3ÐaH!X@9!X@”!@  aH@y@Ӑunknown disk type: %s㿘@28 'a@1@! @ `@} DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %d (0x%x) lseekwriteioctl DIOCWDINFO㿐  !P  '@("@!'"@#!@'"@!@'@"~ !W&&6@ 6!L b!T  e`f@ߔ  >"  '[# !D  `&a@:` '#8@: !T 2&'@[ 6 '#`' `m@ 6&@" @s '#h@ 0$'!T 2  `m@  &@  !T 2  e`g@  '#p@H %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘>"    " (& "(&@B!0@?"(0 (@;"0(@7"0@@ ؁reading label from block %d (0x%x) disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCGDINFO㿘!L j  !D   (#@: @o  ÒaH@c ː &`@Z_H!! !W@(  (  @ r*  A0@ɐ#aP "aP(#ð!Hʐ# !W%(ʠ#2  2   @ L*  ( (@/ ˰!Xe`e@r   )@Z`ÒaH#@& Bootstrap doesn't leave room for disk label㿘`( "&`(&` @ @!!Ԁ)!J  @/hb( *J# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsect bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # size offset fstype [fsize bsize cpg] %c: %8d %8d %8.8s%8d %5d %5d %5.5s %5d %5d %5d %20.20s # (Cyl. %4d- %d)㿘ː)b@ٚH`  B*)b )b`@ى)c @ك`)c @}`)@yc `X )@rc(`X )@kc8`X )@dc@)@`cP)cX@[`()cp@V`,)c@Q`0)c@L`8)c@G`4)c@B`<)c@=`H)c@8`J*`@3`L*`@.`N*`0@)`P*`X@$`T*@ ` , \ ,&  #*, `@\ , *`@`*@` ``C (+& **`a@ **a*a @  #**#* @?a@ǘ``8 @3a(@ػ`8a@@ص``8`T@*@تaH@`8  ?`&  @& *`&*@?`&  @&  & *@ `8 @?*aX@z@`8  ?`&  @ *`&*@@z*@`a`)@\cP`g@!w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) re-edit the label? [y]: C@ "&+@Ԓb&@Ԑ& C@~`v & @~ےmC@C@Į i  +@צb+@עb@C `p"#pp!@l L&@~`ࠒ֐ @!@  @!ÐaHe @{,@T @>?? %?@?a`$a @  n? n? $@ a`$a @ ? n NC@F  sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀,"',"''',@^","@2C@. @ ,@~2#J ,c C@j' @  @  @ 1>@Y" # ,@ 0,#0@U@͐ @~ #(@ '@@DT  ` @5:`  @k  @h  @e 䀠`? 㿘-@!`N` 㿘-@:`L 2,   -@`L` # line %d: syntax errortypeline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐  &`&`/-5---C (#@ G -@a2,@@˒ :2 ,-"!#$: 6` -@ؒa 2(B%#B# 4C $ " @Ò B *@ '-!@|6`-@aЀ 2*' +ܐ@؀  '@耢 - '@a - '!@| 2L@{&`X-@vb  `"qL@ "m 4j@, @"`\ -b @0    -"0@|Q 6`J H6`& -@>bP  `-@6bX `@+ 0-@*b`  @n '!p&`(-@b  @] '&`,-@ b  @O '&`8-@b  @A r'&`0-@b  @3 d'&`4-@bЀ  @% V'&`<-@Ӓb  @ H'6`H-@Œb耢  @  :'6`J-@b  @ ,'6`L-@c  @ '6`N-@c  @ߐ '&`P-@c( 2 @@ѐ  'p@{ }&`T -L` -*`: `@ `-#@`6`*` @@  '-#x@{W $-#`@{L }@  '-#@{= $3, gC ( HC p " @& $ *L@q @ `  @W' : ' -#@{',  *@6 $#@,'@, @  $  @'@, -#`@zǒ° @4#@z @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  0! , 2 00! 2 40!@y   2 H0!@y  H 2 80!@y  8 2 < ,@1 0& 8 < 2  8@) 4& < 2 0"@yȒ  @ ( 0@y"  0"P@y  @ ( " 0@y"h `0"@y I ,`     0*`"@y:`@ݣ 8 0,#@y:` @ݙ 8 0,#8@y:`  <@0,#p@yx:`   < 0,#@yl:` 2 `  0,#@y_:`` @&`a`4%1,`    `a@yF ``,` usage: disklabel [-nv] [-r] disk%s (read) disklabel [-nv] [-r] -e disk%s (edit) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] -[NW] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. The manpage %s describes procedures specific to this architecture. installboot(8)x#&`1ؐcX@ @@*!p"`1@ycx"`1c@t"`1c@o"`1c@j"`2`(@e"`2``@`"`2`@[ c"`2`2@U"`2@Qa "`2a`2@K@  (    *`2 㿘@cannot seek temp fileout of memorycannot read temp file㿘̐!@  "c$˔#0#0 @2 @˖0 :0#@Y  6  @j D2 ({c0  C!\ b C"`""C b!X" @:C@K D(2#H #H*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? "bC" C@"O C" = @" 9 "!\C"!XCb? "bC" C@"6 C" C@"u C!X @Y㈀  @ D2 (cX@   > #0@ B ;#0CaX*aXline too longcannot write temp file㿘@  @Ȑ D(2#H #HN 2 &#@#D(3"8 "8*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * D #$ &# @X(   !@ D2 (c0  @+#: <#0"#$ː @+㈀ "$ː??:0@i D3 (bH @ 0 !#0<@ <`#0@ B <#0 㿘!@3#<&"`"& c@ "c@#< $#<invalid address㿘̒!@@   !@@@@    ̐!@@D4 (`@ܔ ?㿘C"`""C!d +#@@: 4C@HCCC`"`ad "ad<C!D"a`C#@2"adC` "`ad?"ad(CC!d:`@CC` "`ad?"adCC̒a@"!`C  "!dCC`"`ad "adCb? "bC" C@  C" C@!) C!`/tmp/ed.XXXXXXw+cannot open temp file㿘"#"c@' ?* 2 Cah4bb;ah "  2 @f* ?"C4@!cˀ "c?C@ C@x!hD4 (c@- @'?@'} cannot close temp file㿘# @  C@U!hD5 (`@   ?"#C@ڐ!h"#$  :c0 㿘# @C@Ɛ!h@ 㿘p!˒b@   ̒!@"!@"` ː#*@``$*@ C!x!x˄*@"!x*  ?ː(? 㿘CC"!"a̐!0 @ @А @ې ˢ#`@~2 ,  㿘C!C!Ȁ@"̐!(@7$!C!Ȁ  Ca̐"a̐!( ?㿘3Cà  C̐!(@ C"a&aC!Ȁ  Ca̐"a̐!(* `?㿘!C!̀  C̐!( @C"a$!C!Ȁ  C̐!(a@  ?Enter key: 㿐5@B#N  @ @2 @: @,  㿘2D>@"D@4 (?Ѐ66X(4<DXlـٔ٨ټ\\\\\\\ 4H\\\\\\\\\\\\\\\\\\\\\\\\\\ 4HK I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?bad hex digit in keybad binary digit in key㾘N@ 0N` x X26N@`N@  %6 4 N@Q , @?"=h N@   4  ,    "? ,  ? `*` ? @.  , Bˀ 0BN` b B<`N@  %6  ?N@ , @?" N@   ?4  ,    ?"?  , *  *`@  .   ː "c\@ des_setkey㿘#\  C!   @ 2``$ @   ?.  @a 7 des_cipher㿘`-  ̔!0@  .``$  ?@  7!`̒0*0 *` *` *` *` *` *` !*`˔ c`@".  ̔!0@  .``$  ?@ٔ 7Y!`  @(decryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @U I / / / / / / / / @? 7!` ̖!0  . $ ̒0*0*`*` (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X*`*`*`*`*`@ڨ2 N  7"@S 7"耤 ?7#ݰ?invalid pattern delimiter㿘#pJ   D8 (`@ B?@pJ, : @"p@ !#8#8#h4* +)c `    @蝘   2@ Ť#h@  p unexpected end-of-file& no previous commandout of memory㿐   #p8@lb @ ?D8 (b  8 (b@ @k?08"@%)'%CC"@l "̰ g %#< #< @f p!@G ' @J?  ?4   À  8 @b   8@b8 2`Dp@  C" _ Cb "b "&"@@챒:C@{I D(8"X "X*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? g"bC" C@M C" A?@ =?"" $Cb? "bC" C@5 C" "@t @"#pL@ L!@& @   #p#<@ #p J 02㿘# c [#Cb $bˠb#@(, 9@z D(8"X "X*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * b? $bC" C@Ő C" &?@ "?"# "#Cb? "bC" C@ C" @ `"#*`"  㿘)3ˈP 6cP.@ cP'@  !4 !cP ˒l˔* cl  l(ll6   l* 㿘#Cb $b"#P"cl"" !@D#$#b? $bC" C@$ C" @c rcannot open input filecannot close input file%lu 㿘N ! :@ 6b@c:@Hb  @yÐD: (b @;6N)? !@  C0@@  C@yD: (b  @Z?0" ::"8"@p"`@##<&newline inserted newline appended 㿘b c#@@`?""cC"  q"#<3C%C@Nb &b#  b? C&b  @  {?@ w?$ #< @"D b? %&b  @a  ]?@ Y?b? &b  @N  "@  B? `:#p#   #  ˀ` #:#p@yb`# #  "  ː "cˀ cc"c"c@"cC"   "@out of memorycannot read input file㿘 3+C/5DD (;"h-CC" " Ӑ? % @`% @`  @d` b c T b %b bㄒ" @ 24&c@x ; "h.( , , , , , , , , , , , , , b? %b  @  ?@ϐ ?%b? %b  @{  @ *,`  ː "c # b C"`""˒ b#" @鉒:@x! D(;"h "h*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? <"bC" C@% C" I?@d E?"#"#Cb? "bC" C@  C" ` @K ` 2 #*  @ @wǐ D; (bx@| ? # *@ ː "c#*# #  2?wcannot open output filecannot close output file㿘N ! <@c@!@` @wD< (c @36N,? !@ N C0@  C@wdD< (c0 @?0" ::"8"@p"`@&  㿘(C"  C`&C-+)˦ @C@@ `c # *@ @ ?`@C" k  "@cannot write file㿘"" !C#D%="  N@`2  0`@   @v `(@ꠔ ?" unexpected end-of-file㿘#pJ@ `#p"@@N ?'k#p'C"L b C"`""C"H" @:C@v D(;"h "h*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? R"bC" C@ C"   @  ""LC""HCb? "bC" C@ C" !C@А !C"Hcp@"H *?35D1C-C+CD (;"h/C@& a @J?  =(b0@ ڰ "L T  % bbH" @炒 24&"L@v ; "h.( -  -  -  -  -  -  -  -  - - - - - ? %⨀  @# ⨀  @c  %bH? %⨀  @ ⨀ bH@O bHa @鎔bH`@T  bH *?C"L b C"`""C b"H" @:C@u D(;"h "h*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? T"bC" C@ C" " @  ""LC""HCb? "bC" C@ C" C@Ґ CbH*'bHstdincannot read stdin㿘  9pp!7-C+;DD (;"h3C5 ? % @!`'! @j L U   % ba " @ 24&L@u ; "h/`( , , , , , , , , , , , , , ? B%b  @  b H?@` D?%a ? %b  @  b a @L a *,`  ː "c` 2 cX "cX @?@t X?`(``@t  ?5 &p? ?5 r a a *a &p%ld \  \abfnrtv\㿘 ?@# ?5p#( C #耤?# @t "N ^*`:  \?`}"@~ 2x{ ?`"@ \ " \*@s N`  @ѐ "?c8J 2  0?`"@  `"*@ @sӒ  82  0?`"@  `"*@ @s   0?`"@  `"*@ @s  ?`"@  `"*@ @s \ p? " " * @sz  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file㿈'@'C" @,@`$ $@@J? r`?$+@)'>%C !C@8b? s"$ x p" pp0%# $"C"`c@@' a(*`' 'J -C "" "( '?'@ @݀ "  U@Yc̐ U@UaĐ @R  U@Nb@ @"p@s<b`D(@" "*( `* `* `* `* `* `* `* `* ` C* C "b  J@ @  @0 #J@ ! C@"#C @#p@rb`J D@ (c@{ @ #C{ #C!p3Dp"/-@p"`+@%@)p!  b @"`c @1`(# @r’@K?+t #C" @r@`(c(@< @А 2 b c@X#X@`(3  ?4 %t°?+ ! @J?  @`(c`@  ?4 ?@d""?@1 #<@ˀ? ???0221 %t@r["`@`(c(@ @|  b )c@'X@q  b c@X"`#X@`(0 "X@# "`@`(̐ @r0"`@V Z b c@X"`#X@`( M 㿘"!8#<"ch"8#'!1%@<a8 $a8#h$8$#h#pJ , ; #p &#pJ ;"$<0̒!8!8 4  "@#h ch"#8@??number out of rangeinvalid address㿘#<#pJq @ `   pJ@  `"pJ`  p#p#B#)q#%D'B+˲#hcpJ? U*   8 8 88888888888 cp`$cpJ` @ ` cpJ@  `$cpJ`  cpcpJ    cp@;  @@ ->" " -B(bw  ^2w u&    d - ^2_ h?^cpcp@  2P >" "K B(bM Gcp  .6$cpG#<>(@ / @ ;`?9cpJ@, `)$cp*cp`$cp@J` *?cp $cpa8 "a8 ;#<"ch &@c@cp ?c@ ( @2? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘  #pJq @ `  pJ@  `"pJ`  p#p"#pJ`pKD!ȓ*`@22222222222222222222222122222222222222222222222222202222222X2p2222222"h#H2222,L22222222228$,H\4!2!#H$%*H+,L.2/T cpJ n"   p l" 2 cp "cpcpcp"cpJ D" 2@@ #h #<@  cpJ n"   p l" 2 cp "cpcpcp"cpJ D" @m#8@ch @ #< ?#<@ } cpJ n"   p l" 2 cp "cpcpcp"cpJ YD" @2#8@dch P#<`#@@$   EC"#<#t C" 8?!8 DC (c+ #pJq`  DD (` @ cpJ n"   p l" 2 cp "cpcpcp"cpJ Dː @c@ &?@+ &? 6L?  !C"@PL CJ" 2LDD (`0͔  C" &ư?@"#tDD?"a"!8 DC (c #pJq`  DD (` @"?L ! DD (`H cpJ n"   p l" 2 cp "cpcpcp"cpJ oDL C"@C@"@0h" DD (``\ ː @]c@ W`g `G  L`G `V   cpJ n"   p l" 2 cp "cpcpcp"cpJ Db "b !8 DC (c  cpJ n"   p l" 2 cp "cpcpcp"cpJ D4 (!8 DC (c  cpJ n"   p l" 2 cp "cpcpcp"cpJ DC ""@ `""D (J ( p"`@@c 0#h  DB (b cpJ n"   p l" 2 cp "cpcpcp"cpJ D" 2@`#h@ ?g #< @~` x cpJ n"   p l" 2 cp "cpcpcp"cpJ TD" @-#8ch M@ / cp"cp#h JDB (b7  cpJ n"   p l" 2 cp "cpcpcp"cpJ 2D#h@  #<@   cpJ n"   p l" 2 cp "cpcpcp"cpJ D#8chL #<@ #8#h !8 DD (`Δ #h`#@ DB (b ch"#8@ "ch  DD (`  cpJ n"   p l" 2 cp "cpcpcp"cpJ D" @g@ p #<@  cpJ n"   p l" 2 cp "cpcpcp"cpJ ^D#8ch” #<@] W cpJ n"   p l" 2 cp "cpcpcp"cpJ 3D#8ch !8 DC (c'  cpJ n"   p l" 2 cp "cpcpcp"cpJ D˒# #   >"Ѐ 2"@C#"@!8 DC (c  cpJ n" cp p lcp2cp "cpcpcp"cpJ D#t ϰ?C" ʀ`q0#pJq`  DD (` !8 c@"#h@* cpJ n"   p l" 2 cp "cpcpcp"cpJ D" C@aC"J" L ! @L 2 LCJ" 2LDD (`0k  C"+ch&c?a#@]ː Z"ct##%CcpJ g"  p ". ) 9( 0%  cp r"   cp $cpcp@  C"# @@2 >" " Đ ?$Ā D cpJ cp  C#  DD (`   C"##pJ@  CJ` CDD (` #Cb  "b %C@ b%CCb? "bC" C@  C" װ?@  Ӱ?@ "C@@ۨC"#C "cCb? "bC" C@  C"  @    C#C@ cȀ " Cc cĐ ? "cCcĐ "cĀ CcĐ  ?"cCcpJ n" p l 2    "cp "cpcp#<@o i cpJ n"   p l" 2 cp "cpcpcp"cpJ ED" C@CCC#c@" #<@: 4#8#h -!8 DD (`! #h`#@ DB (b ch"#8"ch cpJ n"   p l" 2 cp "cpcpcp"cpJ D" @@΀ !8 DC (c۔  cpJ n"   p l" 2 cp "cpcpcp"cpJ D@ #pJqQ˰?cp "cp#pJq`  DD (` @!8  #@  "#h"c8 @c@ &? cpJ n"   p l" 2 cp "cpcpcp"cpJ `DC"J" L ! @͒L 2 LCJ" 2LDD (`0J  C"`WDD  ː 8Bh7#@2"#t#t .C" *q"(?0&!8 DC (c  cpJ n"   p l" 2 cp "cpcpcp"cpJ DC"bː "c8#< @` ˒#p#p ?ϐ  @ C"# @#@2 >" "  DB (b@$ C"# cpJ n"   p l" 2 cp "cpcpcp"cpJ D˖#hC#hc#@@ 4 @  0 cpJ n"   p l" 2 cp "cpcpcp"cpJ sD!8 #h#@D@z!0l!8 DC (c` @] cpJ n"   p l" 2 cp "cpcpcp"cpJ 29D #H@# @D`#H@ C" /D@9!0+ː "c8#< @&`  #h@ ?DD (a DB (b@b C"#C (c @Y?㿘!8 "#8"#h#8ch 4 D #@@  DB (b@9 ?no match㿘ˀD#<'+)ˀ`@  ?,@#<BѢ+c ` ?   @ #<ڀ`D(L# #*( `* `* `* `* `* `* `* `*?filename too longout of memory㿐#pJ` Nq @  pJ@  `"pJ`  p#pJ  D@ (c@ڶ  " ˀ "cppJ@ !`@"p ' #H@# @O`#H?  DM (`@ڍ  C#Ѐ`4]'!C" $"Cb#@%9C@f D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * "? H$"C" C@ C" = @ 9 "#C"#Cb? "bC" C@ C" "'@ '#pJ C'c#p`##p @* #pJ 1C#*@@#̀ #̰ shell access restrictedno previous command㿐'C"  DN (`h _ ˦"cp? C#؀ b C"`""C#Ԑ "&"@@|:C@f D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? "bC" C@ C" u?@W q?"#C"#Cb? "bC" C@ C" C@> C#Ԑ !*@˒#pJ Ϥ3C)C/C5DD (7MM!+C-C#cpJ !k %Ec؀ S " %" bԒ" @ 23&c@e .( ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` "? E%"b  @ b ?@ސ ?%"? %"b  @ b @ʐ p *@p%pJ \UԒ%p *Np_c؀ S" %" " "@֑ 23&c@e) .( ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` "? %"b  @3 b ?@s ?%"? %"b  @ b @_ p`%p @*#H NJ  N(9`#c؀ S" %" " "@% 23&c@d .( ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` "? n%"b  @ǐ b %?@ !?%"? %"b  @ b @ ˖#H`˔#@ {p *@H  opCJ" C@"@'c؀ Z" %" " "@ծ 23&c@dF .( ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` "? %"b  @P b ?@ ?%"? %"b  @< b  @|  *@??'p`%p cpJ Ccp#T j C"`""˒ b#H" @>B@c֐ D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? "bC" C@ڐ C" 7?@ 3?DD (`0 @T?0*"#T"#HCb? "bC" C@ C" !@ !C#Hc@6"##H*L ! % 㿘 "#<-p!)!C'C+" #p? @J?   ?5 u` N #p %#pJ  #pp "pJ p#p"`  N . "N  "T " $"T"? $"⨀  @F ⨀ =?@ 9?c<c<$ @  "? $"⨀  @' ⨀ ?@g ?ː "ct"? $"⨀  @ ⨀ {@O wˁ 㿘 `#@@  ⦐@rD5-C3C9D (M!/C)` V  %`"cܐ" @ 24&@b M !/ ( , , , , , , , , , , , , , ? %⨀  @ ⨀ ذ?@ ԰?&c? %⨀  @ ⨀ c@ϐ cܐ@``@@ " b C"`""C b#ܒ" @ӝ:@b5 D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? 8"bC" C@9 C" m?@x i?""C"#Cb? "bC" C@  C" C@_ C#Q"X "X*@@ *`@Q !A?$#<Cb "bC#܀  #<@ ϔ Cb? "bC" C@ C" ?@( ? "ctCb? "bC" C@ѐ C"  @  㿘#h #@  #8? #hC Cb  "b\YchZ"#< @ r  #@@   @ f Cb? "bC" C@ C" U?@ Q?(#8  $" `"`$$$`˔#<#86 " #hc8" "" 樒ː "ctCb? "bC" C@0 C"  @o  㿘!#8 #h#8" ` ˀ@"#< `& `"`N1C)C?-" &"@+"~$#< @ ͒  "? &""  @ " '?@) #? %t"? &""  @Ԑ " "@ @¢ #<w ` 㿘!C" $" @  `"? $"C" C@ C" =?@ 9?#@@  HE?" "$$$`@?&@" "@ː?"c<ː "ctCb? "bC" C@n C"  @  㿘  `DB (b@ $?#@@ @" #ފ `$c< w &?@@ invalid mark character㿘q @   DT (a@Ӫ ?" .`@ c| "c|ː" .`"@ 㿘q   ː" . ߗ@ DT (a@Ӄ ?| ˖ˀ`*`  |"||`㿘@ː  >  %& @_ D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` *  㿘"  N \2 `?㿘C#䀢`\ %C $Cb#@п9C@_W D(M! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * ? $C" C@\ C" . @ * "#C"#Cb? "bC" C@C C" C@ C`N \  * C#㿘C"  C? *  "@㿘C"  C? *  "@Oed.hupHOME㿘C" Cߋ C? * *@"#@0U"PD`$  (U@Ђ"X#@X  @ː @wxJ /" /.*`U@wbPːD` @O 㿘C" CE C? * *@"̐ @?㿐C? **@" `h@   C?"c C?"c..㿘C" " N ! V@`@ @͒ /   DN (`h@  invalid pattern delimiterno previous patternout of memory㿘#pJ D (V  ; (::[2*:   #p"#pJ  *D!P  DD(V  :(; # D<!P@J: "7 D!P` C# !D@  C!D@  $!P@]ِ D(V  :(#  3 C"#!D!P@_ 2!D !P!PD(@M!'@!P$!P unbalanced brackets ([])trailing backslash (\)㿘#p @* : )D)D ('VV"ȑ*`:   [ \`L@@``= ( < < , L@ i`L@ @#p$@D!X L C"`""D b!T" @Ē$D@]\ D(V  :(#  3 Cb? "bC" Cv C" B  > "!XD"!TCb? "bC" C] C" 1D 1D!!T#p@ڔ!T*$#p# D!TD (V""; (:"2 *!T  J^" J]"  ]&(8 ![2 J `.`:`=2  J ]   J]2J 2J J] J]@?number out of range㿘&@&#pJ "#(G @V B?#pJ 9 pJ, : @ː"p˒#p#p ?ϐ  @zϔ  @&@#@2 >" " DW (b@9 &@?#pJ g2  #p`"#p & no previous substitutionout of memory㿘 p"pJ % J-: @ː"p#D  DW (c@ #D$p#pJ-: @D3)C+7D (X -C'5̔ cx N " %" bcD" @} 2.&cx@\ X .( `, `, `, `, `, `, `, `, ` , ` , ` , ` , ` , "? %"   %cD"? %"    cDP cDp`$p @*  pJ@ "?\%pcDp`$p @*  " pp!k"    @J? ` ?6 u pJ-: @w  #x b C"`""˒ b#D" @:@[ D(X  *( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? "bC" C C" # Ȑ  "#x"#DCb? "bC" Cp C"  "#(cD*cDno match㿘c<#8"c< #h s +'C)Cc< %c<@&?Yc<  y#@✐ $2✐? j$"  $ " m?d i?c<c<$ @ ✐? K$"   " N?E J?✐? $"   " "0 c<#hc8" c<ˀ"#<``D(Y *( `* `* `* `* `* `* `* `* ?` #<W ? infinite substitution loop 㽨'    # ` P `'  @ 5)C-D (X +C`"@t$ V " %" b" @˙ 25&@Z1 X `D+`(`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` "? 9%"b  9 b O?y K?%"? %"b  % b e # $ Җ @͛@( n$!? W" %" " "˚c@@' 25&@Y X `D+`(`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` "? %"b  ǐ b ݰ? ٰ?%"? %"b   b  #  ` @)$ L  ` 2`   @  ` #@ # b C"`""˒# "&"@@ʟ:@Y7 D(X  *( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? <"bC" C; C" P?z L?"#"#Cb? "bC" C" C"  a   $ 2` DY (c@̒  ?#  ٹ !#@́#@Y# #*@@ *`  㿐'#D#( A3+C-D (7XX /CN &c \  "c O b %b "" @ 2.&c@X D+ ( , , , , , , , , , , , , , b? F%b⨀ >  9%b? %b⨀   ⨀ @ @6Դ@*@`@ ˴r N 0m 9lc? h *   "c Pb %b  "˘#@z 2.&c@X D+ ( , , , , , , , , , , , , , b? %b⨀ ̀  %b? %b⨀    ⨀ @M @6b@*@`@ Yc Pb %b " "˘#@ 2.&c@W D+ ( , , , , , , , , , , , , , b? v%b⨀ n  i%b? %b⨀   ⨀  *@ #D& #(@&N # b C"`""˒ b#" @Ⱥ:@WR D(X  *( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * Cb? "bC" CV C"  ? ?"#"#Cb? "bC" C= C" | #*out of memory㿘D!DD!؀  `d"ؓ* @ @N*`!D$!#Daܑ*` * "a!ԓ*@ *` "ֹa!ԓ*@ *` & ,$a@Vɐ D(]! !*( `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` @* !D@!$!D"!ذ nothing to undo㿈#<#@D!?D!䀢? DD] (c(@B ?!܀ ː "cta Cb "bD!ܐ@XD!ԑ+` *  +`  +`@ =  +` *  ` @" @  ,"`@ *` `"`"`"`@" @ *`@ `"`"` "` "``"``" +`@ *`  " D!ܔ `2  : *D!D!ܐ2  :  +` * ' ''` * @*` "" """ Da"<"aDa"@"aCb? "bC" C C"  >  㿘'Dܐ??!$)Da!ԓ* @*` 2 ``@ @@@ܐ??$D"!D#<"aD#@"a㿘@Ҕ㿘@ƪ  2" @$ " 㿘@Ɲ  @S &  @$  &㿘 @Ƨ @ƥ2  '"@& J-`?    q*8 ((J J 2 "@ 㿐 ̒  @f & & %d㿘 @7  @$6  _8@  && 㿘 2  `?J   Ɛ "   |&=<>+-*/%:()㿘!X 3 aX "aXL`&L   =_"@wS "L  L <  > ! 00   3"a\̐ "a`syntax error㿘 _@Mc㿘!` !!\!` @!` %sh!` ROM`@ " @!_ c@  @ Ȁ ̀ ؀   *@ @"@  2_ #@ِ!` non-numeric argumentdivision by zero㿘.(ؐ `Ӑ  ` @a02` @`&   ` @aH @L`& @H`& y!` ? 㿘 `  ` @ma0 ` `" & L!`  㿐Ԣ A ?< :?` x`#l*`@00000000@4a  0^@6[  0X@&U  0R@$O  0L G`?A DB?` ;a `*`@00000000 @> 4"  0 @684` @02  @+ $  0  @#`? @@ !` m k? h? e㿘[!` #Q   b }a` 㿘!` #ΐ b^a` %d %s 㿘@%` _@ےc"!X!` "@@ 2aa""@m`@q㿘@ lost+found㿘#* c  @@ `" `  " `@  $  $ " `@*@@  ͘  *@  J 2    "  wrong type to dirscan %d 㽘N 0`" $b@4 h   a 2 ` aB  "@2`* @ *` >   @&`4 @   =   b> 8 & @<&ͦ  `@Ô& ( @ @   "@Ű, -2@2`  4   2     DIRECTORY CORRUPTED㿘  @`4 @b !8  4  3  (.  6* `@@ 2#  fb@+\b0 @=`  "4 " , , ,  ,` "&  ~B?\>  4  2W   (S  6O  `@ &     b>  !=`:@  25  (1@1 2, ` a >"@""@ & <  b>   b@*b0 @ג`@ 4  ,`  " @:; `. 45 22 @2 `,   ? `  `   ` ` ` H  /   &HH`?㿘 @%s NAME=%s %s=%s DIRFILE㻐c"@@ c@k>"@)є` @c@ѐ@%b <  cc"8"@c"0@0c" @UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@ T .`>`  @ Ecc@B 0?  @ <  2cc"8"@D"$c@#@ T ,`: c#( @jɔ"#  6 cc@j"c@#@c@j#X# 2  c@%*#h  "@4 㾐 (@ ,/    ` `  " 6  " 74   $4  # @, , ,    ,@ÿ 㿘 (   ,@ "  $ # @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u ` @A 8@@<  `?"cc"8"@d@"@#  ` `  # 2 dd@$A"0 ! @i" ! M@Z Db$' /la'Ē '@ d1$ @"@# !d@$"X $!D  @($ D @$ # d "`! @s $ # c"@iy 2dZ"p@ <  7d@3"d@#ܐ"Ȁ ! D  @( $ d,"D͐ b$@| d "@#͐ /z!''` ,`*`<:`` 2@   J@ d#@ 0R@# @a  d#0@ d@i"0> .  ?72 #͐!d#X@4` 2 !̀`@@#X!@ ` @>4` ! *`  2 d#`@Ò d#x@h .`  2 #  c@hא" ` @ 8 /d!'''''@c@ X G C`A@? @ 8 /d '?''@F "@y` 2```aB  "@X2`* @ *` @>`@Ӓ  @'@ @ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘  @^P 4ڰ , ( "԰     @&Z 8ř,  (# ,# (` 0 : @ B > ` 0:  h & h ͐``P* :  8      0  e< eD`L  ,@5 ` s,`@R"'@&`0` d,`@D"`"`0  )D",@7 "` 0@  ,`, ͒  P*@:`       0  e< eD`L  ,@ ` ,D`b,@ f!@# ff@g! @"!Ȁ  @,` , ," (" ,  0 :  b>   0:`  h" & h @&`8 㿘@ʒ  DD"D"\&@&` @  (@`4 4@ b  4@@  'D%͐,@ b 4@@  . @4     2`@ '  ? @ @ @*@J   .  2@ ,`@  2@ @  @\4 㿘@ @O2 @㿘 `   @C 2 ?,$?@6  0,@1  #,㿘# ?"@"."cDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ &@&`$ >`< @@@(@+x %(:  8ܰ   %( x h x˰ @(` @b< h@f `@"# @”   0?: @ B  @0; Ѐ] +ͦp``e<@ :e@@ B `L ;  @ @W`T&`` 8&` 2+&`N`0 26 2`@$Ւ h (@h@  P`2% @`% `: `@`0: < h@f$ `@j"# N`0 `@ ] R Ѐ ` 8&`` 0+  * :  b ; Ъ p " N`0&`@; "+ 2̀2`"`@$t h (@h@ O P J  t: @  d``$ PARTIALLY TRUNCATED INODE I=%u㷐M 0  b @ 2 0  @   !  @ `0  0 : #` t: @֠  `  t: @8   t@  b: h@ei `@"# ?%z F@B@  t D@+.   t6&*  .  ̢9i    p@d @$u " $- *#@ . @:99h `% @^  ?#%M 0 2  @#  (@ǒh@p P`f * ?% blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘c 'U @`@K``,@F``  `@= i#@d@0  ,@+ @ i#@d@ % '@`@ Đ@``,@``j @dv j @dp  bad inode number %d to ginode 㿘  j!@ْ!l`   x@ 1 @ @  ,@@  @ @ x `*  쀢`!` ?"` @`0"`# @j x@ x$al  @``x*  bad inode number %d to nextinode 㿘#Ē "# +j#(@z` =#d"#d @6 @z  ,@@u  @( @& x `*  d,͐@`  #`#l %`#ct "! #@ ٔ#"ah!h "!hCannot allocate space for inode buffer 㿘"!l"#" "#d e<8`H "c̡4 "#t)`@% %`@|$l̓*  "` % #t"cl#"c`!# 2 @## $#k@ #Ā !^##Ā 㿘# "@("#cannot increase directory list㿘  0?:  @ B  @;  8 ,@ $7!͐@x`* # $@" $` $``$`$`$`$`$` $`,$` `$@a (#x@2̒`d"x!#@*` $#k@"(`"#*`" cannot find inode %d 㿘͐@9`c* @  k   2 k#@^㿘# #* ?c #@?c#@c!@#$#$c (%s %sDIRFILECLEAR (CLEARED) 㿘F <  2ll  l @m@h # 2l@ # l@b ch?"ch’͐` @    * 㿘 ( @2   ,@ 㿘 (  @v , 2 `  @8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐l"X@b' 7 3l@b"`@  pl"h@l"p p@b l"x@b # " l@l@a"l  @a" '@]il"@a%d %s I=%u BAD STATE %d TO BLKERR㿘l#@l@a֐# J "    4̀  0   *@  *@ l#@9J@㿐   J \  ͒   `J "Ͱ  *J <@ @"(@ 9 @4     *@@  $ (  *@4@Uې$ $ $  4 :<  4: $ hch "ch #6` *@` @ 8 /z!''ߐ͐` @ ~  *@ch?"chdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o %c option? 㿘@ @-̒ *#|m#'%>+)D#!m@Fx +8sm* l l %,|m bb@p "#Xm@`"m,|m cc@a "c` %`,|m mc@R p%"(m@# m#8@`"(m ` ,`,# #Ȑ ,#,`m@#Xa!(&* @ @*   @$c\#  @cĀ  @@`  @  ?# 2 @-%c flag requires a %s 㿐@d"nJ n"`@ufsffsrwro㿘 n@tObЀ "   n@tHb؀ 2  n@tAb "   n@t:b耢 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** (#  @c!̐@# # n@ #@?l  # fn@#c #  n#@_`@ "nn@_#n@_#@O# # "oo@ΐ o@^ (@# o@^ P@# o@^ p@ # o@^ @ # o@^ِ @ #%``'!̐@a`8o h#@ . * * @ (. "* *  (2`@ :@ @ o!@^  Ȑ `"@h" `$ho@^!0 R' ``" @`,㼠$`$`?`4@t $!̐@ `8#"@$ `$o@^p!H!# o@^i!`#  o#oa@^a  2ao@^Z!!#p o@^S!#p  o#oa@^K  2ao@^D!"#p"#f"!  ͠  @R  , # )͒ J Ā #  ,71 @``,@```d, @  ,@b @#@ @   5# 2o@]!# o@]!@f "!o"@똒 2W@'''n"ؒ" @ "  # o@]Ɛ" @l 0 ` ͒  ,>+̨ `@C``,@>``!  @2``,@-`` : c   ?$- @ @*   ` ,` ``?`4@g 6̘   : c   $ +   *  @ 8 /t D'Ģ "#"ch ͒ ` 6'̀`@o  `` ,& PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘Ɛ@< 4`(͒`H@~ 0 q`X͒`x@~ q@  q` q` q"@ rq@"  =͒` @   *@"#  0 :`@ B B?` 8`   "~rq`` @\s"wr# <2q@ސ"   4 :<` !4@  0?: `@B @ ; @6 "Grq#@\;?r@@((w# B` ` :` 5 2`h` ;0`h +#\j ?#` `( d`@"+ "q@ #   ` ,q#8`` @[`(@5` 2$`h %(: `8``   %( `h  ``B   @    ) @P`t?   4q,  (`  "r@[`r  , 􀤠  ) @`t  q,  X`  "r@[xr  , @ ch "ch . `2 T` @! 2"q@ 5#q@ސ#  q#q@ ccp""cp`  `     *@  *@#4 *@# "`?"А`$`p?4``$`tp4`"!t"ap&`g  4: @`$&`$`h 0q#@ # rr@[ 0@~  `$" hr @ ƒ!  *@q@k"    *͒` @1 .BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   $s cޔap "aps#@  # qt@Z  @#  q#q@ !c $/-3q5q7q#+̀ ǒ   u   :`J   ?$:@ 2t %  : ㈘   ?$ *@  N*  `at "att @ - # t@Ɛc 2> @ ʒ@ 2 "t@  0@c . @ a a$a%c"@""@ca@ `"a@@ 2`a@2 $`2$a $ & $~ ` @V 8 /u <'#"ax ͒  ,* )͢ ` @6'̀ (`"`' J  & ` @ ` ,ܢ DUP㿘  2 '-u+͐  2 x a  a 8Ҕx $ " $xa"a 2 a x@ բ`ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..' ?* : `lu"ȓ*`@׸t\<׸u@ ! u@!8  u!Hu@ aP !퀢 "Tu@ !Xu@ Ր!xu@~! u   |!퀢 "?u@ y!X@m! 27u!Hu@ oaPu@ !u@_! u   ]!퀢 " u@ Z!X@N!Ѐ u!Hu@ QaPl  / 2  u!@ @J`    *`# *`#!c# y@iyȐ @ 8 /w!'#* c  @Ș8+̤@@  F  u 0a"$ u!Ѐ!% @ u" @ S"c u@Xt"@ ! >$ c u"P@     :  @ 7@  ?Hh $@  ' '̐`@*@#@J+u'u%@ `"?`  ";`  6?4 2u$ u  X@aЀ "(`  ch  * 2  ϔp@aЀ "`  *`  2  *` ?2  $  h- `@*@.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 (#  `  @# ,  $   'v@kc 2"     vc $u@!Ѐ "` "a $  \v ђc P, vʒc '  // /v#7  u@kBbh v#@Ԓ3 $6w@ː * $,`@6 7@=u$7@5 $ & $ *` ?2  @+4u@Q!Ѐ "` $ 4  '  // /u"h"h7 `/ $    @z"@74 $ & $ *` ?2  @4 u@jʒbh %  "X  Sw *`H ,u@!Ѐ "H`G v@jc  u  &Xw `@5?   uXw@( ?%  u%    X7@u@!Ѐ "` $ & $` *` ?2  " ` `8  $L . $ `2L  w`$u@!Ѐ "`` .2 $ w`ؐ & $ @  wD $   2     2 w꥔ $ ,u@]!Ѐ "`  @?* : `y (*`@@DDxx $ w  {w@7! $  J@ 2w!0# } w!8 `w@!r= <    *  *` 2   & $ $ @ @  w!Pw`@H# ww@Ug!  $@ܐ!2 $  %  ! #J @  w# @,u@!Ѐ "` *` ? 2  w!@J@ ` $`@$$ 㿘#* ?c >)+ `"3   J 2+  J $  `  J  `@ `  $ $  *` ?2   *@#:UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @ 8 /z!'Ġ #Y'z #%z' ?* :  6* @x , R@`cp靐2 "/ "cp2% (`  ` z`z` z (J@@ "$cp@?   #('ȁ㿘  `M '+)̐   >  & $@  :`cJ   ?$:@ %㰀   " 2  2  : c   $  * *@* #?%#` DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?bȝ #P?#H@?,   *` @``5 # $eL`X !e$ # z@c#8# 2 %e$z@ #X " `X%e$̐ "c͐  * `X $eLe$  z #pe$`X@```z#x`"eL`X e$ %e$`* @eP*  ``,`: `@`@:`|`,`: e$ `0* `@``|``@(* `,`: z ̀z#@P%e$# 2z@ # E# z#@`* @eP*  ``,`: `@`@`|`,`: e$ * `@``|``@ߓ* `,`: @ e@ B`L ;   %`̐ "c͐  * eL?  nz T?< ``"`: !@"U?, eP?4  V%eP% T`,  % X`@:eP* % \``,`:  \ % `e$  `@)`@`|`,`: ! `@`@}`| , :` `@ % he$ *  % l`@ ``|``@h* `,`:  l % d@"U%  ?<  \ T"@ d" #@eL@ @  @̖ ,"*  * 0# 2" , @ `$`8@    ̘ : c  $ +  *  `,6weL@"U @``.@`` ̐8 @ ` Ԁz#@Β@```$4% % `,?2``@`5 5 &% e$  @`8% p% % $% `% ( @6% (% (, @6% ,% ,U 0@6% 0% 0 4 @   T T @ @eL??, @C` `F }  ?* :  +*       %  ?% :  " \b  ?$. @ *( { J@@` # :  " \b  ?$. @* ?%   `85 ,`:`J ` ` ?"@: 2, :  c `    " .  *`8Ғ`8]  % @`|@` ,`T T @ "@@`|@`@`@y`@`@s`@@`@meP@`*  ,   X@^eP*  4e$ <@`8 & :  l@`8&` ?"@. @&,$ $% $:  " `@ @ ?$: `8" :@   4@ `8De$ 4  h l   p@ @ ` ` e$@4*`  #   *   p瀋@ ` e$@4*`  #  $ '  '  '  '`p> *`@`l.* bؠ @ro  @{@h`0  $ $  $  $$ ͐ * # b` " \\ @rD x{@=`X \ " \ @7̄8(?<@r"   T TTT @r !{@ `x ?<@ TT  T T @̆8( `,eL??4%eP`@qݔ  @{@֒`0  =`=`-`-`͐  * E E $EE 㿘'H'L'P'T'Xp"`@H@ؐ %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  E!$ E!@OSa@ E!$  @OF! E!$  E@!a@O9@ 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘>@M""ޒ㿘'H'L'P'T'X H@i 8@ /@y <  L  r @MN /r㿘@ے /1,!@M> /,!@MTcА!@MQ ! /Can't stat root Can't stat %s %s is not a character device x E"! ! @@y[ 6 @@N H0M@yO8  @ `@N@<  "@L@Ea  "a @y1؀  f `@Nz"<   p<   `g @8 ` malloc failed㿘@  @brealloc failed㿘@0  @bPstrdup failed㿘@2   @bvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead *#̐?"cJ#|@w 6 >@KE" @L[ <    (@Ɛ H " @v ̀  "`>@K%" X@L; #  p@L0J  ̐@vޒ ̀ "c̐?"c# " x@L # 2@L " " !͠ , ?$ $ #͢`,`$`$`@$ @$`  `2r  @`  (̐""c\"@ܐ  Q#X 2 # 2 ͐`@/0 " @A Ȁ } \@%@PL,@@KH8,$X@ \`@\@!#\ a(H!p@KaN  !hcX  !@KJ` р # "0"8K")?# 2B"@  $"c# ,@ $` 0 :`*` * ?:  !  t:   @ @ E  !    "h@" 2! "  ,`!  <`c "@"   " < ,`  `! @$ "`  "`# @K"# 2 @v"  ͐  * ͐ *    @* @%!! #` `"`# @Jِ"# 2 @J"  !͐  * ͐ * ! `0 `H@!#( `0 "`H# @J"# 2 @##P  !͐  * ͐ * ! `4 `L@!o#X `4 "`L# @J"# 2 @#P  ͐  * ͐ *  e, e0!e4%  e4e0># :%0# @J\"# 2 @͐#P  !͐  * ͐ * ! %(`< #  <"e(# @J8"# 2 @#P  ͐  * ͐ *  `H8: e8 !e< ( e<e8# H8: :8# @J"# 2 @v#P  ͐  * ͐ *  `L8: e@ !eD ( eDe@  L8: :@# @IҐ"# 2 @C#P  ͐  * ͐ * ͐ "`H8: :8L8: :@" # 5 %, 1# 2 @ H P n (c "c͘ "e,:%0 <"e(H8: :8L8: :@ + ͐ * # i %L?e# 2 @ݐ  6 hc "c "eL "eP#\"eT%`"eX* @P*  `,`: @  @ @* |`,`: @ e$ * `@``|``@* `,`:  ͚  %@ B L ;   $ +`͐ * ͠ J 䀢 #X    ? @Dh#@?  ͒  = +``"`04 @}`-  "b `ؐ@h 8  d* @ 2` @; H 2 =`` 0   Ȓ#```:   !̐@}  $# @H0Q!#` @}  $ `!!#` @}  $#`!0@H`05!#` @}   $ ``!X@Hq*`0%%  $"c̐ "cx#@}v $c!@}q $#c `  !@HP*`0@S 0@  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘#X  :  @P  `@ 2 ͐ " "  %\F!T@bP  , ͐bh  ͐b  ,@Y    ,?@Q ܒb  h@!͐ђb@= ͢    d 4@* $ @$#X  `,?@#``,@``͐ Ȓ @&`h ؀ 2 #`! "@` % "e `  "` ` `"`"`"`"` ""b` *`` *`` *`` *``  X"`X`  <"`<`  "``  @"`@`  \"`\` "ؒb@ |` #T"cT`  Ԓ`@z"` $\d\@t `  d"`d`  "``  "`` %P"eP` %H"eH` %8:8` %@:@` %H"eH` %0:0  `@i@h % @F"  h ?`)'@ "$ @F:`  `c@ ̐ *c %s: BAD SUPER BLOCK: %s 㿘 # " ?@F  %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@N ??" L ?? Lq`   T @Lq`  "L`* :@ ``E!*`@#0 2e  @%h &4 &8 &&$`0&`,&`8&4@`(&|`` ?4@ ?8@@ђ&?&` * :``& "* &?|@ ?8@@&@@ |&$@?@ &,&d|`$ d :``&d`("` ioctl (GCINFO): %s %s: can't read disk label 㿘e`e@ 61̀ >  @D"#p#[!bad file type 0%o 㿘< @@"$  (@"  @" 0 @" ̀@    @E INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘# "M @Ya`?@Ew! J # !@Ef` J#Ȁ 2   pJ p!(@ETN "'pp!!8@EJ@4?? %?@\?ᰐ`$ @, :  , : ?  $@\ 2  , ᰒ $  ,  ` 2, :  y Y n N2@E!, :  y Y  cannot allocate buffer pool 㿘"#"` @ 02p#X#8" * ?" " ̐c" "c (@`0$  @6&-/'̪#Ш?@ @} 0 `2$ `BX$ $" $, $ `@$ "#܁deadlocked buffer pool 㿘̒##Ѐ   d+̖#  "! 2 ̐ccԐ? ̒#  "  2 ̐#Ѐ2 @ c "c "@ "`̐c& c&c" "c  & 㿘  d.@ #@ ` "`  @i& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` E` ` @`"x""P`.`&```@` ͐ @'  ` !)'#`,`"ؐ@ 8   d*  " 04@ 0 ` CANNOT %s: BLK %dProgram terminated 㿘# 2@Cؐ!#I! N#ЁUPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘#   #a`J# 0 :  :  @|2̀@ # 2 H "! :  @|à $  , #/#*c8@/#P#Ԁ`̨#'̀@ `@`@@#܀@" h"@"# #"` р #    "  ͒   **`# "# , * * @c @Cc@4 #@0SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘> : @% @ # @”\ #ߒ@o  #Ӓ  @@B#> -9͐@\\ /<@ E  ;  B  @G \ #@@w@sc@B{  !@h #@Bq \Ȳ@@Bh!WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `> : @~ @ #] @͐ ="`!N@ޖ 6#B@B! %#)@`` <  D  ;  B  @ @`#@A `@@A!㿘w8@s  1#8 i ;̒ `8 V ,8H >2?  6 ㈄,8N >@ 6 #@,8㈶@ *@ .@#@"# `8 `8 ` `?/?..`@ E2"x! !"x   ? ! !. `K. E "bx @ 8 / '#@-.#'l!'!'Ր{ "E''la''n E@Z$ @f? /,  EȀ2'E""x? ?,<@O& 㿘# Y @_ returning to single-user after filesystem check 㿘@@#̐ "c @ 㿘@  @  @  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 &   $ "' "N 0 U  # @@    0   & &  8㿘 8Fȇ. . @..`EE  &@>/`  8@/`@2 / &/./  8. ` 8@۰ffs_isblock㿘 8 "  $  @ `?*  *@>*  *@>@   `? * >@  `?" ffs_clrblock㿘 8 >  > .@>*` *`  * @ *@.@ "ffs_setblock㿘 8 >  >  .@>*  *   *@@  .@ #㿘@0/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 ! ``@t@ F!0!0  #!3`` @t  ` @%``*؀  F ``@t{;"#!0!0 "`@S "  2` 2   `a@t^`ؐ?"c J !0@   !@@    ڐ @= "c"āinternal error: unknown type %d.㿘؀ # #Ā;!x F`!0"#F!0!0 " @`"@`@ 2`@  "@"0!@J!@ !0@` !@@` "#"#type㿘Fa "`: 㿘Fa "`0 㿘Fa "`& We only support %s mode, sorry. 㿘 ``@s ؐ?"cWe only support %s format, sorry. 㿘 `a@sxؐ?"cWe only support %s structure, sorry. 㿘 `ap@sؐ?"clocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H   'D`&` D  DH@:BЀ D  DDH@:7 D  HH `a@sB   @;  Hؐ?@"c`H`""`HJ a  h "" "(  ! H@  H"`  "H H@} H"`H   `@!local-filesusage: %s local-files Continue withmput%s: not found`'D 'HDH@9 H ``(@rؐ?a"cH"aߐ "c @]b,'@"! !%q#H @: @ N #$# H@; H# /J`@   ଔJ   "J  /J   * *! @ . "H @ А  h ""  bp    @ ^# H"l Hbp $bp @@:`P # $#~$bp D %+)#ަ! K H, @@:z@ a H@ H, @"H @ y  h "" H, @  bp  @   2y "l sbp $bp @@:@`P  $e$bp @ ,H, @, @j HȀ  H,  X@ 0J H`D >H@: 9a "@ u"H @   h "" @  bp  @  2 "l bp $bp @@9`P  $$bp 2@yȠ DM @ "#r+w㿘 @*Pw㿘J#p#p  "P"x@ usage: %s remote-file [ local-file ] local: %sRETR8'D'H   'D`&` D  DH@8  D  DDH@7Ѐ D  HH `b@q ؐ?"c  @9   ؐ?"c:# 6H J`q @  2 JJ   "J  H  /qJ`   * *H"`  ! H@  H"`  "H H@ " H"`#H @f3  JH"@`* :pHH @9  H H   #`@"J  :#p 㿘@=3  `? " " * @ r @% `# "l #bp!! $bp$! @@8a $bp$!ސ"@- ""p"!"#ސ"@$ remote-filesusage: %s remote-files mget㻐'D 'HDH@7( H `c8@pؐ?"cH"aߐ "c @b,'@ؐ"3%q#l!Ha@7T g N c&c H@8G "# N     b,*   +@J+! @  "H @ )  "p  # @!Ŗxc "l H"p $"p @@7cP c &c$"p@*"#onoff ؁Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Command line editing: %s. Macros: %s 㿘 d`ڀ `" 8b@n"(@e``! '@'  d "  `b8@n0"`@M``@& '.#`@nbx`b ږژ x@nb#!"p!`b@n h `b@nz"`@nrc # "x`cH@ne!  `chؔP@nYd#@``"H   `c@nE%#@``%!#"`c@n.a !``@n&`#`@n`#bT  8@` bT)'ڤ!, * `@@n bT&, "#usage: %s [ on | off ] %s %s. 㿘  `? & `@8aЀ   & `@7a؀  & `c@m@? !G ``@m”Bell mode㿘"cEditing mode㿘ߔ0@:"cPacket tracing㿘ڔx"cusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿘  a-`?  `a@m]@>?`@7raЀ "`@7ka؀ "!@{\`4  `a@m?` ?"!  "a1!! `@m/b!  `b@m& "0@``!"cVerbose mode㿘ؔ"cUse of PORT cmds㿘` "cProgress bar㿘ޔ"cInteractive mode㿘ޔpH"cGlobbing㿘ٖ"cPreserve modification times㿘ޔŖ"cusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿘   `a @l@E?2$`@6aЀ 2` @6a؀ "!x@6`6  `aH@ln`#?"!xax`?"ax!x c c ?"c#!!x``ah@lP!x!x 4  "cremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'D  'HDH@3Ѐ D  H `b@lؐ?$"cH#@```#!`# ڐ#@``H#@@`` "ausage: %s local-directory Local directory now %s getcwd: %s㻘   F!,&`   ``H@k@@4m`  @Ŏ`  "@`ؐ?"c@ɒ$   ``h@k @`"#usage: %s remote-file DELE %s㿘'D  'HDH@2t D  H `ap@kؐ?"cH!@@`mdelete㿐'D 'HDH@2P( H `c8@k^ؐ?I"cH"aߐ "c @b,'@&"3!H @2 - N c&c H@3 H!@c H"l H"p $"p @@3b c &c$"p@"#from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'D  'HDH@1ܔ D  DH@1Д D  HH `c@jؐ? "c#@` H#@`-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`    &`   ``@j@1@@I`  !`@I` "`@31` "`@I` `J |@3 ` !@2` ؐ? "c``x@ @, `usage: %s remote-files local-file mls㿀'D  'HDH@11( D DDH@1%Ѐ  DH `bp@j3H*`@'"@I=` J |H@2ɐ !@2| Hؐ?V"cH@I"b 2! 'H"aߐ "c @b,'@ѐ"# 0  w a!#D?' 2//H.  @ # 2 "l bp $bpH @@20@ # $#$bp# ذ  @`"#SHELL/bin/shsh -c%sTry again later㻐 @H  @D @RT @   @6  @3 @ΐ !@c /" -/ @<#/@Ha  +/!x  !ڐ@ `!@ `@2 `  @ @ ! @xؐ?"c@  @ː @ @?@a!("#"#usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'D'H  DH@/D?  H `c(@hؐ?V"cH#X@` 8 D 4 H@#`H"`D 'DH#p@` $ D 4H!#x@k `@ ` Op@3@@*H" D 'DH#@` ` #@L``0` D  ?H#@q` ڐ?"`dPWDPWD command not recognized, trying XPWD. XPWD㿘# "#@T!` #!2 !h@``@D!"#Local directory %s getcwd㻘@႒$   `b@ha@"("#directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'D  'HDH@/ D  H `b@h%ؐ?"cH"@` #!# ڐ"@``H"@`RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'D  'HDH@.Ԕ D  H `b@gؐ?"cH#@` #!# ڐ#@_``H @`command line to sendusage: %s line-to-send 㿘'D 'HDH@.耢 H `a@gؐ?"c 8D@.Harguments to SITE commandSITE 㿘'D 'HDH@.h H `a@gvؐ?"c!D@H㻘@:v#`#/@y#@:k"@q  $#*< , @ @:X$@^? @  @ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'D  'HDH@- D  DH@- D  HH `c0@fؐ?"c#P@SITE UMASKSITE UMASK %s㿘c  "c  0@`"#SITE IDLESITE IDLE %s㿘c  "c  @`"#HELPHELP %s㿘c  "c  @v`"#㿘 d  @ @  d  @  @ې QUIT㿘 d @R!! "@I"!" dJ?"cd! ""Tusage: %s [password] Account:㿘   `b @f`@ؐ? "c2`@"8@#㿘@3 ! @  d ؐ "c"#@ ސ"@' commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'D 'HDH@,  HH `c @fNH@$ ? '!#8@ `@ `g"#2 J !#P@ `@ `0؀  !#h@s `@ `$@" 2ؐ @nb@ J  d 3!"(@U `@ `@  @Vؐ?)"c3`@@p:c ! A@`@"`@@DH?€` d ؐ "c"#@ِ  @+Case mapping㿘ߔ "cCarriage Return stripping㿘ޔxw"cNtrans off. 㿘  !$!"X@``!"ca "a"c!ؐ#P`@8X #P ,  *!d!!d`@8L !d, ͖Hd  d 4J K J(ؚPd K` `JJ@ 2 `@   @*J@ `2  * J *́!Nmap off. mapoutusage: %s [mapin mapout] 㿘'D  'H!$"H @w``"HF"cD  DH@+ D  H `` @dؐ?,"c ""H"#!@7 ! ", L " "!@7 ,#a@7# L " ސ#@7#nmap: unbalanced brackets. #   *` ``"?Z UJ P $ \23JJ*/: J 0$*JJ  94%JKJ@"#J?ϓ+`@ ""ؘ   J*`: +` K  +`"?K@2 K 2 J 2K   K +` "?Θ!*!ޖ#J# "+q J [ [ \ $"J 2 J ߖ J $20 J`  ") J 0?N  @+`J@  f +` _@ @+`@ Q * C: :  ]D \2J9 $20JJ`  ")JJ 0?N & @+`J@   +` @ @+`@  +  J  ,*`J   *`:  ] \2J 2J  J @!@ `0EJ ,\ ]"5X`  "* J 02JN # @+`J@  ϑ+` @ @+`@ + J  [+Β!J! 2 Passive mode㿘# # "cStore unique㿘ڔh"cReceive unique㿘ڔ8"cCDUPCDUP command not recognized, trying XCUP. XCUP㿘@ x``#!`#  @N``@} ` "arestart: offset not specified. Restarting at %qd. Execute get, put or append toinitiate transfer 㿘 ڐ!@@!``0 !J@p` :<#p `@b|a`SYST㿘@>"Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘'D'H"T 2D̐"  DDH@) P D  H `b`@b"p "x@``!"T*` * ڰaH`@5 "T*` * * "T ڐ"p*& ڐ"@``"#$T "T`"T*` *  ?" "#"T*@ *`@ * *    "` "T*` * ڒa  ސ"p/p#p!%ڨ!ަ"p`? &`@Da`$a @?, :  .T*` *  `N? . 2`3pp! ? & @Cېa`&a @ ?2 ? ?  & @CƐ   a &a 2 ڐ"@``ؐ?"cfilenameusage: %s filename %s %qd 㿘'D  'HDH@(, D  H `b@a7ؐ?"cH @*  ?ڀ" H `b@a"#%s %s㿐'D  'HDH@' D  H `b@a?H @* ?'!H@&#@) `c@``"cSTAT %sSTAT㿘  P X@ `Local file "%s" is newer than remote file "%s". 㿘?x  ```@``PAGERmoreCan't allocate memory for $PAGER|%s㿘'D  'HDH@' D  HH `b@`@)5  ؐ?4"c@!!@@  2 @a aH@*Ԕ)J#p '%$$င  =#pH#P@z @ < =#p$$?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgetftpformexiteditdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!㿘@>@㻘@ <  `@(@-4@ .`@ LJ@ &`@*@@2a*< l@+W?   `? " " * @J  @:ޖ@+p 㿘@# @<H##䀢 @3@ @ 2 @#   @#  ...Can't allocate memory for local dir㻘@Ȓ /@ .//$@ // /@1*<`@<Ő@ @"@@- +)-@=ْc @=Ԓ# @Ӑ  @͐@  @ h @Ē@"@@fڰ @=@"  complete/Can't allocate memory for remote dir %s p!'ؒ''?'@O /2L .// / @L@ /@@$@ // /@1g *<!  @=^a Y@] @=Sa   @=Kc  ! @"B @" !"aߐ "c'+)ϐ @%}Ԣ# L@  $#@L@ /2 @@ Ő @!a@!!Ԁ `@]a6 ϐ! @'6"!@!Ѱ ϒ!. @@@8 @@Ȓ 2 @!͒ a  a@@!ْ   Must be logged in to complete. 㿘@.`@"@$! @@@0 @.`@" "!"a!!@"a!$!a !a p+ А!  @n   p!*`А!  @0}!Д! *@ ! }  p@?y x @m    q J?`  2"! ` !  ??* : `/U#0*`@LdddddddddddddddddddddddddddddLdddddddddddddА!    d? @ `` А! k А!   macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'D'H   DH@#p   H ``% "T@ڰ!!H,`@*` @@ "T`@H"T@0H ``@\ؐ?"c@%`@,`* ڒa   )q7,%5ح,`!N    @ N  2 @ X*`:  $ \"F EN    * * :    ଓ, @*`*: @а N  D?"?H,  @%f`H N  i2 D H@%U@H@%@.@`N 2 N @.@ p@?  @ `M&2L   Ȁ   d   @ v`?:&# @@ l` @ h` p (€@! @L  `?`"@  " *@ Œ @@$0@ ('D p'H- 2 ,`*  20ND,`http://ftp://url_get: invalid url '%s'Can't allocate memory for proxy url.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. Invalid IP address: %s%s: %s%s: not an Internet address?Invalid port: %sCan't create socketCan't connect to %sRequesting %s:%d/%s Requesting %s (via %s) GET %s%s HTTP/1.0 /write200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file. Improper response from %sX? ??Ԇ ?Ć a@%"   a@%    a@@-̒ /?L@ ,@`" ?L@ @ڠ /?̄ ?̆ ?̄?̄ ̄ ?̆?̄H ݀`L@ Y?Ą ?Ć? @aĄa@$  ??ĆĄa@$  "?Ć?Ą"?L  /,@-S /"L@ 2,@@-H :.!x   `b(?̆@Z> @i  /Lq`   @쀢 b"P@2 >@""h@5W? N"p@@~9 N @$d?# "7"5 7  @1 ?Ԅ ?Ԇ?@""?Ԅ@` ??"@?Ć  `bؔ@YȘ ? `b@Y?#?Ą@# #( @Fݘ?#@~?Ԇ@}a@#0??# @~ 1?Ԅ@}`  N  "`@ ?#*@?#@,c c8@~V  #@?# @~  1?Ԇ@}(  N  2` `@ @?#*?#@J@ N#l!b,*  R  c2 #`@#Y  "NN b,N N@,  H!*#@#j: <##  ? ;` 7??̆&@N!?܄ ?܆?#x?̄@??܆ ?㼆 @#h ? ?㼆@|a? @|[aP?   : 0! : @"o??#@%)ڪ #?Ԇ@|{I 0@ B <0?܄@|S`"㠤! ?" چ0?`"@ #`"*@@ !  :@ F0 0 ``@(@r# `?! K " F  0 0 4 〢 = ` 9 ! :  0 04 ڀ` `?`"@ # " #*@1  `? " " * @! @q ` @)#??@! # #@`` ?㼆@{?Ԅ@{??܄@{?Ć?Ą@y' #?̆@?#В@?Ԅ?Ԇ@{?Ą?Ć@yb? http fetch aborted. 㿘@$j !!8@6 `@qh `ؐ#h@ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Bad ftp URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmget-X''''@*#Ѐ    d   @zߒa @zےa@yv!@yr! 7"H/܀(@* : y    @2 @3aa@!H    ̀?W0Ta@!8  2V ̀?E0 @) /@ aش"C N /! @2 .ē(!@ &Ĵ@֮ @@aؒJ@ /` J@  :ހ *@`٪L ՠ @) : ,@) : L `,@``L@  @n /`*@ !x  #\#``a@V}3@5a 8a@ d  ߒ @ '''耤  L `'' `L&L @&L d   @=  " @^DZ '#('' !  !  ` L@ @CbP@  `L @7bP 2 `L@ ''' ! N"K?L E?# `# چ`bX@U $p@C  "x''䀤'耥` p%p"' 奒 %p"'`' b#@q d İ@wcĄ ' d ?  %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 !ڐ"X @z @̒b\ "X * !ѐ"@2>@"!h@lؐ?"c"X *  @@yp !ѐ"@(R ", ђb"# "Y @,H 6 @V!pؐ?"c"X2 ڲ"X)>-ت?@  71  +"`'@%"@3!x`$``@y0  `#`'@@Ta@y ` @, 6ѐ@!ps%@!l% 'ڒ`@,#  @!D'  @+  6@!@6Ԓa!$!|@6Βa"!!| `@А!#  `a@T@ !| "@7! @7ؐ?"c '?c!@+   !x @"#@x 㿘@!=  `? " " * @| @n/ `Jch "chJ#l ڐ @H ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘'H'L'P'T'XJ"#h!x 83"@``H"@y  "@``ڐ"@y   "@``@bT `? " " * @ @m `!   @"ؐ?"c( @wb!!@TNH"@s!@m! "a@2c@&`?J#h ` @  @wb%c%c%c421 Service not available, remote server has closed connection. %s:㻈'   # @w@b'+)9;3%c  !|`? "`@5 !|" ހ F?!|`? "`@5ϐ !|" !|  `?`? "`@5 !|" !`  "`@5 !|" !`  @SA@m !!|`` @c  @``@l``!%c  <c  4?6 55``1 4# ,`# `` ``c 2 ``a8@S``?` "@ , :  `"*@@ `q   c*` * ?А%c`c " `  q   2  `  )"--- ` - 2%c "!|,c  ``?! 5 # ```?` "@ , :  `"*@@ @lM``쀣`$d8$!ِ @% ,@ c"#"쀦 1,"! @uc!J@J#h  ""?Пƀ  ?`'@u %c 㿐''   @)^ send aborted waiting for remote to finish abort. 㿘@ "#J"#h!# @ `@k `ڐ (@ sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout''''t! 'L: 'HH?H#"bt  : 0ؐ??:"'<# `" K@ - `c@Q  `c@Q! @ 0n#c "'l o 'l'\'T'd!'D@q ( +! 1 ! 1J#d \@u?&#d\` @u\T  @uTd` @ud<"" @ucT'\ @u`'d@0qcЀ p!'|\""K@ |$ @t 'T @a؀ '|#@d @t\ @tT @td""F!6'l@a؀ '|#@I @t\ @td#'l|S`@m <   `c@Q @t\ @td@4|:@ ڐ @t\ @tdT  @tTؒ?"#<n""@ ( ` J#p#p ` G@/` @/ݒ` :#Ā  ?J|ct@Ŕ   ` |JS`ctcp@uB ` 1J#@J  :#p#p e` J  >#p  :#p ('D` 0P 3 @t!\ @td<""T` @tTl 6|02#4  @t\ @td<""T  @sTl`@|0@PD 't@ ? @s 'T#Ā %  > ""7#ڤ #|S @t $Z>`0@ B >0tS`@s$&@`! |" # 6S 0H10H@```L(?`"@ #`"*@@ !  :H@ C?H0H@ 0H```L@(@i``|! O`" # F` 0 0 4 〢 =`` 9`! :  0 04 ڀ` `?`"@ # " #*@  `? " " * @ @iQ ``#@>05 0| ? # @1||@`#@ @q` 2Tt1) #0H0H@ ``L8)t?`"@ #`"*@@Y @i  `!  :H@ C?H!  "  0t` @5`?`#``@  t # *@,t0`B >0t`?` #``@ .`:   t`#*@@t0`B >0! ?" # 8| 0 0H@4 H`L@ `?`"@ # " #*@ݒ  `? " " * @͒ @h `| @#@t` @ >" @Ɛ 8??:0@\ <""l`@|@1t  @r*\ @r'dT : @r!T7 @r\ @rd<""T  @rT! 1Jؐ?,"c#d t@ru?&#dt`@1]t ؐ?"cl |`| 0 0 ` @  receive aborted waiting for remote to finish abort. 㿘@ "#J"#h!#@ `@g `ڐ @  receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s㾨''|'t'l'\'$! ': '?#"bt  : 0ؐ??:"'"' @,Ғc`? '4#  |` tK@ - `c@M|t  `c@Mt!  4`|@t0?'T'D'<',"x 4 @ ',@\ (! !ϐ ! !J#d D@q?$#dD` @qDL  @pL"" "" @pc8'D @p`'L|@,_cЀ i|K@ |f4|@Z  V|@ />"  #@U|m  2,|  |##@6   /,`#@6|N  >" |@’! #@!|9  4>" `@|  '|)  4@| '|4` #Ā  إ 0#c  ؜ t@ :@  ڐ @p`D @p]Lؐ?i"c@ 24 J#p#p 2J`  tJ lct Ot`  0at  = #X @!؀ '\|@+cЀ  |p"'d"".""K || @p '<|`@?a 'd#@""""F!@Fl 'd#@w|#'TdS @hƒ ؀ ѐ$'#@#䀢 !@m@m؀ $#@R#"#"c<  """"@ܐ?#Ā "J% # !J#p#p 2J`  JdS`ctcp@p > ""715ڸ #\S`@oࠒIdS @o@A<  0@ B > 0! ""  #  0?`"@ #`"*@@֒ !  :@ C? 0@  0``@(@et`! O " # F  0 0 4 〢 = ` 9 ! :  0 04 ڀ` `?`"@ # " #*@~  `? " " * @n @e! ` @>" @q#??:0@V`Q#@X|0N#p#p d` <d @; %J#t  d ? # @-xd?d@`#@ @? "  d @  61#@-|"" ""T d017 03\`? #`@-C\\`# @? p $`l'$ 00@``) 0?`"@ #`"*@@֒ @d``!  :@ C?!  " 㠀  0 0`B > 0\`? #`@,\\`# @ 2d,` d @29$ ?`#  @  d@ #@ *@d ?\ " #d ?` #  @ , :   d@`#@*@@pd 0`B b> 0$  #@.$ @``! ?" # 8\ 0 0@4 `@ `?`"@ # " #*@0  `? " " * @  @c `\ @ >" @"#??:0d` @#@|@ "" ""T  d @mD @m|L<` @mv<@,\)  0 }4 z 0 0  ` @3 " h#T@ct@ɒ ?^'@ ''|@Β?S@ѐ@ 8@z|0H"" ""<  @m-< @m* ! ؐ?,"c@\ذ?"#!J#d T@m$#dT`d "\@d\`@,j\ 0 0   `  @ΐ  @lD @lLsetsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! setsockopt (reuse address)bindlistenPORT %d,%d,%d,%d,%d,%dp '# a   @ " J "cd@/!p # ?J#dc @   6@"" "Ȑ#\#`#b@䀢 "@p``!J!ڐ P @n  P , , , , , , , J#d@?   @ݐ!!JږPڒ  "P`"`"` " !` 22J#d?" @l  @ J "cd@︐!p !` J#d?c @  J@蘿#0m!J#dڒ`P@  @#P`!J# J#d?c @~  6 @" 'J#dڒ`P@؀ J@v!?!J#d@{  !@k#X!!` ڐ`T `T    ? ?#\#`   !`?$!`w "@  "a` 'J#d  @3   @9!  @l##d?$#d  "a` accept㿀 '# %J!J#d@͔䢒6 !J@#@l#d?$#d @k#d$#d '  @  6J@!J#d@)㿘 0 0 ` @8 㿘@ Jch "ch㿘J"#h @kP`耦  a ԰!XѢ#  "aa Ѱ#Ԣ!X"a`d&@"`d#` @ .!. ؐ`"cڒXX&!`&!`&!` &! a"Xa"`a"`a "` ڒ&!`&!`&! ` &!a"a"`a "`a"` a|&!$a$"a|a&!(a("ac&!,a,"cc&!0a0"ca&!4a4"a`h&!8a8"`h`&!<a<"`c &!@a@"c a&!DaD"a!H!ؒ#P@B .!X#P@raH!Y!!d@9 .!i!d@iaYbH&!lal"bH!p!#@+#.%o#@[ap%p!ޒ#@"#.)o#@Rep @jJch "chĀ 㿘@Đ  `? " " * @ @` ``t "`t"#J"#hڐ @ϒ STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortH''''!@%Ȓ# # '  x '#  #  # 2 #Ā"\ T"  @``0ː  d   @`` ؐ?"c#Ā9  /c耢 @; : @ic' 0Ā  @i 0@n   ' 0 ̀  !J#l $#l    @iy $#l ``@F&0@iÒ J"#l@%2c !  @%%c  !!  Q!!   ! 0̀ k0! "@ !5`?!!  ! 0̀  " ! H@ 0D! "@ !`?! .ؐ @j !| *`:`2*:` ` *  "n 6@ǐ  t ؐ?"c@   ! ؐ ֐  t ؐ?"c @i!resetxؒ @j - )'ؤ?|R 2 * -@ ") @셐!@$   |runique: can't find unique file name. 㿘@ / ` 1,@@`##@K ` /,@!#@K< ڐ"@``5 "@^@j0"Ƞ"Ȣ .*'`1֠ 1  d,,@`:  9,@ 0"@ ,:  02 L .2 , ," 1ְ"ȁLost control connection for abort.%cABOR x! @ P t ؐ?"c@;А`  @& !R  @ɖ  !@ِ !!`x@D @^w!ؒ @i֔ !| * : 2`*`@ :   +{ "{ * : 2`*`@ :  +{ "{K  6@룐  t ؐ?"c@ V 2`*  `;ؑ:  V @h?$ 4V  #"(  ftptcphttppftpTERMdumbemacssuadeginpPr:tvVbad port number: %s (ignored)-r requires numeric argumentRetrying... p'@G'Ԧ ?"@u3b   "`"@u'b  P "` "!""p""L"#"""#"""#" l" 8$@"a "`p@ƒ / @"b 2ؐ "c@f"Ȱ @"bЀ @"b؀ @"ݒb 2p p@^R!ڀ  "blؒ `"#"#p""``@^pR  `ސ "bp"`"``R?!)߰ %#3>!@Pϔ耢?p? &i* HHHHH@HHHHHHHHHHTHH\xHHHHHHHHH,H8%# $ax $ax"#"!""p""L"#@ bВ"@^b" bJq @ `  @  "c@Mc" $#$#@a!(ܖ"'ܑ* Ԗ'"!"!ސ "bx?@"a`@n@N@F"a,@ B@  @fb܀G@ :  ߐ "c뒔 8@h(@#Ѐ  @h  @fwa @fsa@ '''''31%#!ܐ@cc  d  c8$T@L `@c d @@#Ѐ`?   @fAa @f=a@e 㿘@[ ؐ#@ 㿘@R  d !! " !JR @ @%!$!!J#d & @ @f#d?$#d" d  d !! " R @ @%c!$!" d"# ftp> "sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿐 !# - `? " " * @5 !-'p @p!+)# B"l " @@ `@[ `@$@ ᰀ  W @g '?'J@ 2` H*@$E"@ `? $@$6'ᰒ $ ' ?2 "#`l@. ?  ?'J@  d "@P `g  c @e* 8 @ &@ ( " p@V? "2N  p`l (@ "w "   d  "@ `g"! p  (€@! " N   `?`"@  " *@n  Đ!,@?ߐ @da @da /   H䀢`$J J@ `JJJ@`J2  "  "  ` ?㿘 @"cߐ#"bh"# p" " (%#@-p@ `( $`(# @@"!"!#  ("! p*`@@e$!!$ hJ@! $4 $*J@㼄 Ȅ #2 J@( h" "#J@!ϐ͐㼄  J@    ؒ`㘀@2J@( h" "  J@㼄   J@ "u  "o n ( @\2$ @`㘀@2!J@( h" "㘒`㘀@2'J@( h" "*J@?*`㘀@ ( h" " J@("2 @`㘀@2J@( h" "*`㘀@ ( h" "ؘ  * h؀     㼄    %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2>?@ڒ `!  Ĕ @@?`H#J"`*` * 31JH#  a L @z "`*` * *@ @ 0"  %+)'IJ`@? ```!@?Y?  @?R ? `usage: %s [-adeginprtvV] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘@p"`Ēb  @? @dc macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8 @`֐#Ġ#@c # @Q ?Đ#@塒ð Ēc@@ jc׀  "b>" Đ#@喒 @˒! &/@[ .-Ů ת"#%)ڦ!@ t   0  ?;q@ @` 4c@[ /c@0 ."@Q c @d$ c$J @ .@9 à$@M L ;q@L ) ' % "%@   0> W@5 @  @c@_} &@@,0@̀ 2-0Ӏ @`  R @ZR  ?@   @bܐ@_T &R @Z9  ?@  @bÐ@_; &@0! `? "`@ "  Ȁ "` 2"T "T*` * *  `? "`@Ő "  `  ,``  ,`? "`@ "  Ȁk"T "Tڐ"p$ `%"T*` * ?:" *` **` *   " "T* @*`@` ސ"p#ޢ"p`? "`@d " 2ő*:  ,L? "T, ސ"pŐ!8@`&א!X@0@  @"   ڐ!@h`` @ Ő H@@"Ȱ?㿘" @ !"`? "`@ ""   ("Ȁ` ""Ȁ`,""Ȁd׀`"+"!"`? "`@ "" H`"F`\2."`? "`@ϐ "" .ڰ . !"`? "`@ ""  ` `,`\2."`? "`@ "" .հ .J"̀ K  h h " !@C"̀ "    stringlist: %m㿘@] 2&  @c`&  & @] P & @c`㿘   2 & @]̓*` & @c`  & * "@㿘  `  .`@] ` @*@]@]㿘  , @ߒ   * Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number '%s'. asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘'D'H d  `Ȓ`-D  ?DH@/(D? H ` D H@ *  H!H `ȒaP@;*H `Ȓa0@;#ؐ?"c*` 媓:` ژ " dڔȒ!p !p* `* `* `* `* `*"#"#ڔxȒ!x !x*x `* `* `* `* `* `* `* `* ` * "# Ȓ! !* `* `* `* `* `* `*" <ޔȒ! !* `* `* `* `*""@Ȓ! !*@ `*ސ "b|"L H  @ !x c?"co! 2"ـ`1ٲ  @   @   L? ."? , `Ȓa@: 2,ِ Ȓa@_n  *! ؐ "cؐ "c"#ږȒ! !* `* `* `* `* `* ``"* `Ȓa@:T ! "#"#`ِ Ȓb@_3 Ȑ" @``"#%s@ftpanonymousName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'H'L `'HLi Hؐ?"cذ H L !#  @_!  @_!@'H@A!! ɔ@' H'Lɐ#'Hɐ# 'HH 23ڢ@ @ @q 2  ``c0@9p``c@@9p O@Ȕ@^Ð@*O 2'H'HH ɐ#PeH L 2@#X'Lɐ#hVL   @#p'ɐ#F ɀ`9# @#2C # f ! 5 @ɒ# #*@ `* `* `* `* `6* p(܇@ ?"`d "T 3ڰ!#ړ, @*`c@C@ Ԡ bT&,  sorry, arguments too long. (%s) 㿘@^/ @$ʐ#X@``w `ʒcx@9 @ , $Ȑ"@p@ 2a @@^  L ",  (@& p&@4  TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘# ! !K>"#0 䀢  @$ ! Kc0 ""c00`"0` ""00 䀢 !K@Z ˰ @]J? /  $0 d @! ?@r  @J{ /" /*| ˔` `*< *< *< *< *< *< *< *< *< *< *< *< *< *< @%r ː @Go @\1cc?"c"!`"!!U`?˖ `@ 1!ː @ `@ !#@Sƒ d ِ &`"!/`?"#"!@ɒa!K$ @$א 䀢 2!K ː!@c`` !8p&א#0$@ 䀢 @ d$ #0@  2.1װ#0%s %s? Interactive mode: off. Prompting off for duration of %s. 㻘"p ;! 27 ! `̒a(@7@QX `$p@ O% lb,*  R  n"  p a  ""p̐!0@``   "a `̒aH@7` %s: not foundh! Ȑ @\} ,, @| Ȁ  ̐"x@X@B @&@;Ȱ SIZE %s%*s %qd 㿐???!x ̐?"̐#   `ِ ̒c(@!x  !ِ @ `̐#0@ `"#MDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H!x ?"⧐# =`#\#`ِ ͒`Ė@{Ȑ @[ ,''''?'Đ8'ܐ?'@?2쀦`!x   `͒` @6!x  !ِ @, `̐#0@( `"#㿘@K  KMGTP %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETAh?!ؐ#H@+ޒ ؖc4#H#H"c4"J#p:@@+В " ؒ## 4 • x` tJ 0cp B5- -@B2`* @ *`B2*@ *@:9@& d4 d!͔@#&"P?․@P^@Q d@[@@Z!"@͐"#\͔͘!@# $  a" ,4  <   2a" @Z͐@Zʐ!"@͐!M`  B#\#\͖@"Ҕؔ#4#4"@'"@`''А"@@'ؒ#@#@4 ؀`ؔc4"c4":#@ ؔcHcH "cH "'ؔ#H#H"@'"@`''А"@@'荠셠K腠čB? 0 0 4 K  `  K؁+@ZU@ZR!"@@"eaڀ @ZE@ZB!"@@"UQJ#p@ b @:?@: 0؁ Ё؁Ɓ@'@Pܒ.@Z@Z!"@͔@",@Z@Z !"@@"А@@.@Y@Y!$@P <@@ <͔@" `R @Y@X?  @Xba@ @  `? " " * @ @Ns `%qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d #  @*' ؔ#H#H"@'"@`''А"@@'荠셠KčB?x@: 0KxB3? ?@9     0 0   "Ϣ!"t#\x  @9;` KK € ;h!ϐ!#p dϔX@!L M 0 0  K E ` A x:# 6J#p@ b @9?p@9 0x pxƁ@'@O.@?.@X@X d$@O <@? <ϔ@    `R @Xݐ@W㿘   ,@X@4 *  ?"P@O{"  @@Nʒ N-ڲ   @6E@N* @ @ `@M  `? "`"%*@ @㈒ !@X6`  ?`?`"@ `"*@@m 뀤@ 㿐 `R `h@W8? P"bP㿈'''' @ emacsftp-completeContext sensitive argument completion^I㿘# @#`l =! 8 8@ pa@s`@L$`l$ 8 @ d`l ͔@ 8`l @(`l @`l !Д#0Ж@@!`l Дh#0@ `l@2 `l @ 0# ! 8 "!@5$ 8! l @[$ l㿘@ -%c %s -%c -- %s 㿘@6 a "a('>%!ѐ@?``? @y@u!@p!a!(%!a!(*`@d@ !( $!(@\!@W㿘@d-link2link2-link1link1-link0link0EtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisoipxnsinet-a'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRH@5 ?@`@@cP   ""а?`"@@ ? `K#x"b#x @@   "Kb *` "  @@@W !"b@ה @ڐ"  @W  @^@V 9?#K#b  b@@ "  2@ 2 "̀ 2   "? 2 ` 2 ѐ cX@@`?`@€ ? Ͳ`K"     2.@*"@ %!!А@U  "@ !!@U  @U| "  @e " 6@k#p! b@M "@U+ K>" 1# K@M#K" b@/ "@U  @:#@VX 㿘L ?@U" @ 〢 "bL?"`L" socketSIOCGIFFLAGSSIOCGIFMETRIC㿘K" "  @w`"0a@TΔ @ ?V "a"0a@T @ ("" "bȰ mallocSIOCGIFCONFp !K" " +Ӑ @@`'#0)'@Rs' @3`a$@T  @)! , /Т @2)@ `` ` @Uj  ""ؒ@ ' ' ' ' ' ' ' 'v @@@R㿘b̐ "b#  "a"#8  €2`㿘" € 㿘" € 㿘@' b@ "b@"!K""㿘"̀ # 〦`6"#"`` @T0 〦`"# "!K"""!Note: trailers are no longer sent, but always received 㿘@Ɛ 㿘" € SIOCSIFFLAGS㿘"0a@S”  @_`"b@Ӕ R#`" "a@"a!2" @Sa  @<`SIOCSIFMETRIC㿘!"b@ @"$ " a@S @֮!`%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d㿘Ԑ!@9bԐ!a@"Ȁ`@+"`p? " " * @Q "Ѐ K @ 0#x#x  " ,` @   2 SIOCGIFADDR inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿐 "  !>" +Đ @`" @T "b@ "0a!@Rה" 6!>" 1 /2 Ԁ # @T !@#h!"#b@ٔ # '@L@#x"b@̔ "0a%@R" >" 1@ѐ## @SՔ c ""! ("0a"@R >" 12 # @S @ի#"b@ # '@@V#Ԑ#@Qb! +"0a#@RZ >" 1 # @S @{#"b@` #  p'@А@##p? " " * @I  ns %s 㿈 "  !>" + @`" @SI "b@& "0a!@R" 61>" 1 /2 Ԁ h# @S- 1@ #h1"b@ # 7 7 7 7 7 7@Y<@#(! 1"0a"@Qʔ" >" 12Ԑ @R @#"b@є # 7 7 7 7 7 7@Y@#p? " " * @ݲ K ipx %s SNAPframe %s X| "  !>" +ϐ @`" @R "b@ "0a!@Qb" 61>" 1 /2 Ԁ # @R 1@#h1"b@d # / / / / / / / / / / / /@\@!! ="0a"@Q" >" 12Ԑ @RL @?#"b@$ # / / / / / / / / / / / /@[ߐ@Ӑ# 'ѐ"x' 'ѐ"p'Đ 'ѐ"h'̐ '֐!' !7'ѐ"X'''   @ "``` 2@``@!p? " " * @ɒ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh "  >" + @!` @Q 0b@ "0 a!@Pn 6>" 1 /2 ׀ iؒ @Q @ӌ!(Ȑb@q @[ݒ@9!8"0 a%@PG >" 1א @Qv  @i!H @Z @!`! ""0 a"@P%Ȁ >" 12אؒ @QT @G!pb@- @ZՐݒ@#p? " " * @ %s: bad value㿘L .`@ `, ,  @U @u@@P 0@^ "  @\’ $ גc@%s=%o%s=%x㿘  N . .` . ؐ @2tp"?`"@ < " <*@۾ N`K. 2 %p ,>@ : ?`"@ ,`"*@@۟ * :  % p":` ?`&  @  `&*@ @ۂ* :` :`NN 4N`p"?`"@ > " >*@^ Attempt to set XNS netmask will be ineffectual 㿈L ,.`@ ,  ,#@@W, 4 4 4 4 4 `4 @"ЁAttempt to set IPX netmask will be ineffectual 㿈L <.`@ ,  ,#@@Z , , , , , , , , , , , , K"`4 @#㿘L L.`@@Y< @N `  ,, , , 㿘@"bNegative NSEL length is absurdSetting NSEL length valid only for iso㿘@K "b @`"Ѐ " R   @a K * 㿘L L L  usage: ifconfig interface %s [ af [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ metric n ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig -a [ af ] 㿘p"`ْa@*3@Ow 㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess arguments`@-@>  @ p"`@)cP@O/ @M " p"`@)ߒc`@O# #x @Ҩ @ 6@Ɛ#@3# +@#+)Lܦ!$%L !ِ@6c`f`s%!$@#a!("@#ې $ @M  #\ #`#dې d    @@ #   @9 " @4 ?' #\#`#d #h #l #p #t#x    @;  @N  ''' @M0  @M, @Mr @Mp @Mn L@! x'H'L'P'T'XH'?' ``䀢`''' @M `#####Ȓ>  ` *#"("#㿘'H'L'P'T'X @H@#@3 㿘'H'L'P'T'X @H@㿘'H'L'P'T'X @֔H@㿘L! "! @ fatal signal: %s㿘@3ݐ P@ @Ncannot get kernel security level: %s㿈 ' ' '  @N, ? >@{" ?cannot change kernel security level from %d to %d: %skernel security level changed from %d to %d㿐'DD ' '   D@M ? >@B"ې!0zD0!hgD㿘㿘  @)( ےbH@( can't open %s: %mcan't get %s for controlling terminal: %m㿘@4@f @Ւ ?ې"@N @)<?ې"@N Enter root password, or ^D to go multi-user /bin/sh-sh/dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: PATH/usr/bin:/bin:/usr/sbin:/sbincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting#p?#x'  @RW#@q#@# . *(J # ےc@@KG ,'1@r㘢L@ @M\ @c @L @ \#0@r~@mp ےc@K  * @K3 ? " ,L :, ,Op p@@ /2` -/@|'l l@K ''ې#ܒ`@@ @#ܐ` #ې#x''!ې#p@` #p@7 @L 2L H? @  ?D1"!)>+1'%L?h@s ?@? " ߐ`x0!$h   Ԑఐ@JȒ ? ې?L! h    @ @L  1!$L "!1ݰ"sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@!1?'' 'ؠؐ @J1  @J- #ݐ!'ݐ!'L! 2 ݐ!'' @J !ې#p@ݐ!(#p&@L% '>ݐ!Hےcp9? @  ?@Q `1)#%ݐ?@ ?@? ⸀ !hcp G1Ԑ   ݐ!cp@I ?ڐ?Ԑ    L!"@2Ԑ?'@ې0Ԁ  ݐ!ےcpՔ1ԑ:  21L"!ݐ"ݒb@&XH1"!$session database close: %ssession database open: %s㿘#$ "  @ >@r"     @ݘ 〢 "c$  >@_"  insert %d: %s㿈'D ' 'D?#$   D>@>"ސ!w delete %d: %s㿐 ' '#$   >@#"ސ" \ 㿀'DD' '#$     @/ `/ `/ `/ 㿘@JO 2  @Fđ* @c$    #ސ @c. $  㿘@F   " @F@F   @F@F @F%s%s/dev/㿘 & ,  (@F , @J , & &@I@Fw & ޒcޔ@C@&    & ("# & $$ (& $%s %scan't parse getty for port %scan't parse window for port %s㿘  @Fb@F` @I`@I@@F8 & ߒ``@@f   & ߐ  @FG &  ` "   @F:@B`L&   & ߐ q @F- &   㿘#    " ( (M "# 1!$@m `V20@of1 can't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@? ߐ"! 0 '@H˔ @| 6 " @@ ߐ#@ @I can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@)  `?  @}Ր?x?@x`ߐ# l? "h@G@G  @G[?@GO 1   & O") @G  @/!?>"   2 `@GK @G@Ii `@GC @G@G@̝   $ 4   c @̐   "'@@̈ ' @H  @(@  P@; @I: 㿘# 61  @!l Ӑ$   $`" ("`( ("c  (` $"`$0L?2$ L!"a@k $  L  L L L X   㿘L."! ^ # #L!  2 ( ?2&  $a@- & N ( 2 L! L1L? @F ?"!w! ?L!port %s changed utmp index from %d to %d㿘#    ?&  ( 2  @l/@#   @   ( 2  (  &   v& "    ?&  ߐ b   &  @FS 0’g0@mz# "1 2 ( &  @F>  ( 2 1     (2    ( shutdownsome processes would not die; ps axl advised㿘# ` `  "` `(`2` ݐ"c@"H # #>1%, ?@E@?2$(b ""!$$(@y ? @r ?"(( b ?b " !$  ݓ, ֐#(1ܰ!$㿘@q_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk][-a ] 㿘p"`@!`@F a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@%@/"+#>) '%@.X?5? .* LLL8LL LLLLLLLLL$LLb%c%#$8$4@bL"a@@bL"aDxɐa!(& na!(* @"0 " "c# * ' ' d' @ @Fk ? @ah  #@ap@Eݔ  !x!"c#4 !@c0!@c!@c!@c#@ڒa #@Ӓax  #@̒aЀ   "c@u˒a#@袒!@E # @6  a@0##0@ @E֐ @D#8 3"@! @ub# @  a@ # "@E  b@b(@x@D%耢  @b8@Dl nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8L@eja "L! ! L! ! L!, !, "@ 0@h !@ @@?@`?# @@! ?@@ ?# @  ?Q@@ 2K@@?@ `?# @! 2 @9@@ ! 3@? ?c @ ̀@2 @%@@@@ ̀@@? ?c @! @"  @@@@! @# #?B ?@ `?# @! 2 @6 @@ ! 0 @? ?c @ ̀@2 @" @@@@ ̀@ @? ?c @! @   @@@@! @ @?@ ?# @!@ ?@!@? `?c @! @ ?+" @@@@! @? " ? `?c @! @  @@@@! @##? "@? ?c @! @ "@@@@! @""L!! "c  "c "c<# ##(#< #P@~@@ @Bh6 #"c#4 #x@$`# ###@#@L#c@ @!&  & &@# `  %s: devread: lseek%s: devread: read㿘. >@B   "cx@@AՔ c@statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@;  a@5@ L `(@+!@ J#<""@L!D!@"  * "c `8@r#4 # P@M #-L+)'%@* c, "@#4 h@5 @#4 @( p0Ԑ`x@B2   `@B+   `@rQ@   `@@9  b@@A2!#0  #0@> 0 @r*`@85 @7y  ,@7t @ @@(' @8% x `* @ d,@  0 @( x* #< 0"@ 0?: `@ B  @$;  # `8@q#"#4  @秒`(`(  53/怤 d*@,"@c4 h@琒   뀤#4 @ pC#4 !@u`X 0!0 t" /-+怤 d*@㬑,"@4 `h@T  t ꀤ#4 @B p `8@qy 㿘@2more-E-m-GMORELESS--help-?--version-VVISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t option㿘@@"cP`@ @,b L "aX@9@@1@ W@.L!X  @*B"@*?"@*<"""@>2@*3 2*?@@b؀ 2@@*&"@@b耢 2?"J - +@J  2@@,  @`@*? 4@@, "@,@ې @=#`"#hJ@ 2@=#`"#hJ@ 2#"ch@=ڐ#`""J@ 2?#("bܰ?  @@a`?@6D  "c<@=  @ @0@  @@  @ @'8@ @8@7` M  ,@ $ M#8@/ @n M@7 # 2@d @@# @\ @8T?"b@T c ""@ @ @6 @? @@@9 㿘@#.㿘@@# @  @ICannot allocate memory㿘@ #@/' @ JJ "  " 㿘 #"# "c@@Ր #< L!T @@^@.d@ @@ hL!lр Ȑ @7;""`"`"` "`"`"`"`"` "`$"`(@$bX"f=#`n"W=`2"O=`I=o`KH=j`"I=`C=a`Ba,C=Z !@"I=g">=d8=Ki`7"@6=B%"@"5=#@-=58!@*p"@)=*'2#D$ "     =     =       =  2cD"cp"b"cԐ >'̐  ?''̐ //##'`'`'` '`'`'`'`'` '`$'`('  @tL"!lWARNING: terminal cannot %s㿐"耢  L!X ' H@. LINESliCOLUMNSco㿐 `h@=  `"#D@; "@@' "cDcD   "cD `h@=  `""@;Ґ "@@ "bbȀ  P"bȁkrklkukdkPkNkh@7kDh  '!@̦!!@⤒@>v` ,` ,`@◒`@>h ,'!@Ԓ̦!!@⃒@>T , ,@v@>G ,'!@̦!!@b@>3 ,!#@V @>' - '"@̦!!@B@> ,!#@6 @> - '"@ș !#@" @= - '"@_̦ !#@ @=ߐ - '"@K̦ !!@@=ː ,'" @7̦ !!@@= ,'"(@#̦2 //Ҧ!@͒@= , ,@@= ,/ #s//ҠА@ᰒ@= ,##  `//ѐ@ធ@=o,#@K!@_TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@:"Ȓ"@ 4 ""? /@H"@,@A""cL@<""cd@7#"cx@2#"c@!# "b"b"""#|"X"#"t""`"""#'#@퀢"#> *`# @ 퀢 "c\#("c\#0@퀢 "c`#("c`L!X 2#8@"cd#@@"chcd 2#("cdch #("ch#H@Ӓ퀤 "#,`J@ 2 V#P#("c,#h@"#0#  뀢`J@  :#p#("c,#@퀤 "#(`J@ 2 ###"c(#@퀤 "#$`"J@  c("#$"# "c#@p퀤"#4`#("c4#@`퀤"#8`#("c8#@P퀤"#<`c4"#<#@@퀤"#@`c8"#@#@0퀤"#D`2 #4"cD#8#@퀤"#H`#("cH#@ 퀤"#L`2 #4"cL#8#@퀤"#P`#("cP#@퀤"#T`2#("cT@ѐ#  @Ԓ퀢`"#XJ@ #"cX @Ò􀤠`#(#$J #(#$ @ @a@;2  '@t "c (@􀤠`#(#$J 2#(#Dc$ @@3@;  '0@FX"c  `@i􀤠`#( h@]􀤠 #(#x  "#p@("c#J "#$l l㿘!$#lcD@4#l㿘N  N@ 2N "N@  ݐ6㿘#\  #dcD@L "ah㿘#\  !L!h  #hcD@$!h㿘# @ā㿘#cD@ā㿘#  @ā㿘#$ @ @ā㿘#( @@( 㿘#TJ  cD@hā㿘#(cD@^ā㿘#, @Uā㿘# #0#, @Cā㿘#4 @:ā㿘#8 @1ā㿘#< @(ā㿘#@ @ā㿘#D @ā㿘#H @ ā㿘#L @ā㿘#P @ā㿘#cX !@"@([ cX @"ā㿘#X @āNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘@)@??@  "=!;!!@M ?.!@`#! < ?@ ?@"@([ seek errorread errorWaiting for data㿘#p #p`  2 `  @3#p#p2 #p @`?"؀ #p   ##p   @ ""#p  & & #p *  @ ?@6?#p`@!L`  ?#p<`   @8H ? 퀢 #p#`@'ޒ k?#p" L!p?2  #p $  @&P"   Lp *` ?"p?〤  L#p@' s L!\  $ ` @77#p`"`  & "`$#4  #@'֒ @  #l 2?#p "` "@&& " "#p  @n ch_ungetchar overrun㿘? L!p?#@'] L"!pFinishing logfile㿘L!\ !Lat !L#p $? "at#`@' !@?#l !L@7!\?$!\L"!dWarning: log file is incomplete㿘 #p c`g:  ')pp2  @'    L!\@6  pp p2  2 㿘@ ?4=  #: #cp` '`#Ԑ cp " #p 6 #!@q?cl #p   #p"  # <&"`  㿘1#p` @` #p"`$@:? @B? #l  㿘 #p 2 #p #p@&  2#p"`"`  4?p$p* 㿘#p@   @  ??#p` #4 "` #p` "`"` 㿘#p` ?#p   #p` 2 `? ?#p`?"`#"` #p@   @  Cannot allocate %d buffers㿐#p !#@N #p &'a@%ђ#p     #p seek error to 0㿘#p` ?$"`$#p@?p"`@@2"`!#p@ #p"`$"`"`"` `   @5 ?!@% 㿘 @G$#p` "`?""`"`""`  㿘#p@ !#p " @2"#p@ #p#p" 㿘  @5 ?  㿘!L@ !L  $#p @ ($#p" "?" " " " " " " " $" ِ L#p` "`L!L@cp#p` ?""` d㿘#p    #p` 2   @4` #p?"`  !@2y#p$#pL!L@ p8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘  # 8 '*`:  9   06,` ."  b c"    * ?N? !@$ } *,@$ u ,`  N   , *,invalid charset name㿘 "" N L   !x!x @7   2"@$L 4 㿘 @Cc q#  ଐ@J  *@ @  "*@ *@ ``ଁ*s<%X> J* J*"LJ kLsd  L u LL ᬄ  L  ᬄ   L LESSBINFMTLESSCHARSETLESSCHARDEF㿘@1 @1 t @1! J@  0      %cESC^%c㿘   #xa #x@ؒa1L @ܐ L#xa#xa@1#x" (  㿘@4c 㿘  @#Q `$`! J@4N "@$ `,@`L@ 2 `  !?  @ *`: @"@4(`L@  @  L!g? L!    @J`?㿘! J a  $ @"!@3  $  㿘  @J 1  J? y J?` 1  J? d 8J? 㿘 J  1 J 0 J 1 J   J   㿘` #! `$`J@3 "@$ N   ` 㿘J    E*L!`?㿘! J   $ @" !@3R  $  㿘  @`"`J@3=! "@$ N   L 㿘L! ۰ 0; L!` !`"`L!  #`"  #%`*``J@2 $@! ` $`N  * 㿘!L! .@2ߐ )! #L% @В a2 #La2L   $ a$`$ `""`L!"`㿘L!@? L!L!@"@ Ȓ `!*`@4H\D۠۴0X||ܔܤܔܔlL!"!L3"!L"! J 1 J    J   J | 1 J r L"! `@1  J?   8J?` )1  J? "N  8J?F L"!AL"! J  1 J 0 L"!, L"!'L"!"L"!L"!L?"! "aL"!Ɛ  @  L"! 㿘@1 uN! ?@1٢  $ bȒ &!@1ΐ "@:$ @1Ȑ   * ! , ?`: ! `$ *@ ?J? '1' L@1"Ȑ?@1$! 3G 0@ E L  $  !Τ  㿘 *`:  #L   㿘 J   1 J  J    @ J   @  ?   N? ? 8N?㿘!! @-$!"! ! #@-! "  $a @" *@ "a *?㿘    1@t!@! h㿘L!  !! : La"! "a!@9a͒ "a!$! a  1!R ! @! 2L"!!!( L"!Q 㿘a "a@;  Ր    㿘@ո 㿘@&!@0k  $  㿘@㿘<"!% @ @*!/?㿘!   "a!!#0! #8! @#@! "#H#PL!ā!done|done㿘!?`* t*`@ 4 d@a0UL@ +"` "`L!H "L@@,RL@ LB"!HL="aH!L!@5,!L@L` L`L@ 0(@N0%L@ ! L! @,&@ L"aL! 2L !@ J!@q (@ 㿐!`/"*`@````x``````````````````````````````````````?Ѐ x@T  dt "a@"! #pe"aJ!  + -Z + -  "a "a*!! @  `@Q J! + -/*!@ / -/// / 8 r  * * @ !"  @"! a"a     !?݀   C  [Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘L!`! @T@ "? @ ""@` " !#, @$#,$#,#8  "  L@ !L ] 8!"  D@!H$"@!L @ :03@" @!1less version %s㿐N"0'#@?㿘L! "L! @"JL"! @= !   g   0 @&?ungetcc overflow㿘La L! "aL!!@  x@  L!"!*㿘@-ѐL?Pattern not found㿘L!L!! @ @ 0 a >"a#a@#Y$a  @  @  ` `!0@  @ 퇐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈 "a#D 2  : "/%- +)!A%$*!l  @$&#@ ?l l ᄀ "/  ᄀ "/_  '/'@7쀢 ` `i`c!*`@th,T<(`Dp  LD﬐ bX  \l`"# @k$ @  0*`"# @X$ @  0 $$; $$> $$+  $$- @ "#4""l  !  @ j #l  "#4 4%bb @ Y 0 4%bb @  0 J@@  $$zX &$ d d$o@ 0j @ t@ 0_ &$@ *c 0T@'"`L 밐 %! $$fP %! $$^0! %! $$U. 0d!  ? ! ? &!  ? ! ? &! %! $$1  @%!@#H ?@"h@ J 0,L bp0?L@ !L@Bb 2LY"# R""@͒ @L@0!L 0 0 $$@) #8 "   $"ؐ '" $$@  " '"@0 $$@ #@ 0 /b "! c #p"`@ 0 c i 0L c@b0 c(\ #p"  @0| c0D ~#pp"l j h@0d %c@, f#pX"T   .@ J*!L %c@0[cH  0Uᄀ R cX 0H" (""㿘L"@)!LL#P@= C@O㿘  @  @"`"`"@& ?Warning: some commands disabled㿘L#ߔ #@0 Warning: some edit commands disabled㿘L#ǔ  @ @ 4J@K)` @ g `"$ ?""2J@ 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2㿘L#㿘L#"H"H* @㿘@J J ?i 㿐@N E27?N n23?N d2/? ' J `e'`e`x`c0 0Ð? O@'@%?  㿘@ B @[@    @( ?  @%@(%?@'@("L@@%? L` M L` +L` Go}.lessCannot use lesskey file "%s"㿐@$ `  ' h@@%yx#p@E "@ ?  *?*? ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?@J?耤 ?0 㿘舐@(& @ & N@ ".@` @*N@㿘`@(r@ @*N@  N@ "` @` `@ J"?8J?  ?J?㿐#LaL @?aL@@1!L#  L@!L#@@$#$#L"!L㿘L@aL0 @-%s"%s" may be a binary file. See it anyway? 㿈L!L" L!L   " @'@{  L @Ւ` L#'A@ ' @@$a쀤`@@$Y@$n @3 '@'#  @  @k ' @쀢 y Y @&π` !LL"!P$!LL"#"a@b!L@Yb "bOL!d`#< L@ L!H !L!T@`? $!T#< " @;@ (@S  #0 ' @k 㿈L!L  'Lǒ`@  耤`@L@#!L @!L!L     㿘L"!L@  㿘L"!L@ 㿘L!L@p? " ` 㿘L!L@k? " ` 㿘 @K"  @ɐMissing filename ("less -\?" for help)㿘L@\# " !@@˒ 泐  㿘{?@?@!Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@ @%h L!` "' O!@?`0T"*`@  ( ( \ ( ( ( ( ( ( ( ( ( (  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ( ( \ ( ( ( ( ( ( ( ( ( (  ( @Ya!L"a\@ !L$!\  @% ?L!\@% !\?$!\ " L!\ '"X@%s/%s㿘% L@ !@%@% @  `h@)@V @"n @$HOME㿘@"!В  LESSHELP/usr/share/misc/more.help㿘@"Ր!P !`㿘  @ #'L%L*`:  # %2 L 0 P g5@R`@%`L@  @ i  @ 1L'L*`:  # %2 @!LP@1`@ɐ@%b, `L@  @,%s*㿘@%Q ; b@ʖ@@@ @!ِ @!֐X !  @$ ?   @# @  @m ?  @ 㿘  @$  㿘 d d ? $@8`$ @` $@&,,,Ԓ @@!|@$ߐ,۠ ,SHELL%s -c "%s"r㿘@$͐`@$Ȑ" @$ 䫒 @@!ې N "@$@$ 䓒 `@@!8@AUa@!0echo %s㿘" {@AN @!0@!LESSOPEN-㿐 !?@!" @]b ". L |    `T @#  @A{ O&&@" 1@AkN` LESSCLOSE㿘"@A[@!H# P@AQ8@ @,# ( <  @$  @'Lc<   @# ْ @Lc@,8@C ǐ㿘#( 邞㿘#4 #l @R??{b "b㿘b @"b...skipping... 㿘   #D?4 #T  #D?   2C?7, #D?<@, L#Ѐ ; 0I@?@@ "?@7 @ #,   ?L#Ѐ 2?@!?,@)L7' ?" 0@  @ ?)@ِ  `#Ѐ ,  M   ,M  ,  $, @?ɀ #4 "" #l b "b)` L"L@L"#@1?㿘/ @ 4  #D? ? ""@@` HO@? `ڞ@@?㿘#8 "    ;♐ 07@&??2-` #D @ ##4 @  @     @?? b "b 㿘@ ?2 `@? wi$  , #D?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘W#@ 0@!#@!cP  ccP@>@@q  @ @L؀ L @" 2 㿘`2@L#@&& @" &@` &  Lc "c㿘 "` "@ђ?Lc?"c㿘 ᔒ & ?& & ˒㿘 !L!L@'$!LԐ@& @$ 2LL؀  2 L L؀ 㿘 ܐ  L㿘L##؀ " #ؐ@I   㿘   @" `"  "@ "` "   " 㿘?c"쀢 M * @@H G T@@,>?H  ! !##l < ??@. b  ?  ? ٰ@" !   ?#l @'?0㿘?f d"쀢  M * @  & @Ғѐ? R" &#ec鈠  ##~  ?cl 02#0/@ Ccl &d ?2cl.蕐  0+ @j@w艐)+"?#l  @?0` ?@  b 2  @K .0ۀ@@CCannot seek to end of file㿘 #@4 0h#D #D @Cannot seek to beginning of fileCannot seek to line number %d㿐@? $  @yc 04' 2 '@lc   8   `@㿐@@@YDetermining length of fileDon't know length of file㿘u? !H@ (k? !h@ 0 @@R d6?@c 㿘ǐ  ? UL@Cannot seek to that file position㿘@А@|$ $ @?D@ g玐  "x@j 0_@ @ސ?2 ? @|""""""#D?  &@01#D"?  x 0' "#D?#? cD ?@J""@#D?       (%6d㿘# B@G#!# a @`a@Ȑa  "a!!`#! *@ c` ! "c`#  !#1!*!`$!*@a $a@W#` !a"!         Xt         |ā㿘 %?  !`  !J@` `!`!J@㿘!"!!# aJJ !"@$!㿘@- 2 # a@ @"Ȁ@4K !#!D !``#J@ !J@  \ ! *@!`!J@   `]  a?"a# *@!*@a@"a 㿘J!  @a  *!  # *!"! @㿘a ."a!# . :`J@ _  f  !# J@ !# J@ _ Ȑ D  # "    r 0n ͒ ! h  b"ac` ! "c`%#   K! $!@c`  G 膐 5#  臐L!!@! bȀ 4%   !*`:  ! $! N   Ҕ  a "a 㿘J!  2 J!?a!bȀ#L  #d # #  *!*@ "# *@!*@~  "@   HJ"@   ḝ㿘?"+? 2&?X?# #` A ,A 6?`,# &@㿘? $!?䏐? !? #,# F  ??,  `2&@          Ȁ   " 㿘!!Ȁ    A 2 ܀ @"!"!"@"`"`"`$ $@ʐ ȐƐ!Ȁ !!  ! 4#!  2 ! " "@Calculating line numbers㿘 !p@  M "`㿘!!̀   d$!@ c$!aВ` ?$!́㿘# li`q !!Ȁ     ` @ @ 5"a!Ȁ"    $@  "@)   G "!  M%’ l 27 ?"4  M" 64'?0%o  ! "!  M%̒ l 2 ?  w?M" 㿘`Z !!Ȁ     I @ {!Ȁ"    $@  "@ !  24? - %Q l 2'??   2?  %g l 2 ????㿘@ Dq? ?%D ? @ 4? D?""?! /dev/ttySHELL%s -c "%s"sh㿘N -  Y@ *"@ (@ %" L!Lk @ڌ @J @N @W "(@Ւ  @N @t"8 L@  N @>@; $ b@@~  N 2"P@@@ @N@@ @ ߀ "b  @ 㿘@?@  ?" @ ? .@ @Cannot seek to start positionwCannot create pipe㿘   А@6` @ڒ t?ߝ@n"@l@i" +?@1Ԑ @  @- "y?E  ?` $  @ . :  "  $* `@?*ݲ`$ $P? ?` $  @ . :  "  $* `@\? ހ?@6 @ے @; y ޹  "b@   ?(( 3 ? XInvalid mark letter㿘? . * 1!X? #p@>  . * 1 Cannot seek to end of fileMark not set㿘 '", . $0' ^$L!& & aL*"!t  #!Ự!& #D?& !Ჰ!& & L!L$! T  ? @  㿘`?㿐 @ & & L!L&㿐@? T"`"`L!L"T㿐!T@ `?2 'L!L"T"`# "``'`'L@!L@ Mark not in current file㿘h L!L@"`@ ?Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &L  L0.0+*"!dd "  L!\ " &L"ad<!\ L# !d'#@1㿘L "a`’Line number is required after -l㿐 ' l@b 2`M (@  0 "`Cannot use lesskey file "%s"㿐   ' @㿘  0"M " ׾@4#`L!L @? ﰐ װ 0<c Tags file "%s"㿐 N  """(0׍N"b("('!@/㿘  M " 騐饐"@%s㿐 (  "N@0+*N@ M" m = N " `"`"`"@' &#"̓*`@'"x@]㿘   !n#$#㿘   @ 㿘     Use "h" for help㿘#H    #@ 0'  @4cL "aT 4DThere is no %s flag ("less -\?" for help)㿐'D! h " D € $ h" hJ  !p J? `0Z'D*`KJJJJJJJJJJJJJJJJJJJJJJKJJJKJJJJJJJ`JJ4JJJJJJJJJJJJDJ@ +`?`"iJ@`d'DM " DJ@ +`L'DL"aHDD@P'DD?'D z@2  @b' @t\    "`   `, # D&     `?"N  @  @*`? J aD@q'DD@  "@ D €DJ@ U There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@e@'  ` @@א'   `! @̐' @@ޒ0    HJ "  ` @  "j``  "#   ^`: 1X`M"` O`"` K`@``?C"@9"` ;`"N@7`N@@@` @c`?` *"@4)`%  `"` H`` @ 2``  "` `"@ @] 05`   `€H`  @ $`  "`    ` *  '`@1`  "b`  @ ` -%s㿘]1 `@@`X `㿘@p "   S@ 㿘@d" ` 2` h@ String is required after %s㿐͐'!@ߒ㿘 hJ㿘N 2Է   `$2 . N Number is required after %s㿐ԐL -    ?А ? $&'!@Ԁ   ?А* *`:` ?Р  А (. $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe less helpful in promptsBe helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenM H   "    J2 M H kJ "  J( P J 㿀'''@+N p ""@E% ?@! $"@ $" ?㿘 p@+7 㿐@n%s: %s㿘>@"@)@&  c@i * 8"㿘!N N@ d$ N  . * * @ d@㿐#l  j"b  ;L;    0 0      0 0׹  כ  `@9   0  0 חק׷㿘N  @L!T   `@ "bN "`㿘N  @ b䀢 N5"bN " *㿘  *` : N 㿈6 `2 @ 0, @ ` -, 耤 $?L?㿘  ,*`:  % `N d  s2N@` *` : `L  N@` @N 㿘c0 "c0L!T  ֽ"L!T Nj 0% Ġ "@  q    ?P"Ȁ "b)㿘ք֔NP ֕ "b㿘L!T  ko@L!T  0 "Ȁ "b??? DNND D2 8Nȅ*  D@ ND*` `@  DNȅ( D` Nȅ*` `"Nȁ  D NȔ?#D("@㿐#D`!N Ȁ ?@S@  #N'#N!#D $`#D"``ȑ*  "?N@ ?D6?ND* @&? * ?㿘#D @ 4 Nȅ*   *   D?ND( "   (?" D $ D6?㿘Nb b"bN\!$ NX!X$ NT!N"bH !"!H!%ld㿘!b@%d㿘!b@㿘! " ᜄ  ᜄ ?*㿘͐ !#D   #D -㿘?. > `6 *`@ijjjjjjjjji`jjjjjjjjjjjjjjjjjjjjhijji$i0jjjjjiTixijijjijjjji! ?@ 188"L!L@Ƚc耠/@ ,## ' 0Y 4!  0" q?i 4  0b8 @ L!L@  㿘?`6"8*`@lllk0llllllk|lllllllllllllllllllllklllk@llkLllk`kllkllll lllll?\0;#h0XLP!LL !L< Jޞ ` A <А?0:˞?.`+!|`!  J  "Lo!L   J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J!*`@nxnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnlnnnnnnnnnnn`nnnnnnnX&@?&@? &@? &@# &@&@?㿐`"!N 21Z" ?#*`:  :# ? %" .". a \" a $a!* N q 2 H N ?] N ""! @1 !` * @!&1 㿘N" 㿘#̙+ ""@"Ē"@  @' ql   (8`b,(" @J@2 @( @*`J@ @* q(8   J  N$@ 㿘 a`. "a#  ##D?%?"  @  " [ D?"!No previous regular expression㿘 "t 0a`?"a Invalid pattern㿘 2 @/  N@֐#U  ?"$ "N@C;N""$ 㿘N"$ "N@C.N""$㿈N"$ @ `?` &@&  㿘N" "N@N""?"a"쀠N2 N"  "  @$ 2 㿘 ``  @ 2" ` & &``" ``` 4 &```@&@?0&@"㿐  +   &     2J@&  J@ `'J` `J` ݐ`'J` `׀ 㿈'L='P:'LP  H L""`P""`P(N  L%P L# 耢` 1N@'a"耢`2@㿘! b"!㿐f? ?@Ho 㿘"!"쀢 㿘.  " ӹ?oӲ" "  x ? D# r K 㿈C+)#l r?` 0`  `Y`?`2'@T#  , $a #  a@ # "h@ 2 @   "󀎠"쀢  Z 쀧 2' Nothing to search㿐`N@  2Q""쀢  "쀢  a "a3"!m" 8 Ԑ M?  "!" "!b"!"쀢 c "!"쀢 ? '`&#  !??  "쀢  : 0 ic "쀢  .  㿘'H3a! paH?  !?HHM *` 'H9HH??!H M *` 'H!'H!M *` M  *` &!&M @ M!`"H?H   H H?H"!"!㿘 @ђccl "cl" 㿘 @cXcl "cl" 㿘 @ccl "cl" 㿘   @c @cX  c@  @   @Line numbers turned off㿘#lU""#l @u Цfl  @j  @g @@  @_cX ? "b!")#D"Ȁ#D #D 2  : " "bjM` "`#  "b"#  P tagsrNo tags fileNo such tag in tags file㿐N"( @]aऒ y!@!)+' @z f@I L  %b%#$_'J@ %#J@J@  `'J`  * E''J ̐ $ *$`'J` ^J@`'%bJ "JJ``\ '`' @*J J $"*@0 @ !' "#Tag not found㿐"   ,! 8 &?b -+)l Yc Ӓ"@Ԑ@ l/dev/tty㿘!! @@  "b "b㿐#?bW ? ?ODZ O "/ b㿘@ Ffs.%s8@Q)!' %#@﨔!? f"$ s F"$0"$c@a!(*`@& ## \" ] "@   . 0" @. @@!a@4 @|`@/ @w?@׺  !b@a<    @@@ `@@V%s: is a directory%s/%s8# @׋ !"K# <  !#@= @n <  @a / $!@#  @ >"  !#€ !"@Ұ 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘p"`"@ᓒaH@א 㿘@㿘 @@`@㿘`@@ @㿘`< < ` 4 `< < ` &?`< $`$$`<   $`$ؒ?㿘`< < ` 4?`< < ` & `< $`$$`< ? $`$ 㿘`< < `4 `< < `&?`< `$`<   `?㿘`< < `4?`< < `& `< `$`< ? `u 㿘`< < (`(4 `< < (`(&?`< ,`,$`<   ,`,L?㿘`< < (`(4?`< < (`(& `< ,`,$`< ? ,`,/ 㿘`< <00@4 @2  <44@( < `<00@4?@ 44@?㿘`< <00@4?@2  <44@( <?`<00@4 @ 44@ ߒuappnd,uchgnodumpopaquesappndarchschg㿘*#  ##@b#"  `@###@b#"  `@###@b#"  `@|###@wb#" `@m###@hb#"@ `@^###@Yb#" `@O###@Jb#"``# ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&')@'%$@b`p"$ &L "$ n2 L  o2    ?* : `$!*`@h0h#b@̞  $```x@̒ 2 `"$&`"$@&@`?$`@x  2ǰ `"$ &`"$@ &@#b@`  2 `"$ }&`"{$@ v&@#b@H  2``$`@<  2`"^$Y&`"W$@R&@#b@%  ``$`@  $`@ 2a `"4$/&`"-$@(&@#b@  2``$`@  2`"$  &`" $@ &@#b@ה  ``$`@˔  $`@Ĕ 2 `"$ &`"$@ &@ COLUMNS1ACFLRSTWacdfgiklnoqrstu㿈@\ @>  %@! " @O"``h@a 2`O"  "`"@ "`l@7   "`H%") '%31/-+O%@~??π D* 0000000000000000 00h00000t00000 00$0000000000P00000<0\% l$$@$@% l$$&`X$&`X% l$@& T%%& T" L `%`` " H" D%`" x" d$"`p~ {" tx" u" \s%`p" Pm"  j%`g" |@(d%a!(&*  d   P   L O  "`   D  L "` | 2`  P @+`p p p &!: "@ \ (O    "D @<!#9! "2# T "#* "'"    " !#!H " # T # 0"""`, l )  P )!D* "`( O` @@7 %s: directory causes a cycle%s: %s %s: %s: fts_read㿘 x  (#@+k2 @\d @- @n  D _ `  . a5@,@L>`4 " '  "V`20 !'0 0@`@0!'`@@d` P@0  0N`@ .0 H 0 ' X@h`  ' `@`` &0@-E@ `  @-' 0"  '@[`h%u-%lu%qu''`; 'L d    2'L P "'t'L't '|  'l'd'\'T  Ю 'D'<4   !'@@ P@= `2 L@4` D $ .  H  $  @ @[&&8L` <`8   2``< (``<`| 8'|` t 8't`08 `02`<`4(`<`0`< f X  D'b`@` < 'b`@`D <` @& `@T @͐T 4'T@Ɛ\ 4'\ t '`DXbh@d@ 4'd    @$   @[# $@͒ $ @Ȓ`< @@@ 'l t  $ @$294J'''L`.l''̠ #'bp@Ȇ@k'd'\' bp@z|@_' bp@rt@W' '@hx@M'T' (@ "`0  @㿘 4"- @ 4 &   2  2?|@R 2 2   ? ,€@㿘 #p   @ b? "b`$b*@ @   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 " 2  P "  ?`p@ )@o -)+<)p  d <)  @[` P   p?: `8@ B  @ޣ;  @F`@() $`  , #\ #` @6 t )! @- ` @@2  )! `@ `    ()!("@ )8@`0 (@ `0 ` T "` `(@)!@@@ L "`@`` ( "@5"? "" %" * @ 2s 㿘O T@$"T!  8@*` $ 8@  `  8` .`"```2`  d     P    L 2  O-  !OА0p @ @@{@w 2R 2   2  P @ ?`p@ )@h ت @B95p  ) 8,@ @8  p"`?`$``@ @`$@*@@u & 8? " & * @^ `@Ŧ 㿘 < d  ) @` P  p?: `8@ B  @];  ) @)!@@ @ L @`㿘'D@_D p"L@ ?`&  @  `&*@ @   $L@  p"L@ ?`&  @  `&*@ @  $L@VpD;!@  p"L@ ?`&  @  `&*@ @Œ  $L@1pp"?`"@  " *@  p"L@ ?`&  @  `&*@ @  $L@p"?`"@  " *@~ 㿘<(@"6p @ @ p] I0@88@FpT I"?`"@\ / " /X*p"?`"@K | " |G*"?`"@; @ " @7*p"?`"@* = " =&*"?`"@ % " %*p"?`"@ * " **@   %s/%s ls: %s: %s -> %s㷈V 2 2  $)@@ @ $,h@ @@$ >@}"p"`,`p@ױ0 *7, @qJ   H ? (usage: ls [-1ACFLRSTWacdfikloqrstu] [file ...] 㿘p"`,@׀a@Đ 㿘@m:pinvalid file mode: %s%s㿘@A  ,@ b@/ 8 ! ',#>),@䏔 ? m p @bЀ "( @,bb@B!@a!(* @@ @@ - , -`@@W ? / *@@@8J@ 4 @@ 4` 6`  @@084  6`,"@@~/@ `@ @G/%s: %s8,#@Z@|L`?,@u >" 2 ,`2.`.2 @0 ,"@@}?<    /!,@ #@}ݒ? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘p"`-@֩a@ 㿘@&node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐@S "`@_`J c! !`J b -@+~ax` @7 ` @ J@  -@+ma`@& ` @ J@  -@+\a,  2    -@+Naؓ. `@/D2`  -a@U`@i usage: mknod name [b | c] major minor 㿘p"`-@ch@T 㿘@unionsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%ldsignal mountd㿈@D    . ."5 #>/.@ⓔ耢?k? 8d* $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$  &bJ@ ".@ O" . @*`@:bb@% ?@.a!(&* @ _   0O06@)dL. @a . @a( . @ڒa0 @  . @ђa8 @ݐ ۀ   `?#\@/ 2Ϣ 0@ 7   .@T4a@. @@ < " @;@ &. @ΐO" @@@@u@ ' .aP@)@@)' L2&  .ax@)@) L@)@2  @)@2  .a@)t@.@ha . @ba(  . @\a0 "  .a@)]@ #\  " 2#\@.@Na .!@@Ӧ 2#\@` @@"`%@-Z  .".@b.b @⇔  @ ? >"  .@Sb(@@5,㿘N@ n N` o `@ '0`? @.8J@ n J` o  `@ "  @ܒ " @l/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %s\@ؒh `0!(h0!8  O@ .!(0!8@@ݒ0@ma@  @'%@+h ע@8 Z @0   ˒0!X 0@ap° 0@a.@a @0@ah$0@A'd'h 'dd@hd`'d*`">p`'d*"p*`@"~p 0!@В d010, @!@~p d, 0@!o @U?  O0-0@y!@_ #ph907>30$!@@Qh⸀ aؒ@y۔  >" 0!ؒh@y͔@ @V`@@ `0@y!,  `>  0#   " @6 0!@y0  @+h 0!H@y @h %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘1"@  L @- #3@=#?I? 0B*    Вbp@R @9a!(&*  @@.@`'?'  ' '''3#@(  @O/ @ې usage: mount_cd9660 [-egrt] [-o options] special node 㿘p"`4@~a@ ,-o %s: option not supported㿘@~+ @O 4@*;b5L n L  o  @J = 2*@i "   "4 @2    &*@& b@$NȠ @ߐ㿘@ԸԨԠԘԐԀxph`XP H@@80reloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %s @Ҁ%5'a= "cL"(#>!4@ӔȀ? ? obВ#`@f@Na!(&*  @@C@'`?'  ''5 В@'~ >"  2>5 @@"55 ! @" 5a8@#m@ usage: mount_ffs [-o options] special node 㿘p"`5@9b@} ,-o %s: option not supported㿘@| @M 5@(c5L n L  o  @ = 2*@# "   "5 @2    &*@& c @#Ƞ @㿘@ڸڰڨ ڠژڐڈxph X@P@80( @nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%snqnfs 1/mount_nfs:nfssvc err %m@Ф+P #"ap'x'tPbP@ X)P %>-P6@?ђ?΀`F7!H*`@ބdTTTTTTTTTTTTTTTT(TTTTߌTTTTT8TtT,HTTTTTTTTTTT޴|TTTTTTDTTXTD@TTb "%"6 @!wc0" "%b6 @!oc0` =$`В|@ |J 26`6$`86 cX@!Y`S ~%` z$`В|@ה |J 2 `4$`@ 6cp@!<`6`(a$`В|@ |J 2 `4$`( 6c@!#`` @H$`В|@ |J 2 `4$`< 6c@! ``@ .$`6`xx@tt  %t  ` $`t t`($`t t` @$`t  b "%" 6@ ֒ct@ " "%b 6@ ʒc` =$`t @@` $`t P""t!$`$`t$ b "%" 6@ c`!$`t(t` $`t@P$`  "bt@ !P6@N<c@͐ 4"'t`$`b "%" 6@ c`!$`В|@ |J 2 ` 7`@ i"!pВ|@ |J 2 `4$`$ 7`@ U` }$`` y$`$` P t"bВ|@є |J 2 `4$`, 7`0@ 6` ^$`В|@ |J 2 `4$`  7`H@ ` H$`В|@ |J 2 `4$`0 7``@ ` 2$`P/""@t,6a!(&*  @@i@`@ 7@  xx@#ږ "` 7`@JZ%6P" 7@Mi  ? 7@JH`@ @#T@ @ @ 7@$s 7  @sm !'%>#7@#   Q @rI`!@ϐ no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!!@Z Z!, Z@: @  @4 : 9@qR!0  *#@` `$` @+  2P9 "@*9"(@q1  @@: P"     "!p  ` =&`  !p "`!p 7 %P + -  o5 P",`   ab@=, 2 5  ap9@~"P{ap ''P" `  ab @zz  ''ܐab@2   Tap9@~"`Oap@$ ''`$  %%'' #\@ :Ж:# # 2P" p9@|Ӓbpp"`7@n` ap9@|Œbx7@p|  ap `@  @%apap? "%ap  ?@K$  ?9 @Hےb@ @!@Q @O @M 7@#  $@rU <ap A  P" >@h  @"b9"@p3  2 &` &` &`?&`!&`D 㿘'HH@W$㿐 @ "J @ "`D    =  &` `@ 5@S` "0 ` ? ?*`@` $@C   @< `@"` &`2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘p"`;a8;X;;!;@cb@ ,-o %s: option not supported㿘@w @G ;@#bp?L n L  o  @. = 2*@M "   P  @2   "*@ ""耢 2Š ; bx@( @鹐㿘@O unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfs㿐@ˊ%<'#>!;@? ? obВ#@A@)a!(&*  @@<!`@   @G @Ȑ usage: mount_kernfs [-o options] /kern mount_point 㿘p"`<@ma@챐 ,-o %s: option not supported㿘@v @F <@")bH5L n L  o  @8 = 2*@W "   "< @2    &*@& bP@<Ƞ @͐㿘@if%s: destination pathname too long0@'<%# @5㨀? f i$$a$a$@a!(&*  @@@័ "a. ?@f  <   $@@@@d`@ . @@@֐L / /,@`?# )<@@F / @@ ##@m@  @즔@@4 "? ?`@Ԑoverwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%s ! q@v k!   p"`=a@N0`! )@_  $@Β 2  @@ @В O =!=!#\p"`=a@"` `-p!`? "`@j p!"! ` p%p! ? $ @U  $ 2 `y`Y2h @ >` " !=@B 2 =!@lN @l @Ԁ  =@l"= "0@l7 @L <   @  = @ ="@ @0 ="P@l 0<  @(@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set times㿈  @ 6="P&@! ="P@lz@f  @ >" ?Ð@ے* a #!@@"a $!@l[ n #)+=a@! a@"bP="P@l@@ >!@l8@$@"G @>"", >!@l% 3 6! >"@l@ >" @l' '''@H耢 >"0@l@ ="P @А > !Ȓ@k /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿀'@'䀢 2!? ?`?@C ="P@k @r @2 ? ? ?@k`K  ?!?@k`B : ?! ?7`@ 2!?!P?`?X@B ="P@k!P@@ @1Ҕ ? ? ?@kvaP  ?!?@kmaP :    ?! ?aP:@k] usage: mv [-fi] source target mv [-fi] source ... directory 㿘!p"`?@c"`?@c8@\ 㿘@ (    *`2 ,-o %s: option not supported㿘@r @C ?@c5L n L  o  @̒ = 2*@ "   "@ @2    &*@& `@ДȠ @aupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%d@  @ @@Dߒa u"#x"c`@F @!@#` @!@"B < !>@.?/? ;'*                 , 8    D h             x     D   h      ,     H p     u"#xu"#|@"u "cl@Ր"0u""c@"Q "b@Ȑ"H@"Q/"b@"p@"Q "b@"@"uc "c@"Q "b@"@"u "c@"@"Q "b|@"@" "c@#@"Q "bx@#(@"u "c@z#@@"ВQ`""`cw`@m#X@"Q m"b@d#p#`  "QaQ4_`@@5c "QU""@@,c @QL""@#I`@i"Q B"bp@9#@`" 9"`0A0 @W"u 0"cA' (@N"u "ctA H@x""АA@`` 2 `@:"u "cA  h@1"Q  "btA @["`@Y`ϐa!(&* ` @  #`  @D#` 2@ @' *A@`` $$A@˖%$#A`A@@?X$`A@@?N A`@@#` 'A@` !?` @囔!"' @' ''$''.7 77'' / 7@@, /u!t#hA`#Aa@#h@ђ? t#hAaa@t#hu#x N?@ƒ 6 >@"A!@@    >@"A!@ A!@  " &5A? r-A @ ,@ @   0@|L!'#` !u# "@| A!H@e#v @f 6 >@"A!@U@@ 6 >@"A!@G<   #` 2 @@A!``@@@ ?"AJ?`` `@M@q`  A!@@#`  uc `"c@’M@q`   M@* : 2 A!@@M@ uA!@@M@uc u"cu#  #` A"@@M@`0 2 u H "`0."`0uct 2 u 0 "ctA"P@@uc 2 u , "cA"h@@ucl 2 Q ( "clA"@@Qbx?2u L "bx"bxuc 2 Q J "c "cQb|  b| "b| (c$ "!Q" " @]  $"Q"|* @ "Q"" 2  Q@@ڧb? $ $c QQ"|* "cQ" Q#Qb !p"`A@b"`Ab@  $bQbp?2u @ "bp"bpuuQ#bp "pQbt?!u B "bt"bt!uuu#@ctQbt" $# 8  p"`AcAA@#Huc 2Q"2 "c'P'T'X '\u!u#la "#h@:""$#l!u#@3$#!u#p@.$#p!u#@)$#!u#@$$#@x%$u#lb `&a<` u""cl!u@خ#$#!u@ة#p$#p!u@ؤ#$#!u@؟#$#@؛$@u#hab@"@، $`&a@<:` $u#x  uP@&  @wu#x @@ #` .@A@Rch'p?'xQ"  't'tu#'uu#@Kcl'Q@!`@p  >@"A!@W`@  ioctl (GDINFO)㿘e`e@᫔ 613uc`8 "`8@a A!H@4c0 F@dƐ Q"@,1!ioctl (WDINFO)%s: can't rewrite disk label㿘 8 6y6 e`g@q F@d!F!@㿘'H'L'P'T'XH @p   @  @f/  @e=@fl@{@✐ usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device%s [device-type]where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder 㿘#`  @p"`Fb@d !pp"`FbF@Z!p"`F@Uc"`F@Qc("`F@Mch"`F@Ic"`F@Ec"`F@Ac"`F@=cؐ"`F@9c"`G@5`"`G@1`0"`G@-`h"`G@)`x"`G@%`"`G@!`"`G@`ؐ"`G@`"`G@a0"`G@ah"`G@ a"`G@ a"`G@a"`G@aؐ"`G@a"`G@b@= mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/''|'t@y[#` @@'l V@ݟc@<2H@jd @9 @'j ? @.: @, @  #u!uc@Q#luc ?@@#l$cuu#@Ccl@ u "c@ " @" <u#| #?"%,"%(# "%, <"%(u#`4#H@ @ u?cl!@ [##u#$ u#t`$ H@z 8@ސ  X`4H@p P@Ԑ cQ""`0Q"|"`4 "H h@_ @Ð # "H@U @޹ u#cl 6H @I @ޭ #o4H @?@ޣ ##` 6H!(@3 @ޗ 08 "H48 "L ; :8 ::@  "P#`P <"`P#" T 4 #`T <"`T# 0 T:@ " 8  " `#`` <"``##耢 &H!h@@:@I !#Q"$%P 02 $ t2 $ xu 4@cl$ | $ d#`d <"`d%QQ"b?4@ԯ?8@Ԫ@G$@@ԡ?@ԝ@:$ $?|@Ԓ ?@Ԏ@+$?$ #`* <"` T T "x* "x0* * ?: :0 : # t:   @ %0@ C<%0#u#"|`*@"X  2: "X <#cX: "cX <"cX##u}T@cl6`} @}@’|ؑ* @ ?@@ҷ4#c? h P@ : c @ҧ l 8@Ң ?  @?@@@Ҕ$ $ Q"   $%$ #/#?#`* @|eP*  ``,`: `@p`@`|`,`:  * @`|L0@ӽ* `,`: ? ; * %<cX* $cX.?@@Ӝ@9$``8*`$`8`` `$``##2 `8H@!H@!@ : $`8``?$```4* $`4`|* $`| u@cl@ "@gc?#c`x@_@$`##0,@S ?x@N@xv 8 ro!H#H@ڒ"@8!b@?0: &08: &8`?&`>?@$@&* @ѽP*  `,`: @ѱ@|`,`: # * @Ѡ|L0@* `,`: 80 0* &0 d@х"@c?dĦ@ْ@vd}  (!# 0* @ʒ ? x@Œ@b @\"@ҺH"( `` H"H@cH"h@` H"@`\H"h@ `Q#b H"H@bQ#b| H"H@c@ Q""`d@|  u# H#`H#pH#0@z!# ?@f@$ u# #Q""#c@`"@Rc?`x@M@$`' h#)x* @@ ?@;@ؒh@ "$@"@+#?@'@Ē$h#/#* @кP*  `,`: @Ю@ |`,`: $ *  @О | L 0@* `,`: 8 !! "@$@Ѕ"@c?x@ݒ@z$# @t @ |$  | `@̓* "H@Ӑ#@7  d6H#@ɒ@- Q db-u# `H@# `` `@  H #`I I 8@I X@`du# @ #ഡ* @"P*  ฐ`,`: @!# @ @s |`,`: @#e$ * `@``|``@`* `,`:  #@ BL ;   $ud: "$$@|@A$@`$ 't ` 4I@< x@ڠ #u#"Q"x"u#p" "LD%hL "h !"X!!@ϱ~* ~@ϭ{\{,{@ * !  h~ #\$`%` $`#%`"%T`"%X4 X* * X@XI!(#\I I`IXI!@?$"DL "h X+-## ? @6 - 5L?,` @RP* T 2`@&L #& @<c褒t## !@1|@Џନ@ଢ@Ј@%@@@|@P@x`<L?,`-  @@ P* T R? L?X@*@?X@L?,`-  @@P* T  ".L?,`-  @@P* T 2#褤# @# $ , @ `$ ,!# x ` @:   $  ,? 8 4 #@Σ``,@Ξ`` $`&@`8$@`8I!X@~I!`I@~@U ##ܦ?!u@z #" It??,@n?? ># 8*`  @a PI@~ː!@/ c@W``,@S`` @ϰ`8@Ϭ`8I"@~@C`|I@~"X`,?$`,`@`$$`%u@2`@ϑ`|$$`$'tt#` 2#`\uT#@Р?@`\$`\I"@~"@c`"``,* eD `L "``02  "`l "`p#`p <"`p!`L @`L$ 4dF!T$dQ"$Q"$Q"$u#$ 0@? <$Q"$$b8$`$$`($`,$`0,`4,`6 ,`5@$$#` - $@ #\I"| I#@~(  $ 4 ($Q F ("F #`#\'I# ? ,@~  #` I@~#X@  #܀6/#@` 2% #I@``-@z```dc@}f, I@}ؐ# I#@}Ғp@̻" #܀Ԑ#` 2uI@}#u#x #` @ @|!#$ u@ΟclQb@}  " - H#+)#< H@̗*@ " 0@4`4 @_ #l& #܀ #%Q@ ``-@```d,@@ `, ( ##  `( `0#` l@` @ @ք @ւ @ր I@ 9#Panic: cylinder group too big 㿘!#@   $4#@̾``.@̹`` %` %`?`4@  .  4@P!4#h @[P#h$ @"U$ $ ?4`@`4 #h`f2 4#h h4 &$ l  @$ p#4ch $`T d d*  $`X@o* $`\`\: @ $``  Ԁ  4#h``;@X;);X#h`` d d@O?@ͮ?Ȓ`,`:  ?$`h4hh` "h  Ԑ *  "l `l;@2;;X;<* @͎`,`:  $`d4cc̐?"@ P@4Q@|"P@ %h `h ("  4#h@"U5"< ``:`@ \@@  `` ?$@+ @* ?``"  9 h#/uu# h@;: @& 02  3@, @"`l c2  @.@˿d,0@8֢@  9#4#h@"U@#5`#@@ Ԁ   : l l   ?$ *@  * $@y`|@`* 4@T#@@ "@@g`|@`@`@_`@`@Y`@@`@SeP@̲`*  @̫`* 5`<@ @A`|@̠`@=eP* X @@ 2@#c`("`(#4#|#|" ( $ (@ 83  8"@*`@  "@  8$6(4#h@"U5#@   :`@ `@@    ?%+ @*$  "$#& &-#4#h@"U5 <@85`#@@” Ԁ   : l l   ?$ *@  * $@ʭ`|@ `* 4@T#@@ "@@ʛ`|@`@`@ʓ`@`@ʍ`@@`@ʇeP@`* @`* @ @w`|@`@seP* X @@ 2@  &@& 0"4c*  " 4#h@"U5#@ &:`@ `@@  ?$+@ @*$  "$ Ԁ 74#h h@ l@ @   p@ 4 ` ` Ԁ@4*`@  #@  ` *  `؀@耋 `  Ԁ@4*`@  #@ !#4c c $    $   $   $ '@'`'` '` @  .@ @ @ d,@ 0@㿘c" " " #` #!2c# 4 u#|  R!8@0 :  < Q#(@( : :%c@_c$ ( e @ C ` :` @ + 3`  3 $ h`0* @ʔh@ 㿘#h @",`,   4 @% `@$,`@*` 2` ` @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘c` `d*`4@3h4#l@"U@U/ H4#  U' `4#|!U#4#h@"U)5%'4`#@``@m@  |&`U @yj 0 >4#h@"U@5` #@#@ Ԁ 4#h  : l4#h l    ?$ *@ * + 4#h?"#Đ?" 4`?"`@ ! " "@ "@#@ȫ |@  * 4#h@"U@4 T@#@?"@#@Ȓ`|@`@`@Ȋ`@`@Ȅ`@@`@~eP@`* 4#h @"U@ @`*  Ԓ  #4ch!#@e |@ @a%P* `X @@?2@##E @ɱ `4 "@ @ "  "  $ 4h$ "$4* `"  (4#h@"U5#@  ,` :`@  `@@  ` ` ?"@( @*c耢撆 c` `d*`4@Jhfsinit: inode value out of range (%d). ?c@& lc` `d*`4@h4#l@"U@"4U@xO H@ҳ #h ?" @"U@6` \@5"<` *@  *!#  d*@ 4@h Ȑ?$  4`?"` @Ǵ ,@ !V!@x@ #@` @Ǥ  ,@ǟ @ @@R @P x `* @ d,@'? 0@@A x* @:  0@㿘@M getrlimitsetrlimit㿈#cX 2&@k @Š?$cX * @c" @耢 6V@]R#? @耢 uV@]G#u""c#X.u#8uc" "c@9 㿘   @ڔ@㿘@ @єseek error: %ld rdfsread error: %ld 㿘#`  u@clu# @Ы0+> ul @;   @  @ 6 W!p@wJW@\֐!@ѫ ! @@= W!@w;W@\ǐ!@ќ "wtfswrite error: %ld 㿘#`  u@ƶcluc@@h0/u#x +> ul @^;   <  @ 6 W!p@wW@\"@d # <@ޔ W"@vW@\"@U $isblock bad fs_frag %d 㿘 8 "  $p  p@ !`?*  *@>*  *@>@  `? * >@  `?"`Wc@ 8 clrblock bad fs_frag %d 㿘 8 >  >p p.@>*` *`  * @ *@.@ "`X`@ 8setblock bad fs_frag %d 㿘 8 >  >p p .@>*  *   *@@  .@ "`Xah@q 8COLUMNS㿐  `h@Y?2  X@͛"0  @u" P㿘@8Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`R#?R@R?"cR" "`H"L"R"#"!T!(`rY H*`@d\d\deTe  R"#X"-"a\ @l!R &"c> bX@I  R "cX""a\&@Q!R "c> bXR "c!D .R@#+R!D   X@*4c R "cX""a\ @%!R "c> bX8@HRX#X"a\R# !?!h "!R@@  >bX`@H!h!R#@`X  > bXx@H\0 `<   Xc@HW\!R@Z#?$#R"#ΰ? `<  2R#R#a@%   "$ `<  RR "c#  @α ?R2 "#>" RR "c"#R# R"#T!( 2RS!$#`|Z *`@hhDhDh4hDSq?T!(  !$S"!e"`  ` >#@a2"!"aT!( BR# ?SAST!( !$ < @ 2 `S"!0"`  ?"a1!: @ !`">$! a T "aT!( SSa " ?"` S""a" R "c %s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿈R#  T"!"`H"L!( pp""`!X !R# #R!@  ? $  $ * @Y'Zb @ x@Ր#Rc R#@~`X R ` `<  R(  R, 2R@!\$cR@#!X R#  RZ"P@Yp"!@@ R?"c H  L s" H"`LT!, Rc "c!X b!@ T ? $  $ * @X"!@T!,  ZbXd`@x0<Z"@ax #!`!` ` !`!8 @ Z@ub0Z"@ax T!,R#!`#\#`!8#d#hZbax?@Ya@#"!?cR# R#  %R#?@?R"#Unable to truncate archive file㿘R"#R#  R#  @̺   R  @g#   > b[@FJ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘R#  [@Ec?   [c@Ex? Failed read on archive volume %dEnd of archive volume %d reached㿘R# 3R# R@ˏ# " Ha"! "a" @~# "`HR  "#>R b\@E0R \`@EWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘R# R#@ R "#" HR"#"#R# I , C !R#  @˰  4>  bR  @Y# * %R %>"倢 `E R >"  > \@DaR"#F " ?  R"#  R "c "`HR#   \&b R \`@D0 T>R b\8@D0!, ` @   \b`\b@DCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐 P q?R# lT!(?  ]baP H  "`LR#  4F C" H`H  7"`H7 'R# a@@ 0R/"# R# R"R#  @͖  >   @[@ dR#@ʹ  RR "c" HR#  ]@D!a  ]a@D?Foward positioning operation on archive failed㿘  > 2B `(? R# 4R8# 24 R#  @w  @C  4 2 >`(>@ b >R#  @X   > b]@CR?"c?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐R# 6R# O  4  R`} ^@Cda tR R rR`(p #  @ܖ   > b^@CtPZRbRR#  ^@C;aKR  R#  @ɹ DR> b^@CR8R@u2 "! 1R`/ @5<   `" ^@C aR7@,< 'R# a@ R> b^@CR?"c? "c Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cR#  'R?#ㄒ@o? @  > b_@B? 7 'R# a@n   > b_@Bv?7 'R# a@Z  R> b_@Bb??c# @0? 'R> b_@BP??#ㄒ@? 4㄀   > b_@Bn;?7 'R# a@  R> b_@BZ'? `#"c@  ^@B!a? 7@ߒ'R# a@  > b_0@B4?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈 aH@˔쀢 > b`@AG @ǽ  > b`@A8( P ?R# Z"@ax D` H@@ax1!\X@b耢 "R!\X@b "RR# z x  R` x!\@@`  R` a\@@` @@T!(? 8``!  "`PR?"c `@@c8?!H@@%#`!`!P@@x`@@!x`@@|!`@@y!Ȑ@@, `@a O J"`P $bO  bO Y  s S"`b ybi!\ l`"(@@K!\``@@F"H %@@B`R`"p@@;c% !R#`"@@2x`@@/"@@>, `@Za O" PR?"c`!@@x"!@ ``@@"`@@b耢 `@@"`@;,`@?#` `# @a\$#@Pʐ U$a\$##X@?` could not pipecould not forkar_start_gzip: impossible-c-dccould not exec㿐@  a@!wc@$ a @!ocT!(   2  @!0 b@`@@0/!(    @!w @!t b (@!n @!k b 0 b@`@Ų@Ű! @ M  b@!(`8?#p@<@ \#Ta, D Ua,  O!X  @  F@  A@` )p  x@ 'T@+6 &"T2@/ 2@* T@,  &T2@" B@ T!, ( aH@ @*iCannot chdir to %sCan't chdir to %s?#p@ˤ@ u!T!, D n!,  h@7` c! @4 Z@`F   x?# 8?#0 @?#8-p @ 1T@*&,T4u@/y 2p!P !4 *@d %!P !4 @@M!4 " @B@$>@*  T@+Z&T@3.! ! *@# &! !  @ ! "@  B@!X  @)` @P` "a@ "  "@  > bbH@>q  3 1? @0@1 B@u @2!X 6!@ 2`? "` %` * @P !"!@@g T B@K@2h0!,? < @!X !@ `? "` %` * @O "!@ 2 ?# B@   !@! > bb`@=!0!, ( aH@Z d@6~@(Unable to open %s to read㿈?'T!,  @1g  @ !T!, , !, 0! @3N @^  '#p%  x@! ̀`@. ?'!P  @2&`@2 @1B   ?  @ϔ  '>d bp@=g0@)@Ӓ@1` !  @  X@@10X  @ܔb` @Ob` $@a "a@_` X @ b`? "b``$b`*@ @N $@@0tT!, @@zX @ b`? "b` $b` * @Nϒ $@ 耢 2 쀢 (@耢 ` = 9@ 4`T!, 4@e aH@> H!L @5]@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. ?#p@#T@a,   a,  ea@ bfH@;0S<   fap@;`0G@/* C@ >@3 9! @1 0@M;?#?#  8 @/%p+@ ?$@+Ɛ !P 2L`a4 5L` /`?@"  fa@;`0`@ @p.@ -!P  a4 @@ @a4 @@@@ǐ@.ڐ ʐ @'&Ő ?# @( ! `! #`@a X!  !  @@X@ ! @@@|X `@M6` %a@a "a!l @@א`X ]a@ Z`? d"``$` a*@ @ ! ? @o@p`X@.ԐX 5a@ 2`? 6";  @  @  $> bdp @:y@ 0@@@.0 @@ڒ@ْX a@ `? "` $` * @L. %a@ aH@Ŕ @2@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 'T!,  ?3g-T/h'  @В  @ ` Lc"( > @9`!T!, $€ $!,` ``8 ( `Β (   h@9`h` @ T!,` "`8@ 0gc?0 h`@@9w?0a "a Cannot identify format. Searching...Sorry, unable to determine archive format.㿘" T   T S"h.  *` *   & .  . @  "k?T@*` * ",@j_   /5T3hT @!4 H @ B" ( > @9 b`  S"h . @* @*`@`€  .  6. 2 ?(  @8b`?   @۔"""  h@8Вb?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘`" a$ T!, "a$!$?  i`!$ ia( "!$" i a`@8q?0!S!$"a" R!\  9 ?  :!8 a$"" Ȱ Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘 "`T!( !$?  i b!$i c"@8?0!\   ? a ""`  :!`  S? "!Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘!p  j``$ Sa" "$a"   Ȑ" : @ FS : @@ 4S @S  :@ D &W @d  1`/ "S @@"%)'! 8Ȓ $Ā@*'%" :  '@$S @ "S ` "" S "a`@b:`  :!8  T "a(  j`@75?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘S $ M T!(  j@7 cXD?{ ! 8? "`"` :!`@ B ;!`*   :!`!)S'S%j#  4$    @6ؒ0H       bl` la@ > bl@5[ >>? 8@ la@5  > Unable to obtain block size for file %sActual crc does not match expected crc %s( H  '" @k 2 >؀ 2  'N> bl@5'  ;> `Ș" ; @?7;    @  #\ @!  Ȓ " ? `Ȑ"`Ȓ :@ d  `  H`4 `   @ 4  ` !  ?!  2 `2    lc@4j  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(      '" H P2`*    *` 2  @ 2>؀ 2  ' bl@4<')7S @  @  #\@ @<` D`> bm @4 / H    mb@A  > bm@3  8@  mb @3   H`4 `   @㿘S (  0) "`"`> !`@ B ;!` "`( !%S#  4 Q S  bh   k:!8  :!8S `  @"a S &&%'S+/-   < a8@ B =a8`@$@% @#$@%< a8@ B =a8%Ƞ&@ %T!, `"@   =a8    @% && "ap?Unable to allocate memory for user id cache table㿘S t  S ?!S!=@  $ t  S `"  o@2a?Unable to allocate memory for group id cache table㿘S x  S ?!S @c  $ x  S `"  o@2qa?Unable to allocate memory for user name cache table㿘S |  S ?!S!=@7  $ |  S `"  o@2Ebh?Unable to allocate memory for group name cache table㿘S  S ?!S!=@   $   S `"  o@2c?%lu㿘S t R >1o@ !=S`t* @ !S` l $2  l`27 `"4 $1o l  @ɐ  l $ l @c (@{   & $&  o@`2 1o#2& $ @ @@fÔ . # & 㿘S x ' >1o@ɒ S`x* @ !S` p $2  p`27 `"4 $1o p  @  p $ p @  (@ߙ   & $&  o@`2 1o#2& $ @ @@fl . # & 㿘@k"R?N MS |  D@*x!=S`|* @ #S  @rG  #S .?& $`l  @ `l $`l  @ (  @y?`@f , #@n $`$ $&@  $?㿘@"R?N MS  D@*  S`* @ #S  @q  #S .?& $`p  @0 `p $`p  @V (  @Ȑ?`@eǔ , #@޽ $`$ $&@  $?㿘@$|TRAILER!!!㿘 q@qap  ? H   ` 㿘   > &  & < @@"+$@")@".@")@&% (@0@"  '&  #&  &  &  &  &  /  6   & H> @$: #?cp @F $ $? 4??ctq!p!p$ $ $ 4  , T!, 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘`l   r`@/?  J   N    r@/Ӓ`0?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H     H` `! ,  HH r`@/ ? H,     ra H &,*, N,   ra(@/y?070707㿘`K rbH@O   ?㿘 L w x  >` @ `& `  @ `& ` @ ` 6 ` @ `$& ` @ܔ `(& `$ @Ք `"6 `* @Δ `,& `0 @ǔ `8& @`0& & `A @' H> `; @ `&&   < ( 2 &, H     &,., < &?Y?  W㿘@%`File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@% Ұ? x  >  ?  ,&  ",   4  H A @   s`  A @X  !ǒ @O     @E     @;  v   @1  l $  @'  b (  @  X " $ @  N , * @   D 8 0 @   : ; @   2 L    s`А       2 , , 6  s`@-  ? sa @-  070701㿘`m t`@   ?070702㿘`m ta@   ?㿘 @!~"a㿘!  n ђ n  x  >` @ 9 `& ` @ 2 ` 6 ` @ + `$& ` @ $ `(& `. @  `8& @`0& & `6 @ } H> `& @  `"6 `> @  `F @  , @& `N @  `V @  ,, @& `f @  `& `^ @ ߔ `J&F C`n  " r 9 < ( 2 &, H    &,.,  x H   @ b  `> O  H   @ b  `; ?[  |㿘 @#b"aFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@#? 6%?  ?  ,&! !’ @ y    ! @ l    f @ d    "(  (4& "`x H    @ b  `>   6 @ Ř   uɒ` x  >, x  >  6 @ %     @      @    $  @    (  @    8 . @    " & @   v   > @ ޖ  k  F @ Ֆ  b ,  N @ ʖ  W  V @   N ^ @   F n    n  "   u'`Ȑ    '   2" , ,   , "  6  u`@+  ? ua @+  `("? (8 (0ǀ2  (8 (0ǀ2 ?Ѐ   Ё㿘ْ   x  > Ѐ ]`* ` & `* ` &  `*`` 6 $` * ` & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, \``* ` & `* ` &  `*`` 6 $`* `  & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, `@`0 8& H& ?& @  ɐ 9 < ( 2 &, H    &,.,  x H   @ b  `>   H   @ b  ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@! \? ?  ,&  P؀   f4d ` x`H    @ b  `>   +   ; + +   ; + * 2 :+ + *    0(@( *      . q wc( x  >N,+V,+,: +, + *` @*` *  @,   q x  >++++ q+ +` : + + *   @` 2 + + *   @`  2 + + *   @`$ 2 + + *   @`( 2 +  + *   @`" 2 +  + *   @u`, : + + *   @f8N +V + : + + *` @*` *  @ M`< ++ *   Bϒ   ʒ  `    w%cP    %   2  , ,  ,  6  wcx@(  ? wc@(  Unable to create %s㿘    @(. 6,` @  "?, ->+ $ (&@4 6at  @ y h@( ?Unable to close file descriptor on %s㿘@B @f  > by`@( !  `$(  @' !T ``  36 !T  ` @@ T!0 T!4  `80   @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @  > by@(& ?<  ,  @h  yc@', ?㿘    `  @O  Unable to copy %s, file would overwrite itself8 @R !   @2  @2   z`@'   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@ >%>! 2P @@`@  za@'o??<   @? %> >@vP %>* > bz@'{!? ؖ@'s?#@m at  ` @}` z  %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8    # { h , $ (? 3*      , @2``&$   *` 2`@, @ݓ2`z  ch, @D  z c@& ?` >" @$!t    @ 6 z@&Ė ?!    `$(  @w  `$(  @[    x!T ``  36 !T  ` @m   MTz#@g]ax D @V\  )@}ڒ > bz@&j*`@G2` c @Aa!T  6   !T  T!0 T!4     @T!0 T!4 "  `80   @  Unable to remove directory %sCould not unlink %s8@}{ !! 2&?<  @൐ 6 `>  b| 0@t >   b|P@%?8L /?  /@Z /1,@}< (@! ,#?!  @v@U  6,@}  2 , c@a$@ ,͠ Unable to obtain file stats %sAccess/modification time set failed on: %s8S!"!("`T!0 T!4  @| 2>T!0 TS"aT!4  S"a  b|(@%hS@ߔa > b|H@%[Unable to set file uid/gid of %s㿘@ʔ >   b|h@%??㿘@? >   b|h@%,?Could not set permissions on %s㿘@ऒo > b}(@%File seek on %sFailed write to file %s㿘\J'>  '&"& $& N    L "  2'<`  @0  }  @R } ⸔@$?2&Failed seek on file %s㿘??@  > b} Sa(@%  > b}@$㿘@ @c?&@!L   `80   File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &h  X 8+?@ :@ D @  `@  H   @"? }bc@\  > b}" 8?c   }c(@# ?  @S  > b}P@# ? & Unable to allocate memory for file name buffer㿘 "`!  `ؐ "`!0 `ؐ "`! `ؐ @"`S!p @, "`ܐ ~@#a@?@ !L  @ &?Invalid file name arguementUnable to allocate memory for filename㿘  N  ~ bh@Ԑ  ~b@#H?0@P?`$$N /". $$ $ $ S!p Sat" S"!p"at 㿘S!x` "`!|  "`!    S!|`S!l@ո WARNING! These file names were not selected:%s 㿘!L  @S!p )~'p%  4   2 `` @"# `(@ 2 Can't chdir to %s㿘1S!l 'S@&!l!1S%#>)+p !xp ܒ,@OŔ . @W 2-*, ܀ "p &!x+?&!x!x  !x@^ !x b  @T p!x b @" ?$ ܐ `@  S "al File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐`䀢 #S~"`䀢 #S#     8S@ӱ!l  $a|f Sհ?a| 4? E* <Ttt!L Sa| <@`@ &Sa|  Sa| b@@!Sa| `a| `@"Sa| u  > x>&,., a| <>< < <  < (< (0< 08< 8@< @H< HP< PX< X < @@"Q (@"K @E E!S@ @!S@"% 0 @ 5!S@0 0!S&!L )a| 0 @Z  !S& H>&a| , @A,6  >a| b@!6S*, &,&!S!| `@,&*  !|`& %s %b %e %Y%b %e %H:%M%s%2u %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8!X b@# 0p `@! ` ;!@@""!@H8`  @@/H "/`  `O `  #\#`b @ ?  c `@ `c@`0c@֖  ?  c   2c(@, 0? & & * @2ɒ@}%s%s %s @! 2 8;!@A 4""! 8@G @@.ϔ "/ @F!0@ \  J@ *  `0  **  J@*  ` **"    J 0  *J0 0 Є *`(8*`(8 *`(8  0Є *`(Ѕ8  * @  #  8W0(2    0 0(2      0( :(`     J 0*JFF Є  3`+ +`*8І8 + +`*8 &3`+ +`*88 @@B* 0Є3`+ +`*8І8@B*   㿘 / 9  `8W0 (.W.* 2`@2  `  00.* 2`@2  ` `  0.:. ?`" %s: unknown option %c %s: %c argument missing 㿘>"" 耢 `N?`"`J -a ` *` "a(J 쀢 @K8`"J@ "-?. :  @S  :2J . p"`b耢 :2. a!( . p"`c@@:  ?>a(* @ "А "(. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@ / "ax @"ax @_ax @0 @_ax @0 "ax@Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  9-> !5T@xp??`8M#*`@44$@444T444h444|44444444DT4d44x444$04``@ Ѐ`'!$ a@@."!`"!`"a\`"!` "!`@"!l`"!|ab@Ѐ 60 7+)%T* :  "* X`t|&0%a%!T&0$4 $4 %a %!T a@L@ L  HdFh@Ѐ ?@"!L:@"!P5@"!X 0@@-@'!TSbh  H@P!Ȁ $!,@ a@f!p@/b` +p)S"h, *b`"@G  (, "p@/֒b`0Q"!D""a @L:(( (    b @1@d "@!(  `" b8@ "@S̢@"!4Ǣ@@"`@^Ѐ S?"`$@IXS "`$ @bh0@jЀ @"!0@"!  @"! @@@Ѐ @@ Ѐ @"!@"!@"!}@B@ @T"!(sې"/ @( BT "a(qȐ % @  @@ BT  ` @ @ @ BT "a( ! @ @ T "a(" @@@Ґ@@ T!( TTS#"a,T!(`K"@*`@TTa!(;!aa(* @@` !(@!( $!(0)a!( @Tb@?. @ "!a!(S!aa(* @ !(@q!( $!(S" $b:cef:hmopruts:vwxzBC:HLPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-CTAPE㿘 T "!8 +%>'T#5 /-X?Ґ?Ѐ J* L\l|L  ,8DPd@Ѐ` %a$ a@@@a$* %a$ $(S" $J@ -  J` Ш $a\$a\T"!4@+# "!"!TT"!0Ts"!4 p$(@Ѐ 6l@ he$(aX `"aX]"![$(%D"V% R"ahO"!0M& TJ"!8G"!%D#B% #>$a\#:$a\#6$a\#2$a\#.$a\#*$a\a!(&* @T!(?  T@F T!( TTS#"a,T!(   '@  #!@@[` 2 @`@  $!h ``@!h  @@  0."!h!h " @w  6@@|@ S!@@[˒ 2 @`@  `` \ 6@@a@ 2@S" $ !\ "J @ΐ `"!\J@ #"a\/%s8!'@ܒ@L`?,@q >"  @Շ!  @g?<    @ ?` /,`ΐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6rUnable to open file '%s' for readUnknown -H format: %scpio: Known -H formats are:H "!"!"!TT"!4"!\"!T?"a("!t )T'T751%>/+p9S"h@2耢??ʀ D֑* `4 ##p#p#p#p#p#p#p#p#p#p"" "#p"("#p""#p#p##p#p"#p#p#p#p#p#p#p#p#p##p#p#p#p#p#p!H!T!d#p!p#p#p!|#p!!#p!!#p!!!!#p#p#p!"!LS"%!,"!t"!$("!lT"!4 $(S#@%!, $("!$("!"!X&D"&  |$(y&!$@Eu&!$@FZc  c@r@@   *? @] @^WWJ@ -J` K%\I%\'Sbh  H@'!Ȁ <%!, c@@@#X@+ƒb` , *b`"@{&  (, "@+b`@< "! &D#& %!,a!(* @T!(`G#*`@##$$$8@ ;`@ 6@@@ 2@0-@ 2  @b@@c"a `@@ S@S" $!p!@{  *?@) x !@%s: Invalid combination of options: -%c㿘 p"``@zx'p%S"?@ǐ 6`@zL0p`? "` "` * @* 㿘@Y@S`   `These format options are not supported %s = %s 㿘S"`  @pb!p1"`"0@zW0@ Invalid option nameUnable to allocate space for option listInvalid options format㿘  N   b@( b@3?09 b b@*@͐.?`"+ )S'SL@ $@M ,2,@L =@ , "@"`"` "` d%"`" `$d 㿐@)<  # `  [`YVJ k6` m b 6`- w6`'.  .` .  .` 6` .  .`.  .` (@# 'J x  *  @ @   usage: pax [-cdnv] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘"!p@)Q"`"@@)M"`%`@)I"`#b@)E"`"@)A"`"@)="`"@)9"`"@)5"`#(@)1"`b@)."`#X@)*"`#h@)&"`#@)""`#@)"`#@)"``@)"`#`@)"` 8@)"` H@) "` p@)"` @)"``@)"` @("`@ usage: tar -{txru}[cevfbmopswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] file1 file2... 㿘"h!p@(֒"`"@(Ғ"`@~ usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘#!p@(t"`#X@(p"`#@(l"`#@(h"` @(d"`@ Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N   `@J|N \`@ 2, a@?0f` @w @h$ a@@q@Q?, @JON2 *@x`@ *`$@ $` +%*`:  P"` g G" `0  p"`0` $` $`@P`@ݐ, p@2?J  $`T | T`" T" |"` Empty pattern stringUnable to allocate memory for pattern string㿘  N   c@ 2$ c@?0$ @$ $ $ $ T t T`x" T" t"`x WARNING! These patterns were not matched:%s 㿘T t  )'p%  2 `` @  `@v  2 Pattern select out of memoryPattern list inconsistant㿘T t    !|   $ \ 2Y ! 6T  2 *  ,T  2*@%'   $ @qaX ` /*@5$  ` /*@$ @m$ ?J / * $ $  & t  t         "@@ &@7ax?㿘 &T t  T!| ? !:@? t   "   J  /2 @   @&     2  !`? &!   P  & ?㿘&N ?  ? [  *"N;*`"/N@7*`N@  ! 5?N@ /1&. N@ ܲ`(? N *`"   N@˔ `N@ ?``@2?: N@ `?J!`?   * 8]#2J" -2* J ] * 8 4 @$ * 8 "  *  ] ` Removing leading / from absolute path names in the archive㿘T!8 " N  /TN    . .  @F@5?&Ta8  T "a8 @)bT!8 *TN, /&T ? TN, ,  . ., , @@ ,?&,Ta8  T "a8 @bT |  @< &  ?  , ,@- ! @g   ? , @ ", ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐 @Cax)'1#!@:!(@8X@6!@E, &@Sba @)!0@^,@!!0O  .@!   O  @! ?"@@.,$,> 㿘 @ ? ? ,  ,@ : File name %s/%s, too long㿘@N /@ ?#l @c?@ &@ @+@ ?@ * . @+@ ?.  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s  T |?#P@<PAP X@ 1\@@     @,`@  !X@f 6 V `@X d\"  @L@   ː  Đ ? L@ ,  `,L@  $ `@OP% OP OP  p"`a@s0 OP"`a(@s(POP  P,&@., 㿘I  L D  &\ \ А  *`: ?Ѐ- . @\2 ,@L \ &2,@  ,@` @ @ "@ @'4 r@?@* $@Can't get current working directory.㿘@v @Ӓ   "a> b@0@s (@[ "T!(`!*`@EEEEEv ) !pCpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "a@ "X a b @h@ 2!L @@ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @7 2? @ے @+ 2? @ϒ @ 2? @Ò @ 2? @ʷ@B""a"aHaH@ "@aH@ "@aH@ "@aH@ "@aH@ "@aH @ "@aH@@ "@!H''"<'ذȐ @ 6 Ȁ 2 Ȑ @ ZȐ @ 6 Ȁ 2 Ȑ @} HȐ @v 6 Ȁ 2 Ȑ @k 6Ȑ @d 6 Ȁ 2 Ȑ @Y $Ȑ @R   Ȁ    @G  'ذؠȐ @=  @7   > b@?㿘T! T@ 2 T! T@! 2  T! " @F   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "V?N $!T! 2 N!=@q  $! :bN # \N  #" @^ 2  c0@.?  @|Ȕ @@|!=T!, @ " 2@h 2" cP@۰?0T!,  ""  㿘 $@{!=Ta* @`  $@2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "V?N $!T! 2 N!=@pk  $! :aHN # \N  #" @o 2  a@k.?  @|2 @@{|!=T!, @ " 2@Ґ 2" a@E?0T!,  ""  㿘 (@{R!=Ta* @`  (@2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N  c@ /"N,@`N $ А ,2 J2J* .  2c c@  J 2 @ ` c L@ 2$  *$  @ &*:  M"  c C"    m     $   $ `L@@ eS `L@  @@. $ $N @ 6  `8 $ "($ L #@  6   `X@ 8@ې$   $  @  `x@ &@ɐ?$ Ta 2TT"a"!  a" "a `@ ?T J8@  " * )  @ 6 @ &/  /@  *@  " @ &  @  " @ &    @   2 `?㿘@3ڐ@A ."$@, @ 2j?L?Г* @*`L @`=$@]?@?`8W?!ܓ*`@VUVUVtUV8UVN?Г* @*`N @ D$` d$` N?Г* @*`N @` $``?$` N?Г* @*`N @`$`  N?Г* @*`N @`$` N?Г* @*`N @`;$`@6&@8@?Cannot allocate memory for hard link table㿘T!̀  !T)@n  $!  @ "c ?Hard link table out of memory㿘T!̀ r  e " ` @y)ǤT!̑,@ 8     2   @    2  ", p,&, .   &   & ? $  $@@m@k' @G  @l  $ $  $  "$ T!̓, $ "   @I @ c?㿘T!̀`4 " /  *? ' @x)Ǒ* @     2   @    2   "@ @ 㿘T!̀  'T̑,@ ""@`@@`2́Cannot allocate memory for file time table/tmp/paxXXXXXXUnable to create temporary file: %s㿘T!Ѐ ) !T1!G@m  $!А @ c?@Ð#@@ZNT "a@Y@  > bP@ +@?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐T!Ѐ 2  1@GT!Б-`@ ;%T'>)2%    @>      @ Ӕ 0c?@qJ @    2   8 @ G$ E @  6T!  @  < T! @-> 8$ $T!Г-` $ " #  b@ ` > b@  > b@ |H ? @ L` ?@?Cannot allocate memory for interactive rename table㿘T!Ԁ  !T"@l  $!  @ $c?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘T!Ԁ  @ cH @"T!ԑ, @`@J@ ````@J` ", @}`@ &` c@R  @w &@@r  &`T!ԓ,  &`" @\@@Z c@ ?㿘!T!Ԁ @@Д"!ԑ* @ @J 2   %,&@., Cannot allocate memory for device mapping table㿘T!؀  !T!=@k]  $!  @ oa?㿘 @ @?Device map table out of memory㿘T!؀ +@vn!=T!ؑ,`@  `   2 ` @  T&& !ؓ,` & "  @ +b Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘  T!؀   @ 2 "`*  ` 02% & V&Q s A#5T!@F 8 "" "$ 5T[ @@%R   #T   &#Ta耢  @  "a" "$  &  & c@  @c Cannot allocate space for directory access time table㿘T!܀  !T!=@jK  $!  @]b(?㿘T!܀  %Tܑ,`@ " `  ߖ   2`a<܁Directory access time reset table ran out of memory㿘T!܀ 4@uF!=,`  2     2  @  @  $$ $ $ $ T!ܓ,` $ " @ @c(㿘T!܀ -@u !=T!ܑ*@ #T*!܀ @ 2      2  ? "@ & &@o@m ?Unable to create temporary file for directory times: %s㿘T!? @Z#@@VT  "a a@@C?@V@= Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxT! .  @  ? !aД`'7 '''3Ta@؀  a@  ` "`b@EUnable to set mode and times for created directoriespT! W  @E!T!??@  =!@ 7!  @ /!@Ѐ (!  @  !T 쀢 T!0 T!4 ზ ` @ !!T@!?$! @ @ْc㿐`@  @6` `  *   @`' *  @@sǐ 㿘 $ $ J$J` ?  "&  @   (  ((( (  0(2      0( :(` 㿘     .  ... .  `0.* 2`@2  `  0.:. ?`"  !   ustar㿘aL  a` @Ӕ    ? 剔 Β"` write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘!#%"") @F  @F`   `@  `  `T!(?   a  @?0 $㿘" °?` & `" 6 `&  c&* `d  ` /6 `l  `$& `t  `(& `|  H > `  `8& @`0& &   x  > >N` 1"= 2 5)8.,   &, `䯔 c&,*, `  (  & " 6, `䜔 c&,*, `    A6   &`   6  " 6., 1&,., &,L /  &`   6  " 6  &`    6 `x H   "@ b  a>  > L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ?` 8"*`@vvvwXw8ww w8w8wX %ݰ  Ԓa@ Βap Ȓa ’a, d a,   ``d a  㚔 c/S x  >   / @/ d /* l   2 ?  1,  , q c,!  | n  q%,   @ d H |    _b x H  "@ b  a>   d @ C $ l 6 9 ( t , / 8  "  %!    o! &?  Ͳ ? ` `     b8 @w 㿘 ?;  ?㿘Э ?  ?㿘aL  !` @/    ?  *"` 㿘 ߒ" 2?  & " 6 &&NaY   aY⭔ .a /, `⢔ c@&* `d ⬔ ` /6 `| ⤔ H > ` ⛔ `8& @`0& & .aH (a) 6.a(`t ⅔ &.a( $a | 6., `l w &., &, x  > > ,&N``7!$*`@~~~(~  &`  |  &`   6  " 6 J  /2k &e* N` 4   &`     &`   6 aI  aQ  `,, A& N` 2   &`  ( 6   &`    6  " 6, `᱔ c&,*,   &`x H   "@ b  a>  > `    6  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠   6`(  ?   , d `P',  @'2 `p x     >,Y  /, aY @   c,`c ?` b"*`@@`` 5,`` @ d:aI   4 3,`` @ d , aI ږ   aQ і     6,`` @i daI   1 2,``, ൔ c,aaI @V aQ @R  `|   2a   0 7,`` @< daI @8 aQ @4 `x H   "@ b  a>  `|    k`a` n a`i  `d e  S $`l [  I (`t Q  ? 8` G  5a γ 9 a) 1 !` ,  ʄ! &?   ?        ` @ `da  ?  /"J J J" `4 ` /dev/ttywrFatal error, cannot open %s㿘"@Wܒ @DMbT  "bh@DEbT  "blT@E6"h@D!   b@2?㿘'H'L'P'T'X1T"h H@b@{"h㿘` T"l@-  2. ?@4 2* %s: 㿘'L'P'T'X L "ap!X  !!@  p@pkb`$!@!p"``@ax"`@b@ @p\"` <%s>㿘'P'T'X P "ap!X  1!@  p@pBb`&!@1p"``@ax"`@b`  @+h"`@a` p@p(b`㿘@fTp"㿘`T"p@ @@3 @2@T"p&allocate bad sizecannot allocateallocated object too small㿘 2?@kb6  @. %T"pa@  :(&@ @@ 2@@2@Ґa2@@k(2@""@""" c" " &@ @kqb84"@.  @"@"@ 2#" 㿘`@kXb2  ? "  ?@* ` *$? $?@freeing with invalid areafreeing free object㿘 @@@2@k`h 8:  * 2?@k`+`@2&` &?& 2?"* ?@2#  #?#LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀J! #!a@qd!? L"  P ?" " !* J! "k!@<!ж@8!ش 2 @0!@aT"@2Z$R!耢 2 @?b L$@KT"@C`<" 8! J 20"(! @ %'"H "@@  @ bq` @@ @ @@@@`"`@Jo $'"`'S$' '@"x@%' @s@@s@j䀢  ``"@Jh; >@)L""@J^1 @< ! J@ @?J /  @s젒쀤  T@sĐ@)`@s"쀦`` "@Jƒ can't get current directory - %s㿘J!%#@pYa? L"  P ?"@ " !*  @I"`/ ! J@  @s !  @-'  &  @r8  >@("@I֐" "@Ji Rnprsu,ne-p: %s-u: %s: %s㿀 J e.   ` L@ - L` ` @ `n2L@ e2L@ E2 L@ `L@  @L@   ؤ  !\a@oʔ?n? 6*                   8                  L        T \    (  @K䦒 0@I5  !L@   @J|䦒 8@I !! ?*  @=Eb  ? $?a?"a!*  '"`' ' 'j?#@@i Q \2P+@L@ f/` f r a"D  b 0"*  \ "66 \"7+@2 \ c"2 , \ r t n"' # \ v"!  \     @А , *: @И  `+@ \+@`+@`L@ `   +@` 2 +@`+@"` "`@GN 6 #@!h   @  )>@@ 6@"@" 2 @t @$ " @ pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘   J w`? ""+a@n? p"  v ? V" "  !*   2 ? 2Ԫ Ӏ`հ    !"@ @z  !!p@@l " @8   `"@H ?`!*`@Ly@G"u" T"Ȓ"@G "@Gߒ@n~ ZW@G֐" @GА" @Gʐ# 2 @GÐ# `@G#@G#074@"T#X"&#@ @G#h   "T"Ȓ"@G#p"  @G# #@GTT@G{"2/",㿘L#R#UZ#fi#lrtuxponly -t, -u and -x options may be used with -ffunction %s %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s[%d] %s exportreadonly%s[%d]=㿐      J r r s e"    t"     ! `" !)a@l?l? 9] * TDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD$D,4DD@ @@@! b! @  d`@`!  +,, - '@i " '@iv " !! `*  `J - + `ထ*J` `J@" ?#瀊@@E X !*  !"*P @ , , ,!*  A  `"!,` "` ,` @4@6k  *#,`! P @  `@' 7`,` Ӏ``1" 1-)@``-@"`- "! P @ @EȒ  ,  `@E# "  " -)@ "0"`@" `\`Y@E x"@E  @E $@E  @E~ @ @Ev  @ @En @@@Eg @@E` @@EY @@ER  ؒ @EJ = "@ED 7  `"  @E7 ! @E/ `-"@E* `-T "T@@E! ""@ET@kT@E"  2f ],U drtUx-taunaliasalias: -r flag can only be used with -t and without arguments %s=%s alias not found 㿘!p    /-"%#@ju?M? 98* xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx b  !* "`?  @Dj! !@i @! @1@ ``/-T 2 @(@DI @j @DE@ ` "x/-@+ =$@`ℐ@c@}`!`@~d  "(@D @j T@D"F "0@D ? @~u  `$ " `2$ `  ?$  al @5  @"@cS$   ?$ `$ℐ`  2adt㿐!p  -+)!@i_b? d"" t ? a" ""> !*  )@}h@}Ւ2    ?$ A! ?$  2@~1#@~3"  ?$ &a ?$no arguments㿐   @B (0 @92  `?  lpnz㿘   )'!@hࠀ? n"  p ? l"  z"?  !*  2 @Jn "   @Jf 2   2bgjob control not enabled%%㿘@6a`?J! @BR!) aT@h ? !*   @H   0!@Hْ  J!@? %*d %*s %s%*d %*d %s㿐`+ T"В@`  #\`#`+ T"#\#`@q; bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈 ``, L@ -)% `"*@  `*: q`  #@~2`#h  @5ْcx $ "   %#!@gӔc? l"  s ? @~a! ְ !  ,@   " @pcT@Ah" ,@ $T"#!@ @d  ' *` `b#@Aۤ,@  0J! T" T"'!T, @A’"T@A"z   ' '@r   ' T"Б,   @{D쀢@4', @{; @4   , ! ܖ@hs A #h!@@ 0; 3 1 % @F ")& @d% #@@ʒ ?6  @  !@y˒ 6 !>@" (@@ ,@`2L@㿘!   J!   !@f!$!missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTINDOPTARG%s is readonly㿐aT@f ? !*  O!` H!(L@  @C J |!@"  , 2 @@na`  ?"  ,  "  , &  `*` 2`!  !  *@zF? @!x@@ 0Q!$ @f: ?   +// /  ?/// ? ! $!@!@a$!! @ !@ 0@!@a@$!@? J!    @} @6 lm㿘   )'!@eࠀ? l"  m ?"* " !*     @@' ="*@`@ 2   2DD X08D p `XPH@bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasH f`?%s: bad numbernothing to shift㿐" aT@e< ?"* !*  @5e  6 # @>     *"  $  " $ @>ѐ#0 Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 %#@d` ? ? S" !*  2;@? * 2 @; ,8  ( =  0 . .  *  #@< "` @ . ``  ,. .? 8@?  @@> "*@    А?Г*:`  А ,N "ő, H@ * 2 @8  53# #`*`X@&I:` `N g  g o a" `I N u"`@N``N `" IN @&% ` w   I<<*``h@&:` "A ?* :  5 * HXXXXXXXXXXXXXX8XXXXXXX@XX XX0X(T    I"N N  @mN-:  -", = +"  N,`N",N ,   `@%N "NN ^N 8 x@= ,@*2  %s: not found%s: %s㿘aT@c ?A!*  : al @/ !P@=^, !* @ "  "@   `*`   2`    @Z  >@!"!`@=3 㿐 aT@ci ?! !*    @B  @Bߒ   6 " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp      a@c&P?2 r"  s ?) p   u@>Ԩ#Xݲ !L ֨  @>Ԩ#`@< !*  ?#p&@=S @g@$ ? `,@lz #x@= `  '"`'F ' 'ئ  '"`'8 ' ' ?#"쀤` x"w  ?$ `$ @@jB`" `(`$  `@y}` $ ؐ?$@\f,?$@\[``  J!  @l `  @R "@R ` ` ,`\`  `  `* ` 쀤2 ``   2 ,   2,쀤 ? *  " ,? " , ?*` *`,@ $ @g#@;ɰ 02J!    @ @  N@g` ,"` "`@: 䀤 @=D 8`?㿘!!T@aϔ ?" @P``!*` " @Y  trap -- %s bad signal %s㿘aT@a ?C !*  T"Т %1 " @;h@b !x@;  ( @x(    !@;@? `"L@ -2L` "   @x "@y4 2 㿘 aT@a\ ?; !*  #@^ab 2  $bc @:J r"`@?* 2  ( ``2@ !!Ȁ  @B  $!Ȥ @Y@YK%s: bad value%s: cannot %s%s: can only %s %d level(s)㿐 aT@a ?!*   @^D N  '`#@:B "``@ * 2  2 ``` 2` ```@`" 2 ` `@:e  ?4` ` @:Y# J b  @X-set㿐"   Ð!2 @\H*   *`?`@ZM&  &: ?$` * $`&   J!  !؁fv㿘  #!a@`W"؀? f"  v ?"7 " !* `"))@/ " $#@9  @" [@ @ @* 2  `ހShell: %8s user %8s system Kids: %8s user 㿈@@W@:T @Q!@:N @K@:H 0@E@:C  %8s real %8s user %8s system x#%$$b@l @$T@e@$"!" @h`" b@ " @h`" @  " @h`ؐ" T@hb㿘1!.? s.? . ?.?@Y  0.@i   ` 㿘" ! " . R@  @rr $  " . R@ " @#Ԑ  """   Hh@8٬0, ,,DD͐׸Ƙװǐר٬נטא׈*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]x' T' '!8'!l'   `,` 2`@,a  ,`@,a @8A!` ^  'ܑ,``T'ࢄ O ؟€  `%`  €  @ ؀ 2-  ܐ?'܀`    @  `?`?؟€  "   '@ذ㿘` P!N "" N@ *`: N`2`@+ 2 ` 2``?怢 (``N@ 2N` internal error: unknown opȀ  `# *`@|݌ݜ0H`޸<hތ`ߔTPN@ N`?N !`? 2@XI '4'4!4J@ '4`?   @qf`?@e``?@AZ`? @X S< D  @M H< 9 @B =< . @7 2< # @, '<  @AŒ <  ( @ < 0 @   (@  @  $@  @  "@  @ Ȁ 4  ̀ ڰ  @ZD4  &'4 4@f'44 @’ @w  @ @@@ `? @Z! @*`? @Z `?@*@ @*2 @* 4  00@,ؔ  ,@,Ҕ   o&`-"(*`@@Xp0,\`?0,V@ 0,@6Q  0N0,0,@$G  0D0!, @@Ԓ ;@@ϒ8 6X@42  0/ @@’ )@@8 $X@&   0 @@ @@8 8@<  `?   㿘@@㿘@unexpected operator/operand㿘@  2  €  2     `?㿘@2  2 €   2   㿘@"  2 €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2j  €   2\  €  2U  M €  2  ?:-  2   *€  2  ?(  2     @?@ PH@80)(!-a-o㿘  @ ``?  `2   `.`@( `?   $ 1   ` " 㿘ژ%s: %s%s㿘.` @  @  `&@4i!`0!h@4d XtHf0c dslmnpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimited%-20s unlimited %ld bad limit: %s㿀    Ja؀ aؐ H*aؒ S*@` a*@!!Ѐ  ` *@ `*@ f-%@Y؀? S"  a ?" H" " !!Ѐ " L" 2L   cp@3̔ !* @ "`  @3{# @'c !#? `@)  @b: `7!!Ѐ r+#  c@l{耍  2c@32 2@3ؐ#: @L #@3ʒ 2C  #@lM耤 2?耍 2? @耢 >@"@3#%  2 #2 2@3# : @LN #@3 㿘?"`"`"` "`" "`U"P`D@qF ! Tbc "c @"a@?*a  COLUMNSLINES㿐a쀢 4"a"ax-U"`h@k” %`T` "Ē " X   @|a "@z   `   @|R @z㿘!쀢 @v !J! J` @b J! @-?@\ 㿐!>1 @Z| " `!,  @G @o @C  `?㿘@^ " 㿘" ` 2@`0 b `?"``"`*㿘 "    ?*` : @`v N$  `$ *@ N P!耢Z!耦 O"!!!' ' ' ' ' '"P"P'`'`'` '`'`'`'`'` '`$'`('#!$ $ $ $ $  'Ȕ w' !/// /U"@v@ @3   @ U"bP@v/    K@K` 2 ` ++ 8(8 2 J     2J2J4   2 `? J `2"@ 㿘@\ / 2  ! X, @*`@>@  @@R 0  , "F J#     " J# * `J `? 񀠠"(   J "  &J  ?  # #J *  *  #*" 㿈n @h  @@;  .@@@2 .P`$  @@ J? /" `@   b* 䄒`''.    '% $< , ɔ', ''`'.@@"@ $< b, 䭔', ''`'"@Q O @%"ʒ`fileglob: substitute error(r @5!"" @E7`"" $"@> ! $"@0a[ """  `'' '"@$  $< b, O', ''`'"@"@ =   .  2  @$J @: J @: "N` "&&㿘 @`@$&  `"@FPATH㿈 @!@0 "$`" ㎒`'' '@>Ԑ@9p@4"  " @*  , 2@Kl@uؐ#@w T"@="@>   &"ܒ` N  . b* =` @',`, ,`&@  $  ,`@ix ,`,`*  ,`* `@"  @ !ㄢ @ ,`,`@*` `@$"㎒`-@Tش ? %?,`@@#`` ,`.@&@ @n``@,`.,`@&@ . @' $< b, ', ''`'"@"@  &;|&()㿘&'{  `& 'q  J?q`  J?  q J?  " Lq`    L   q   L  "  * q L   `g  0y7#-1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[%A"BCD㿐"""b"""""b ". ""8""D""""1"А "b< *bH#T"$b$!"B"b(""@ ""b b$"@",""  @A "@`" " """@:  *@t"@?"b@%¢ 3 z@ I  "L*    * @*`@`  bH 6"""0""4* $ *@ *`@@  `  00Ɠ* @*`@` ".bH0"b"@gq g @HՐ 㿐 2/@ R 0 /1@B"0??&"0 㿘" @ = 0>  "P**` @@ "J ""Ⰱ 㿘#b@ b !" " @ @eZ" @eV" @$" b@$b @  ?㿘" " @dOِ #?@ ""8#1b "@`?"@" "b  1?@tL" 8? "b 㿘" b@А 0b0 4"b0!" "0@)"@"0@  㿘"b @ 0 b0 4"b0"0@  㿘 iD"   ("DbD""bD `@""@""" ??  N@@3`??@!" ""   @d""@." "( b$"@ @4?@a ??? @W ?? "b@ ""8" @ !@N@" @㿘@  㿘@ 㿘@R b @ 㿘@I { 㿘" " @ 07"0??0#"0"q $ "0J@  `_2J"0"J@  2`_`$"0  "0??#"0@E 㿘" " @Ր 05"0??0#"0"q $ "0J@  `_2J"0"J@  2`_`$"0  "0??#"0㿘" ",@ @R"" 0"  !" ?$" @J?"  ?0"  "  $" @UJ"  㿘@??@i ??㿘   *` @ : N       㿘@ "  "%#  *` @: N b   㿘  @W"0  2@ ^  ? @@㿘" b@ 0 b0 4"b0" b0^" 㿘"b @ 0 b0 4"b0" b0G 㿘" "@*!"0?? $"0'%` @   "0@"0@ 0??$"0 㿘@" 0??"0 @b 2J@ 0   0??"0 㿘@ @ S b"b * 㿘@5" 㿘@/"Ё 㿘"0* b<@%"@ 㿘"0* b<@  㿘"4  ""0*`В@" * "@@ 㿘" "Ѐ@4 0 ""  *"b8 <@? @ ??""  1?L" 8? "b㿘" b@x 0;" bJ! !" b" !" J?" J?" 9J?" 6J?" ? ?*?" *?" J?" )J" &J?" ? *?" *" J"   ? ⬁   ⬁   ⬁ 㿘" b" "" "4 ""00 4"0"0@ <"r a  㿘" !@E,"""T*`@ "!U"!"bT* "  @E $" nothing to yank㿘"  "bb""b?"bbT*  b ""D 0@#? yank something first㿘 "H 0  @ (?0(""T*`@^@" "  "Tb ?"b"bb*  "b""T*`z@ """b "" ""8( 㿘@o  㿘G"""#" #b "8*@H?  㿘"@Dk`   ^^2 N >  ?`  **@`?*@` N *@   2( ^(  @ ?*@(!%s%s = %s '%s' 㿘  T"@$"  T"@$"ʐ@$""L.    * @*` @ʐ" `"P.`. @ʐ"@ @$xcannot bind, not a tty%s: no such function㿘"L  @#ɐ# °  !ʒ *` *  `"    2 @$J"  :   3 , bL     2bL   u ) "L @ ,   ,    ` `2N@[V 2 *  ´  *` *   " @ "   : `; *` * ’`   ʐ#@#@' ې@CGb"L,   "P.,   xb"L,  *"P.,  "  㿘#֩b?"b@!!͒b$"L  L* ``L   + bL* ``$bL    Ú"V+   J  L*`@   E*@ !&֝b$"P "P +  *```"   bL *bL  *bL  (bL (bL  $*bL( D 㿘"D @ 0"Db " bD"ܒ ""D 㿘D`" "Dې 0@t  㿘+b)"#b'%@8 b" !<!$ $b%b@\$%"F(@6%b%"$b$$ @\?8 @"  㿘 @a  㿘 @[  㿘 @U  㿘 @O  㿘 @I  㿘 @C  㿘 @=  㿀"b" #\#`  " # @ 0 "]@"@K  ?%T. @ ꀦ6 ڐ   㿀  `9  +"b" #\#` " # l$!  b@ @[Ք" 2  b@AԔ耢  ` ` " "b" #\#` " # 1B`  `0<0$@[" " >$@S 0#젒"@"@ *F J? /T;"0@B 㿘b  "b ",2  :  "@""@*"""8"$T 㿘Tb ?"b` `"J` J@" 4 㿘  ""("(b$ɐ   b(  b(?b( "b("  "(`"$?@㿘"  #b  *` : N 㿘  #q`   , * ? `   ""0""4p""0""4 㿐!&"#b"" '" " H" $b* ""b" [    d  㿘"<?"@ "Ѐ@R 0"4 :@@Z?@&N   " '?8N(N*  : "N? N   "`'N   " '  0b *`:    " ' N "0/""0* : " N    "`' *`:    " '20 N 0`"0* : "N N    "`'N.. 㿘@ U㿘@  L㿘@ C㿘" " 0g0??a 0qlk` $  J@  `_2J L J`@  b, *``@  *`@ `**0J`@   U`_`$0 U J`@   *``@  b,*`@ `*2J0?? 0  㿘"8 "" %#, N b ,"" ""8"substitute㿘!"" @3`$@$`$"@-B ! @>b"""M`"@P㿈 G" Ҭ`'' ' $< b, ', '' '"@ 2  $< b, ؔ', ''`'"@"@ Ɣ 㿈" c`'' '@U":  T""ޒ`㿈" D`'' '@6" :   T"Ē"ҷ`expand(NULL)%S%s: bad substitution%s: is read only%s: %sparameter null or not set(    @zaЀ @i  J! 2J! 2J! 2@ '"`'ܐ ' '  '(@  ''Ԩ?$@@>0А#p-@CI4IXI`JIN Ӱ А#,@CCCDDCG4EGHHI N   ˶    $,@` (,@?$@@=,@ N `1 )@22@Œ       $,@` (,@`,@?$@@=,@ N ` ),@`,@}`"' '/j @ @  @dݐL f?$@@= ,@ L `T@r  ؒ@@a  ,  @Д@_,@!2A   2  b `" " %  5$@5 5 % 5       %" = #"   ?"  ""(  @`  ,@U U   %"U  = #" U B  ?"-U < @@dB @U' @$"U А"@`@@Wb Ђ`@ג@d @d$ '؀    @ @’Д" А"@l  'N}  'y | 'u ) 쀤@ ؐ`'J@f_  ؐ`'J@[W䀢 2 ܒ ' H'T" W䀢 X ?W䀢 = : `" `  ?"` `"` @J-ܦ ` "`@JBܦ  @GW䀢 @!"a؀ 2A,` * b   * b n2,@ i,@` $@ `@$@  @@ ? `@7 @`` `$< b, &`, &@&`@`&@"@` `$< b, є&`, &@&`@Œ@&@" (@ ' 'b`'[ ' '΀  * b  } ,߀`]Ӑ!p*`@NOOOOOOOOOOO NOOOOOOOOOOOOO|OOOPOOOOOOOOOOOOOOOOOOOOOOOOOOOOONONOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OO OA[`@9` @@3{`@0` ,@*`(`$ '  " ('@2  @2 Ұ `'`@ 2,@` ,@`,@` %s: parameter not set㿈N@ J$N@ #d N` aN 2?`@Ò [' *L` * @! *L` ] * @h @` @2 % " 2 @"  @`@aT"@@ @TJ!  2 &2&Ԑ H@'&@:R b@:c`$$ N  N :  N  N b*   ? b*  @ N N" 2&N ?&N@ * @"  %? = #"    T"$ @  "  `$`$y @@ [y L` * @s L` ]o  %? = #t" ͠`'' '@gI@`"1  $< ", ', ''@a''"2" :  T"$L` @  "`9  $< b, ͯ', ''`'"@`$@$L` @`?4   =@"*`@ F? A?@_@`$$  ", @ @2 "J T"@ + = - ?"  J! T"@ b*  @2Ԁ  +Ԑ H@funny $() command: %s%R%s: cannot open $() input㿐" @-`"" !@R"Ȳ$"P 1V@ -` (` #`   "   @[`@"D   @C/ 02!6 Ր"@@ @CR  @  @ @R@ 2 @ϒ@: 6 &  㿘@Ԓ %3%# P>JG.@<9 ?. (9@ 5.@<' -.?:'@ #@< 2?"&@8 @< 2 㿘@`"@< @* 2, @` `$< b, a&`, &@&`@U@&@ "`@"@:`"@@=؁㿀@`$< !'"`'!' ''䀠` @c@`&> &.@U.@2     2\  @"  $  @ ! L / < @(@ @"8  ? @<    2. @ (*L /%< @(@2   @"h8  ? @ @<  2 /,@`,@ $< b, ˰&, && " $@ @7&"@ / ,@?$@@7,@`N /"@ / , @Q@;+ 2,@$ @" $@7|@c@Q@&@<Q @֐#8@ KF  @<L  .  L  .2OL O .N .@:  @QL  @"@@73@PO@?&@@ @  â@ 2,*+?@!㿘@ *$@@P- @ %ײ (`2 @`L@ @ ` 2 @ @, , , `L@  @,@㿈 '"`'j ' 'L@ 2 *@ ` /:"*@?"@$ `@6 `*@`L@ `L` / `*@ @   @. N "& @?$@6 2, , N  &HOMEPWDOLDPWD㿘N  +@\}"@]2 NN  2 N@\p"@] - N  @\c"@]@ T"" 㿘@P"@Q 2 @ 2   @6a$  $ 㿘  @ ,N {#    `N { }  2N? ,2 "N  # g$0d   $< b, є& , && Œ&K" 0A= "& 4N { }- 2N? `N ,2% 2"`&":`@NÔ@N@@N,f2㿘 @ %sPS4%s%scoprocess already exists%s is read only%s: %sX'D'H' D 2H H  DR DH@Z?@3 !, @R DR L"!DD ` *`:`'J! 3 .@[7"@\h  " @Db " ٲ"%T#T,  @` b@D ,  @@"  @; D  !DR DR  " @z`""`  @O @D %D  # %'T@ے 6 ' x$b  uq@Z D?* : `bڐ!\*`@iiikXmHmHmmn4n4q4pppprrm,rr0r@kDH@DH  `09H 'HH ?'H @? !"` 2@" R @$  @2 "` 2`DR !!@` @ DH `@f @ @bH 'HD 'DDR !"  @#R`" 2 HD`@@G H H "'DH Œ aD 'DDR HD a0Ґ b@Mɔ" 2 @f͒ "  @M @2@2M!t!t   @" @  @ !"` 2@ @ "` 2`@ @ @L!`" "    @  @ѐa`"a` @ $ $   $  @Ms " 2@H ?'HDH b@djDH  G`0`D B!'D   @ DR `?@DH , a0EH!'HCD "!:`? 'D '!L'"t'"'#('{0% 'D  D L 0"   '" 2@" @f "  ?  @2@1''DR &! "D@YD $D"@@``' @Z@DH  a' @"ǐ 'D@Y @$ D"@@`@ZȒDH  a'0" 2@" @e "  ?  @1@1*''D t!@ DR@` `? DH e a'0D  {D Z! D H D H L a0eD ߒ D 'DD \DR WD '0ʒ @6  ' D DH  a01DH  a0+D D@aDHثD @]'@P8@1rDD`@ >" >D@ @"ِ"P@'@1""H @L H! J! @0x @O _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿀'H'P'J!   "    2 ܐ#H(  @[b @Y? H ["",##'H  P` H X@ 'HH 9ܐ#P@;H   2`P 'P$H & a@7 a@7p p?   J!  a*   @ 'HH ` "( H H!  0"!'H쀦`@VK`H H   H(  J! 2`  D '" ٨".`@R J! (`2 !@W#"@XTՒ  @@ " .`@` T"T"@? .`@` @<   @Z ` .`@ Ƒ.`H!H J!  @ɒ /  ܒc@ @'HH    0&р 0!H@'H DH   H  "  H@d  ÒcǒcH  @-M H>@P" ܒc@J  @JƐ@I @  H ݒ`(@4 'Hb'H("b" "  ` !" "`φ Ja'H2  *aH "'H@""@" 2 @b 2 HP ϒ a"b "b!* !HH = "H &$2H  H@ ?"@HH @T`H"`ސ#*`@|||||| | |a"@.@.<@. ݒ`H@0UH !H   H@  ݒ`X@ ~@'ݒ`p@ 9' @cx 2'J!  ܐ#H(  @Ya H@W` P @UP J! " T#@N= T#0@N9  2" H` " " P@?'P ""@-א EXECSHELL/bin/sh%s: %s: %s㿘@U!@VL al @  L 2 ߠ! &  "@ " @@>@"ߐ! @shcomexec: %s㿘@I @I ߒb@S@㿘"     @Iޔ , 2 , @I&& &  ,  㿘 @IQԔ  2 " ,  ?$$ ?$ @S `2`@J`?@R  $ `$V` h$ 㿘 N = * !2N +  @I  @I " " " FPATH㿘@H J!@ / `  o @IX ` @2 .`Y   @T!@UT"@& &  @ &   ` @2  ` 2 % `0 ! "@I #`   @c     ?& la ?&  `  Q M`K `  ` 2 "@I "Ԑ &  &` "!l @~ "Ԁ @-a& &  &`@T !@U;T"@  @] bԐ & "b& 㿐@I b%?@I     J /  ?$ $8 @H $?@͒`>" <  2?I ?<     2&㿈&@ / Ɣ@?X@ " qQ@G  '"`'  ' '耦`;@Y :@Gw@$@" @-[$@Fv@ /,@`@"@@-H@Fdy N@ Ȳ`Ʋ Y 㿘'@$|%$|  #@7הa! $!!@3  @@8a$!$|$|%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?       J!   0' ' ' '''!'J! @R֐"@T툒   @O#@ ?`U!@*`@Xh`H F" J! A&  @>`@" <  2`/-"  @ʒ `&L -  L 2 #     @ `  @N ْbP@ $?`J!   ܒc@ ?@ߔ!`!2x?   ## >@" cؔ@ ^?" *R@   @  "` *2@ "@E'?`@ <`@      @NN>@" `@  +?@E'?`@E``` `` ",@ `  @ Z`@ y`   @6  here document missingherein: yylexerror writing %s: %s㿐 ` @ x`{?r"'  @5͖ 0' "m?@*I " @^Z  @6@*J"bV?" @ <`" "b@ ! @ `@6'"쩒 !"@ h "`@&@"`@`'  ` @ 6 >@"ِ"P@ ` @9@6? @D^'>@ " @ ` '@) @Д &?80(REPLY-rreadPS3㿘  `,` 2`%〦` @Q+(@R\J !@?!@Q#@@RP@ f"#8M ےc  @Q (@R=J@ ײ @N 4T* ?T"%*d) %s㿘.`` `@9 㿈   @D       @; 4 '''" h@2 㿐   `?`? J@ "`J@`? `+  J@   : * `*`J@ *v``     (a.`@| `?   $ 㿘`   "`1T "耢   {㿘pdbteste_error: %s (offset %d)㿘 & c@ ?++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"''ܐؒ@&@p''L'''b''"b@(> " @\O 쀢 *@"@(B  "bL 2 T@ "@'@t1"` ( '@q"`""`@Ð @{"  (Ԑ @F "@Q@P @Q@( "b end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐 Y#. @"  '" & " ( )""  "@P6 ""  //  * @*`#X@" b" b" c"  c8" cP" cx@~@' missing )zero divisormissing :㿘 Z " ߀ 怢 #@ @! 88& " `?0& / *& @yѐ "  $ Va@i"`@) @`  "  > "  J@ @K0D"  ;)#,* cX  /@2@A @   뀢 v@.耢   "  $  a( * l`p L,0p` @7M  @8  @(   @  "@  *@  :@  @&    @$    @4    @6     z`?   t@   p @  l@  h@ "`  "` א@   @  R" "`  "` @v  2     7"` ?3"`  @ "`  "`  "` ?"` "  %  a8@5"`  "`  "` ?"` "  $ @"@O@O"2& "  ̑,missing ]㿘" Mq    q  M  2 ""` ( "*`@ <  " M *  2 [ !@T 2 c!"  #@""`@@ "b !" % @&@Läb"`"ْ`"e & b*  <_" *  2M#!M_ !"? " % @&~@"" }"" " @O  2 X"`"' '"" J#X` #X2 , @*`@`@@D  , * J`퀤`" )"`"" 㿘@@J  ` $ @" @N@N2 "$ 㿘N` 2@@@@2 @. *cX  $ . *cX  㿘!" `""" "`" " * 㿘N  @" @b%@Nt 2 @!  ""   &@M'  *@&"" e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        "+a@+oЀ C8* \\\\\\\\\\<DLTa@a `@? "@$@Na ! @4a@!( !* `Q `  2 逥2逥"@!@y `J@ `@즒 = "@$`$@-@  2  @n!(P  @ @K `A@y<` 逥@N!h0 2 22  @8!(  ! @ @   @     @@  @@  @  `? <!!@ *)53/逤@$bД": !@3" @@   !᠔$@2!a@2"`@ހ@@/! !"@ِ "`@%"`@   >@"!@  @ @! !@2@"`@@@.?2 >@v"@!k J!  !@Jz @Kj "Ȑ@"@  S""   @- 2 "@c E @5 & ̔'# $'' '"@@0 " $" @#d @., @+$ @ @ $"8@! @. 㿘@) )!)' @*  @, L " @@  #` "`@Ք @y2,!"@ e$"ȁsubstitution failed㿈`"@"`0T@=@=  '"`' ' '@  $@"  @"ܒ@;@;@# @<א "@@"@;ڔ $ j%s: not in history%s: invalid range㿐@%Ē 0􀢠 # "* b*`"а@"`.@X4"Ѐ`#@3)&"Ѐ"!pL ?   "b" : ? @} '!X@( *`"@no history (yet)㿘"b  2 @ " "?"Ё㿘"b@" 㿘!"" %T#c  "1a"А?$"c $⸐"`: @&   *`⸄"#  㿘"b"< `? @; . "@@ !1!,`"Ѐ@ @@; " "2 @@@t "@"&@> "@"а?㿘 !Ā"b"<`!. @<" !". x$""a,`@"Ё㿘# # 1@  # a&# @q#㿘!"   "aĐ"a$"?"bЁ㿘"Р %#ađ*   @haaĔ `@<>*ađ* ? @!a@;@$ J "*""Ё㿘"@;.@;+@J? "!"В`""@` , @:!,HISTFILEr㻐J! N "c"#@F @H&J@  ;"# @ a"c @༒`(0   /   $@*;@謒   $` "` ^ $ ۨ`?@w%s%c㿘c  2"c"b"< !Ā* ""# @ga"Ѐ@ )', @ !@h  , @Ѐ , @c㿘'H'L'P'T'X"! "bN " @ !" @/H @." @+" @ 㿘'L'P'T'X@n!" @/L @.l" @+ؐ" %s: 㿘'H'L'P'T'X"! "bN @N !|!" @/cH!" @/_H @.B" @+" "|@ J! a"!|@: internal error: 㿘'L'P'T'X@ !" @.`0" @/2L @." @+" @ %s[%d]: 㿘"J-" cH @.b "Ȁ``  $" `@."" 㿘'H'L'P'T'X!" @.H@+C" shl_stdout not valid㿘'H'L'P'T'X!  a!@.ӔH8@0   <   `  㿘  @)  @)   @)too many files open in shell㿘@  >" "㿘  @:  `>"  ?̐"@86颐㿘 `@*Đ" `Ŕ @8 can't create pipe - try again㿘@n 6# &  & 㿘@8@7 bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘Nq @  "*NN  2&NА @Ĕ `+( H(  %` `  2 ` x p N  @K &?!`?  "!`  㿘1!`` @@7!`?&!`㿘!!d  !d` @7v?$!d㿘1!h` @7g?&!hno coprocess `h `"@?㿘  !d!d &1 11!` &1@79?&!`1!d &1@70?&!d1!h @7'?&!h/tmp%s/sh%05u.%03x㿘"#@8 ,` & & -+')>b`$@-.@|!  @(7  & " b̀  `&"& Rargument must be %job or process idambiguousno such job㿘 P"c<"b b@7^ "bb@ "@U!Pcx@; )   !J!  *`  @' "cD!J!  J T"! . *`@` "`*  @; ?<. J! @J! @A 㿘#$ 1 +)!% b̀@2$  2  2 M! "L 2x@2  @jO  2 @jH  2 `@J @X!xb̀ !T"`U@" @j"Ja @.*aj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘J! @Ao #HU"  !8@ "!#H @k-  "cL>@ۃ" c$#H#H U!p @: #U!@ub& !#L@ @5 0#>@b" _"#H ! T"Б, *  @:֔ ?, !#H 0#Lax +@j;  U>@:" 6`$#H"@*ax  T>@)" %` "#HcL""ax"#L#H U `@U" 5@@bP01"#HJ!  ! T"Б, *  @:~ ?, ! T"Б, *  ` "?2` `@:i ?, J! @A fork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐}=` 懒6 b@5@ $$$$` $ #(c "#"c @` `2$$ $$ $$$ $"$c8 "c8$$($0"#("# @ N  0@  +>)@Xb # ` "䀢  @,` @ ]@c @5? .#`?`"$ @4"b$ J! `    $  @i.#H  `U"@! @``g@4g`b   @4 @8J! `  ! T"Б, *  @9~ ?, J! `$@U `J! T# @9e T#0 @9` 2 #@   @4@`c"#4"#H!* @?* @8唒`  c@: `8 @ !l!l$0` "`"``#@xJ! !" `@)( #!b  @) b  !@)" @&l"   @ϔ @4h 㿐 b@4_#(`" ` "`@  @4Q waitlast: no last jobwaitlast: not startedjw:waitlast㿐 b@49#(``  `  ;a a @4    } @| @4 %s: %sjw:waitfor㿐  b@4 &@#$ "  2   2  ( @s  "̀@  @3ݔ #? @3ה  ?*"p @&x @3   &@㿐  b@3@62  @3 *"p ;  2  ( 0'#> @2ǒ 6 @؛bp  2   2  ``2  @fْ  @f֒ 6  >@|""p  @3a job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  b@3+@2` @3! *"p  ` @3 6!@Ű !X``(  !`)'T  2$ $    !h 2 T"@$ސ!2$` @Ȓ `"` @>` 22`#H  ` U"`4@=x #H !U"@` ` "bP@=f  @2 !U>@׿"!p"`_ `  ?$`c,@""c,` =``@e  7`>'"` $`#H  ` U"bP@=1 #H !U#"@cL   >@׃" a"}cL @2g @v! 0 #H ` ?$` @ @2J You have %s%s%s jobs stopped and running㿘#$( "!Ja!x ` "`"H 2 2  2 "2!!!Ȕ!!!!  jobs㿐  b@1􀦠   @d` @1Ӕ *"p D #$``    #% !`   @ @. ?   "$   2 #$  # "@6c2  @1  notify㿐 b@1|#$ ,%#L "    @ @b  ? 8 "$  L#$ % "@@2 @#D"  @1G 㿐 b@1?#,` ` "` @13 #0asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘#,`"  ` !!2  @b   hb0B"#, , "c0#4c<7#!1c$ #, "! " @6  #, !#4  b(1#4  @obH#4#<@c$㿘  &  (@ 2@& ,c@ "c@"@/ j_waitj: tcsetpgrp(%d, %d) failed: %s㿐 ``& `& J! "`  2" @eƐ"  `   ?& @4" & `" @32N  `倎`ဢ`  `s&  & J! &#H #U  !U#"@bcL 6  >@a" `"[cL  U  & U"@: 4U"`&) , 2U  2U $  @:ԒbP , ?& T U  ` bbP@:ʔ  2 ,  ;&  , 'J! " 2 `  *TbА   @3&  $"b "b耎` J!   !@f" @!ِ"   J! `2@{p>"#$ "  2 2Y##@2@I?@xw L>@I#$( "    2 2( ''''"@$@"$"@ @" ''''$   2       $ @ ?""check_job: job started (flags 0x%x)checkjob㿘 2 ( a80`  `  4@`2`&  ,   "  , &  , : &    &  ? atat"at  0`!l!l@2  ? "  @& J! ;`: @ J! .   ("` ` "`R  2``2` !  @#D @]#D@ #D    @t`J!  ` #,`  !& ?& c4 "c4@Ta`%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sH /`   ,"  @#`0  ?&     (#$ +#$2 ( -/ ( р /T      @`" " :` 06?-:``"2/ :    8 8' `%/  @@@#:`  2 `2 `2      2  / `*`TВ@@Ҕ``` ( `P @#F```@#@```h@#8 `2 O "`  x⠐`p@#&   ⠀` x⠐`@#   ; 7 T" T"  *``   #\#\@"2  ⠐@"ے  "  27  T@"ʒb㿘 b*  "'L@#$ ̀` , "  2 ,#$ `    2 ` %` &@L`?!ؓ*`@          T#$#$ W` S`0U@ғ#$ J`  J 2 @`#$ 7   ( " @  `"`2.&@-    2 (`@-#$    (`@, 2`` 2 (`` &@ 㿘cP "cP `qa $`"& ` `@`2``"& 㿘cT "cT @Naremove_job: job not found (%s)㿘#$#$  "@ " a00)"@ ("   T"@"T !  "̀@c4?"c4#P&"#Pc(""c(c,""c,$ $`"`0$" $$ $ 2"2 ""㿘 (   "@+  2 %T㿘R  (R 2 `  ".@,$4@+-&@`. `.@4?Pno closing quote (    '' @'"`'w H' '"#X`"#\ Q'`  ,@` 'H' ,@`b` ''!@N  \#X  "@N@  Ȁ "@ #!c\ "c\'!@N  \#X  "@N@ l  c\?"c\@ 3"`  ?"` J! a`,+3 7b@N  \cX  "@N@ ; P   * " D?$@@J b# ,@@xPp [< *``9 *,@@<] ",@@ ! [,@`,@`?$@@,@` ,@ `L "*`bbȐ @`$" "" b" 8%b @ + ? !" 'bJ@  \cX `"J@@ (  ,@`,@`  `,@z 'j ' \ ""! \ \b@N  \cX  "@N@ ?bȐ ,@  ,  \ \ ` $7b{,@"w,@b@N  \cX  "@N@a $  \ ""^,@  ` U,@?$@@n bC,@@N  \cX  "@N@3 () {b@N  \cX  "@N@ (   , * @  ,   ,@`O  ,@@`b@N  \cX  "@N@ # %,,@`,@bJ@  ` \cX `"J@@,@`,@`@ ,@` @,@`  w,@  p,* " , ,@`?$@@Β,@b@N  ` \cX  "@N@ * " 2,@`  * " ?$@$ @ ,@`,@`,@` ,@` $,@`@:bȦ  , ,@'J! `@( bȔJ@  '@ 8J@bȀ '  L ,@`\?&\A,@ " \LJ 7"ē-@<D<h ("* ) " '" " \"  \  " \  "   ' \?&\"$,@ ( )2,@2,@bJ@  \cX `"J@@ )L,@`@ @)$@ / (/`   , } *LА  }ʀ |L ,@`Ɛ  ` \,@2,@b@N  \ cX  "@N@ $ $ \ "   ` ,@ 2,@ 7bȐ \,@ ) ( ?'bJ@  \cX `"J@@c )" 0 ' ' \ 'b@N  \cX  "@N@E bȐ D,@ "  , ,@`\ &\25,@ B  " \ ,@`ۦ 2(,@b@N  \ cX  "@N@ $ $ \ " ` ,@` \,@`,@`,@` ) | ,@`L * ,@`?$@@  @ (" < >$@  >J  > "*@ * : ?А >`?@2,@2,@ ; > (">  &"083 > | </00/"J@  \ #X `"J@@ | ; | &!,!!!  &!"  `$"J@  \ #X `"J@@R <+ & >( &  >  $   26$ "J@  \ #X `"J@@+ -  $  > <  $ $    > $  |  @$ @ݐ$ $ ""!@`= @0J@  \ #X `"J@@ (!@0` $@ "b (t!@"!|@ !J@ ` @* `!  @' $ 2,?!|J!| O` N!@'`"Ԓ@'}` ` !  } `b"`1` `-!pa|@'b&!@ ""Ȁ!`8` "` !"Ȑ @J`$` "@"`"` ""`8$""` @!㿘!@!h #@) ah !@"ahcannot create temporary file %s - %s here document `%s' unclosed error saving here document `%s': %s 㿈' ́ '"   !;!a(& "a("2 "`@&"`@ #  '  >@""8@ @ ʐ " @>ے  @ @Z@ \  %c\ "c\#'  J@  \cX `"J@@  Ȱ L  L K I@ $ @wJ@  \cX `"J@@ `@H   @`?"``"`*   @ߞ``?"``"`*@@( @P $"@@ @@  c\?"c\㿘'H'L'P'T'Xa0 "a0" ?  b 8"b ? (b"!T""돐 " @H㿘 <$ T"$$ $ $ $ $ $ 8? $ $!$ 0 $$ 4 0А $ , 0 $ ( ( @%Y 㿘"@`$@J@ #T"T"T"%$@` r* ddH4$@| @|`@` `$` @$@$` V$``  2$@$@$`M$`$` I$`` " ` `8$` ` @ " N J@  @ʒ J?q @ ` " `8`8$`  9$` `8$` ` @ " "`  $` ,`,``$@$`$`8"$$@`` "` Ӓ``8$@ 2` $`$@$` " @@!@" @<" @`$@J@ "u$@㿘 ,J!    `?  @  (<$ (@ u,&` & "T "b@W  `!J!  J耢 Jꀢ  $ & ,E"@ ?  & ?#' ("@@  @`$  "@, " (@'g  ("  J "   ,$ ("  (@ Ҡ? @ ` """ T""@V  ,&&  , @$  ,   29&@E 5&3!4  , ` "*`@ "* " JJ  * *J !4 2  ,蟒  & h  @  PS1%dPS2㿈 "!4 R!0V@/!H@0'@#*   B@  !!P`!  'K ! `K '@  ` @qK  @ې'!" '@ " @< a$ ""! @ 8$"@@/[!X@0$"㿘!@ǒ" @" missing ] 㿐 )'#""J@  \X `" @@`l.` $(, :  # [  *  U  *   M *  H F  *  A`, :  [; @O 2.m# ?&@ .  L 2@"`"J@  \X `" @@  *  ` `2@. , @^: 0 ?&@.q 㿈  '"`', (' ''%J@  \X `" @@[?$@x,,`:  [  ,`:  ]"? ,`:   ,  $ H%`?㿘cX ?"cX"T"`"@`"@!"Ȑ `$* *  "" "" 8$""㿘#\  "J@ `0cX  "cX"J@ `"*J@&"#X"@N  "@N \"J@ `"J@ " "cXMAILCHECKMAILPATHMAIL0@-ې @/ R@ ct ""ctt" C"t@-Đ "   #`@-   #d )%<#   " $ @! 2$  2$ Ȁ 2 ̀     @$  2 8#l "a#d$  $ @  <  $ "#p㿘!@=#`$#`@/a3)'@3 :,@`@, %N? \ ?@!F @"5   M!  @ ?. @`"`$`㿘 #  2a/a 8 a$$ $  @} 2 $ <  2$ $ _%s you have mail in $_㿘J! 2   h@- @.    xNj  p@1e IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION$H$@$8$0$($H$ !0$H$$$H$##########x#`#H#8# ##"""#"""""""""x"p"h"`"X"P"H"@"8"0"(whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUnewgrp=exec newgrplogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliasTMOUT=0SECONDS=0RANDOMMAILCHECK=600OPTIND=1-iPPID-ri-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin/sh-shPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV$H$ $0%0$80@@ T"Ȱ @"b# a @” D7@*""& @+1@@!"a@۔ !pa@֔ "a@є @ a@ʔ @"̀ "̑, ֈ` ,  , !  !, v` ,  , %  X$  @Q   גa @Q$""al! * * !@A"?"@ @7`h "@1b8 " @+`p >! * >"   #`  @.   2`@!"b$!x!   @. !Ŵ  @* x@,,L /@lP   @f  P@2 T@ @*! J@ @ Ȑ ! J T"" @,|a  @*Ð @S@,@*#@ @,@*!0<@,ea!<!< L   @y<!$    "@ @*   @+@e # @,1a$!@R 2  @R@R", ,! *  @% @ J! " `,`@$$ ` ސ ,`@`S""P`@'J! "" ؒ`,`@$`  @@ 0  $  "b>@"  ("b! ," `  $䄐   @L $ @  @    ,  $  @ "@$ @]  <  @  aJa ?*a@ L  "" ,`?@"`&"``""@ !J!*!! J  J`   k`!J!     @U L   ![   @I J! "   !@)!0@*I J@    @2 @@ 2   @) 8@*@ ` ` !4! * J! j@! * @  include: %d`'''''  @ b 0 '?Ԁ  "` '` '''"'@ː " @5ܒ ?@"" @T 쀢  ""`"`?`  *`@0 0T0 0T0,0\0\0TB "̀ " 8 @-  bԀ  3"`" `" b `'" b@`"`@/ @}"b@ 쀢 b"`"` 㿘" \`"" @ shell: %dUse `exit' to leave ksh 㿈'D'HD ' 'J!  H@ '@* 쀢 "!" @56 ? DDT""@?`/" "T*`@222t22t222t쀢  2TⳐ"J!  D  3 D "`@@@   ahP3!, @x D 8 J! D`  D` ?"` 쀢  LL DqD@?V +  J!  ?'  V!x0 aȀ  k  &aD" H &@*  J! D p "b  V  쀢 aȀ 2&a@@y"㿘 TJ!    T"܀ T "J!   !U"@ ! !#T""R /* 55556l55" @4CJ! @!( b?   .  @  @M@b@"㿘#b D`44  b`$ $ $ $ @$b㿘"` 2 @"`@"` @&e`  ` , R@`"    $` ` R    @ ה @:"`""A`㿘"`"` "` ` , R@  @ $` ``2` "" 㿘" @ @  @!(㿘!"@ @"" @N 㿘  ! "̀@2@  2 㿘@u / 2 @Ȱ r @xb8@ alloc: %s㿘 a(TJ"` * 0 0  (  0  J 0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 a"*@  z2@  A"*@  Z2@ b` 2`! ! " " " "  @"(!0123456789ABCDEF㿘1#.# ?@M .@H2?㿘   @) @P㿘` `*@5 㿘   *`@&  ` &   &&@ >a>>Rc>>e>>>i>xk>pl>`X>Xm>HC>@n>8f>0>(> b>u>>=p=r==s=h=v=====x=pxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘 X   X. @K   .  . ?%-*s %sonoff㿘.` !J@ #H#P@@( Current option settings set -o %sx "2o#'آ  X   Xء. J@ " @ ,`" " ؀`'ذ .  . !T@4 0!@# X  ! X#N  . J@ " +cذ .  2NT""p X   X!*` J  J@ "`*`*` *`*"s`㿘!N  .`4 2ᛞ฀    &!* * *  . ` @L@L6@L@s@L@L6@L@L" !* o:Ao;s%s: bad optionparse_args: `%c'-A: missing array name%s: is not an identifier㿀  J R" "* `,  `, @4 X   X,  J` ` " * ,  2, *" "* `,  `,  `,  `, @  X   X,  J` ` " * ,  , *`!J@ -   @r / ",` J  -2,`  ,` ##@ ! X@͔d2 `A `A`o`?"ϰ?,` (`?  ސL䠒, LՐ  , R Ȑ"~2 `s2  ,   , J`@2 R`@ ,  , ,   bex? %*  J - +* J` J@ - !J! *` *` '   쀊 2  *  "& &  '* `2L@#3? @'ݒ J  #Ӱ?0# ,  2 *`$ @x؀ *@*9  '*  J- +2  (  * (Ѕ+ 8 +  2*J- "@J `  %s: bad number㿘Œ!pkX `+ @@@@$ 2$@"  `]@{ `?@j*+?@!㿘   U  N  * ? [E  ]`2A       !"   24   ]"/ .  `(21 $ "@  `  | )`02 `  2 *  ``?㿘 "    @ꀦ    ?"` [ *`̀ " 4 &_"˰ @ːİ I? @   @  "   ? 2 @ $  2  ~  y  @Ԑ@Ȕ "j   ?` 2] @ M  E 2B  @N@ E?B @ " 2 @ 2       @* `?     !`?2 `[     22 @?8  - 2  ]      2   4 @4   2 ]2   㿘% #   ) |?? |2  2 `b@p ` 2  * 㿘.` @㿘&@:`2` : `[*`ƀ ?$$$@ƀ `@$@$2 `$@$$@ $$̤ݦ2?$:`&@: @``$$$㿘@ "" " " " * %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`` @* ? J 2D`@* ` @ -&`J` -`J`  `@ &@&``  &` ʰ?`-2`` "J`` "&`` 2 &`+2&`J`  `&`?@ &@-`   &` ` &`, : `??Ɛ  `, `#"N@{2`N :2`.``R&`  (`  ( 0,  7`J@ : ;; ,@* ?`J ` @* XJ@ ;2NU&` :2`.``&`R :  (`  ( 0,  `8; ` T"6 ?2 J@@* ?`' #2), @* ?`J   `b*   &`@*  b*  &@ &`&`&`, > %s'\''㿘  "* !2L L  L  F 00 ( )%!`'`7$ 2 10   2 L@  ?&  `&  *@ L  ` 0%-*s%*s㿘 "2`T"@ c" @@ [` @$!T!T@"Ĩ"@@ G$  .5/-T   @Ւ@6 @ h@Z 6 p@Q  @&۠ "l`㿘@& @ @`@L@ "` @&"$@$@ @.@&@㿘 @#6@,.㿘 %>@Ӕ   # @  $$ 㿘 @ ?    @ܔ* ? 㿘d"$``@D  > "b"`" @ɐ   "  ">"b  @” "’`㿘   `T"N@ / .'r 2N` .``*`:  / 2    L  J@ :" "@`J@  :"@J@  `&  L /"" "N "@\@"@C@_J? /@ /,@`$@ '@"@'@CJ? /@ /,@` @' @"@@* "&JV/`? 2   . /J/"J .@2@*@*@`<*@,@J"/"J.!@J/@ @ @"*@*@`*@`*@`  /"͔@ 8J@ǔ"J*@`JJ/*@㿘   Β T"@ b@ !"b! $! ! @ T""`㿈@ 'b`' '@'@ 2* /** " G㻘?&dK`N /"N [@, /$@@J``N .H`2 N .2 N . ;?N /6 8?3& /. `" @+. @ϔ# >"   *<O / " 2N㿘@m  4` @Ԕ @ݐ ` 2@  shf_fdopen: missing read/write㿘`"`` @ק   "`  " ``"````  ՟a   "`&  d & "0` 0& b" & ,&  & & & & `& & & && $`& (ڐshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @A   "`  " ``"````  9b       (6&  *b&  & & & & `& & &  &&`& $~shf_sopen: flags 0x%x㿘   `  " 0}`"  & ,B B2 ?`$ @j ,?& & & & & & & & && $& (㿘   @b@  &?"$  ,㿘  @H@  &?&  & & ?& 㿘     &  @  ?&  `& *@" ,㿘  @"$  ,shf_flush: no fd㿘!" 0` 6 ^b(> $"b!?@ *@&   :   @  &  & @ @  shf_emptybuf: no fd㿘!   6 #cx(> $"by?@ `p *@&!%` $@$@2`?  *` ,  "@  &   "@  &   @ &  *&  @ &  *`& =& @5  "@ %%> @  6@   (&& $&  @@ & $ 4 `  & & *@&  &  &  &shf_fillbuf: no fd㿘!2J  6 ӏa@h> $ "b@ P ?2,? & & !>  X   & " 2  "  4  (&>"& $&  &  & 㿘 6> (> $"bQ?@  ?2E?@,2(& 6   " : `4& 2 8&   : 2 & ( &  "&  &  & *@& @ v 6  >"& $(&? shf_read: flags %xshf_read: bsize %d㿘 ג``% `Д` 2  /?@ @ 4@ ˔&@& "& `4 @$@ (` shf_getse: flags %x㿘 җa` 4 ` / 2 ?"&  ", @ " $@ 4@ & "& `&@`2 ,shf_getchar: flags %x㿘2  Nb 2  ?"? ???&  `&  @shf_ungetc: flags %x㿘@2@ (cp@(2<??"9?``@2@` 20?@@ ?"&?``@2@`@&`@!"@` ?"@?*@&@`? &`*@&@`&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@? Ӓ`?">?@ "*`/` 6@ Ò`@(>`$"b)?!>` @ a  ! 6` " @ "` @(&@"&`$ 2 `p ?" ?`?&```&`*@㿘 " ?@ @shf_write: flags %xshf_write: nbytes %d㿘 pb8`6 bPh 4@ o&@&"&`;# ?25?@ %`@&@ &@#> @  6b   (&b&$&?$ 4 ` @ 1@&"&㿘'L'P'T'X@NLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Ȑ ` Ȑ @*PCh'H'L'P'T'XȐ   BΖ@H/0123456789ABCDEF0123456789abcdef(null %s)P ` a @,W`":``%   ? ϒC&  `& *@<  N@ `"* :  Ln* {X{{{H{{{{{{{{P{{{t{{`{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{A?=":@9N@5 06/N@ +) ' *  &,: ?@, `"-@*`,: @@, ` "N@ f` & ,  ۤ ۑ* : `S *`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@,~@@@@~@@@@@~~@@@~@@~ Ϥ* : `k"P*`@~~4t~t   @s  0,@@n 2,:  u: -5 +0. +  04  ,@#'L@ 0"'!!   @4  ,@  X x,@ 0,@'?$@`!8@  // @@c_%@ @"@? L@ + -  0  )?#L@3 0  ? 0 `&  `&  @*@`?  @` x 0  ?*`:  `&  `&  @*@`?@  0` %,  ?< ʒ`&  `& *@`,    `?  ?L@ `&  `&  @*@`?`$@,  ?< &  `& *@`4 @,``(?㿘!$#@"!0"c#   $#G "c#` ` !# ` @ $#`@o 㿘 @/*0$  | "c@#  @X  @  @ $ c "c# | "c㿘ΐ $%# $c $c!! !@   @g  "c㿘բ L'% $Ð $ ; &! 4#䀢  &@"Ȁ + &! &  ` `@- $`@( ` @ °`@ $` "ctoo many <<'s 㿘c 2  "cs!"c#!- "##b   @?`?!@" b b& J!|   & !h!h@ !Ṑ"@!h"!h""& 㿘c "c# 0,"c@e 㿈@L @ @ too many redirections let%s: bad identifier forselectH !" |`" @w`'' @'" @n`''ؐ @'#䀢 2  @"Ȁ  c  "c#͐ ,"ca a 6xȀa! `{" !`( !0 s! ! 3a !# !!!   !̀!  "c!"`"`"`  "c@5 +3#)T` @" :  2! $c 2c %ci&c!"! (`"f!"c"͐ ې,% ئ%cؐ" :  " :  2 @&!| "4" :  J! @bb  ܠ$< ", 'ܡ, 'ؠ'ؒ ' $< ", ', '' 'b"`" :  ؐ" :  " :  ؐ" :  "%c@"  )  "#  ( )ۤ { }֤ @ "# $< b, ', ''"b @#`'"!r  $< b, ~', ''`'""@@C "# ''(!<'(#') ') 'p!"  @'!7 @"@  2 a "" @ H"Ӑ ("!|,`$Ȑ@@f@$0$@a   @!"s@$$@0E@ ! "$Ȑ@̒@$@Œ@ܐ U@$$! @ɐ$!"  2 @S  @    @  !ɒ " @!"} ,f % ,"~` $ %",~$ T  @! $< b, ~', ''`'"@"@#b ~$ ܠ$< b, ~'ܡ, 'ؠ'ؐ`'"@ܒ"@ ~y $"~`"~`㿘c "c#؁ "c! {! }@ 7 㿘!1 @  & @ @& 㿘c "c#P ,"c!! 0u@ @ l& &  "c 㿘c "c#) "c! {!  }@\   ' %  $ $ @`2$`& Ē 㿈" @}y`'' @'@ c "c# "c ( "c)'%#!  $< ", }', ''`'"@ $c׵ $c |ݐ! "c $< b, }', ''`'"@"@ }p&  )T & c 2  "c׀ "c0#!< %S%s: invalid function name 㿈 '"`'| ' 'L@ 2 @쀤 % @  ?  %  @ w%"ݲ?$'L@ 2 @,  ? 8Ѣ` `, ̢`@Ր  $ |& `6  {ܒ  "c!"  ``2   & @ & " |`& "" |`& "`"` ?2`㿈" @|n`'' @'c "c#ڐ "c! ;? <"c#1'%c $c#Ð &#! $< ℓ, |', '' '"  ;@ " :   " |`   $< b, |i', ''`'"@"@ |W㿘@%" " " 0(   @ H  {}xp newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘"a@C &"" ' T` "`@@@`"" T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %R?%dsyntax error: `%s' %s 㿐 ' "##" &&""&c䀢 c '"c""`' '    % '@  "" " @R` "@`@ 2R`@  // 'o'! ޔ"" "   ""  "` "`㿘" zΒ`22 " " " " " " 㿘"!0c  `?"c""!@"ah""#aliasexportreadonlytypeset㿘J!   a)   '@ c "  e r'@c  r t'@c  t2 '@cȀ   "  2   2 8  2  ||&&!()]]<>㿘c  "c` @ AԴ "c#  aJ!|@ ``Ja`Fa `C (":a`8`(4`) (`a"  ` (!0(!8" @ `N|"  "(a(@V`? /`,"#2 `(.`" @ ``@`*``$< b, z`"``, `"@`@"``""㿘c 2  "c @"c#!% "# @`*@`$< b, y "` , `"@ @"` @"@""1T" 㿘 `& "c!"c .` "  *`(8 J *`  * " *  *  㿘"" 2 `2 @㿘 V .`y/ ,  $@6 .`@X 6 6&  0, `"' @ "`V  * @@ ""@@2V * @@ @"@ ?6 2 y ֑, y|㿘T  $?*    N N@@2   @K 2   2T *  2N  㿘T  ? T ?*    N N@@2   @ * @2T * @@ 2N T  T ٓ*`@ x&& & & &  @ ?4 $@"R`"`"  `"` "@@"@ 㿘 @͒`㿘T` b* xJ`` T` "@  2` T`&"@< *!, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘 T"q"*  2 * J@ 2"*#"#"` " " "`"`#+ch" !T" T $ T t $ t! @$! 4"$ 4" $" @@ `@ !@  @ 㿘T"!Ԓ`"!Ԑ!+b|@ )㿘#Tb @/  $b""0@/㿐 @b*  k  * 1T"T"Р   "?@D ?  㿘. T"Д@ ""a, @""""  2 " ""`@㿘"䀢 @="@TІ  "  @   TІ  " " H2 @"   timed out waiting for input㿘Tb 2 T"b ,t`  """!, @""䀎"" T"Т      "  2@ 㿘  & 2L " @"b )"bຐ  " !  ! >& & !"ߵ$"  !va &  & 㿘"!,""" T"Т $   "  " J @  㿘T"Т  `02` `@l  㿘 "vCaa&  !` & N@ +#h    "@& `2 +#h   J!   ?π`&   &   & @( 㿘U p     @    @    @  㿘 U p @ 㿈 < ";    c@s耢  ``&  &     J!  @!"&  +& #h  & '''@D  setexecsig: unset signal %d(%s)㿘   ?ϐ -bz   ?ϲ`` & `` `"  0   2     & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %Ttime %Tcan't open %s - %s%s㻘 ?* : `. *`@ $$h<Pt(   #- @b 2 -@ߔ   I#- @єb 2> -6 `-'--@  V --## - @  -@( -@0   #-, c8@   ,  , -@-H@v V 2  -X@l   -@d`   #- @Yb 2-@Ph`-p@J -x-@?  `"'--#@5 `   ) |@*  2-`@```-`-@ !-%-#-    @#h`@  `" R@   @#h`c@     -@h`-@ -JV `-#. -@ .@ǔ`.@ -,x`.@ .! .(.0.8 @  .H@   .P@ `P @`@`@ 2@ @ = @   1`  ".@ m   O "!.$]_ !. >@" X B @H p @ 2@  << <<- << >> >| > <> <&>&%s 㿘 ` ```  "     @`0`>0!*`@ t4`0, 0%0!0 @0 0(0 0 080@@`2  -Ѐ !0 H-"А@㿘 `2    ^ $왒   @ 2   ^ $썒 ?슒㿘 0"N  , $0|<HTĠĨN N`   " ` $ \_N $W (T K*` : N A ) $B (? (<  *` : N  ),& ) # "   " $! {N  vN  N  }N   ( | )N㿘'P'T'X@P h'P'T'X   B跖 @P`N`1!`% Nŀ :* ǤPPPPPPPPPPPPPPPPPPǤPPP4LjPPPPPPPPPPPPPPƠPPPPPPPPPPPPPPƬPl h*` : 냒L  ^NXN`d 2 `2  `? -, B*` : ]L  8N81N! `;2(  ;G#  B`  <?  $N 2?   NN "N`H㿘  ^ pr4 4V  @S$ܰ$  2 $   $ ?pS$ @9$@` 2 $@  2 $   $ ?p7$ @$@` 2 $@ " @b$ $  $ $㿘@  "p @ 2lJ  ( DʜʜLL J J JJߐ J J`2ֆ0цϐ J?@  2JĆ㿘  & ?o % , o&$@$`$` $`  " $` "$` , ,,&㿘 7  " p  " p   p  " o   o " @  ϒ ̒o㿘   "oܒoْ  㿘@&㿘 @*Ŕ/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘!U"  @w?$"! $!83! @  >$!8@" 3a` @   @    3a01 @? U  "b>@" 3a!U"  >@" 3b@-"?$"U"nbP@㿘!U" @?$"R㿘!" 0n`ne"  2$`3#"` $`` $`$`$$`(` : `6 "`$`,"`㿘"`,"`T? @``@!"?@А`@ @Ő ?@i ?<@n#"nג`x ph`PH8 (   TMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘 Xa 4!P  +4!P ,`X$" " , ,%s: subscript out of range㿐&@@ 1L [-@T( &@!"ܒ "n=`"$W #(&4#"n&`bad substitution㿐" +L "*`@  5z `8$"`8& " & .  b*  "!L  *   "*@ *`*: @  * `~*`@n 0x v"`@&5!*`@pL ppppppppXppppppppppppppppp<!xH&  C& ? ="<& `9&  =ڶ&3& / =@N," `  0`, "` # "@. &@  !&㿐' g "*`@   `8$"`8& ℐ ?& `& 2#,`  ` `,`` " @@&""& &  "@ &@ !&0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @ 2TV""2 O@@6 6  5@  & `" ?.?@س .@讒2?`  #?.?@J ` .?@B .@ 0 0? -.0@@%s: bad number㿐@|?26"setstr: %s=%s: assigning to self㿘"28  ? @ @D  @ 6b : lM  ?&` & @@ђ @w   &  &Z  !&@㿘"2& 8""8" b`" ("  !&@㿘! @ R" "V?""  &@N  @ T"  L@ >`"'q - #2 + ? "' ' *   ଐ  ?А  ?  ?ɠ?  6? @ ?L@ ɢ`2 &@㿐2 b  & k &   "& "!&@\%0*s%.*s%*s%.*s%-*.*s㿐@X0@  "&  "j̒`0@Z @2@ q J  "8J" @ #@ @ @@ @b*  7"7" #\ " T",N@q @ `  `N@  2`@@ N@N@ 0"`7  @ @"L@ /qkJ @  *`@ `*J 2J0@L@ qlJ @  ,*`@ `*J 2J㿘    @@  &@j & @璉 =,  $& @ j ENVSHELL%s: restricted%s: is read only㿘@5 " L [ =@@ @6 " *  ޒ`@ &  L = $"&@ϰ  J! 4@2b` 8@,b@ 8@&bH h8"Ph6`ے `.@@@B$ 8"`"j `@a _    @2 "2  "b ""        ?$"2 b"$  ?$@*b $ p$ p@2$ "  N`i   2 "" < 4& 5 b    `T  "ǐ㿘 " i @` `"&  ` il ii `2& `! @ a&!@ސ㿘 &b*    "*` ` N ` N [@4 2J2 (+ J ` (2 `JJ [ J@ `[`]2J@2J@ 㿘Ȓ J`? 㿘 @  J@ J` =`? 㿈"!h>`''!'" NT E >  2:ΐ ,   7" ,@ ?"@ ,  "  =&3 $< b, hU', '' ' "<,2T $< b, h7', ''`'"@"@ h%㿘o Xے   㿘  " "0"0 >&@[ `d"  >@&?*  >&a!&8Ɛ ?`; L*`@L(!$!l 0+ TL{"burԐ  : 0q!" ga$"L /c@ǒ  ^@6 Y<  SӆaM"b >&D7Ԑ4" 9ɐ!T. /$"Đ ,$"$ >&@{ >&#@ $$`d! &"" & "@ 㿘 ?`7;"*`@,Hhb"!lI 0;"҄ T "b1" gHa &"˦ 0Ɛ 0""㿘@ @`$@4$`      2       @` !f` @#`@ >&`& `& `& & $&  J@`][["J "  㿘@ [""@Ҥ㿘$`8"`AA   . V  .  @(#)PD KSH v5.2.12 96/10/29 AAA  Q AA A QB㿘d$@ǐ@Ԑ !#%!!$``$!$ @``$!$ ` !$@4a (@@2@@   g !@a    !$@x ?@* !$  ? @@ ` "`  .  /?㿘! ` = *`@8|! *  "a  ^@{ " ?0& @A!  `?"`! @@   " ?π "`?"` "a `"` h*@ "a @ 9 "  /" = P= X @  ߰?@ А ! p@ !< " " @y!ܒ!@ ʔ 0̐ <a     @ `@ܞ  "  * @  pq    *` * ?;"`"` hM*?π "`?"` "a `"``h*J`hi <a 104q    *` * ?"` ! "` @e`$ `"``h*J`h: <a @o"a  "a "! `"` h*  @  Ѐ  J 䀢 @H"!  `k* @  "a !  Ѐ`"  k@ @` "@" "@ ["! @  ! 2 "   "` !A Ѐ  jq N    ? 4N  jNq @ `  j?  N   "? Р?  k#@ ` "@?" ="  Ѐ '`А"` k *J!  "   M*@  "   -*@     "   ^*@  "   @*@   "  *  ` "`@ ` k ! "   ]_ '[ "!  @`h " ?  0KB H F @cT! " ! @ -@ 8 "!  `"  @Œ`܀@ " ۀ ?" @?! J ܀ s c C  @  @)l@   "! @" 㿘"! %#!? $!$a$ "! "" "@"!@z < ! <  < .       <  㿘! K! *  ` @@ 0$`̀ ?"` "  @ ?"       *    `̀ ?"` `?"`` "` `` "@ @U! !  "   @ @"  ` `" "` "`!-1   U@       @ @Ք"  "@ " " "̀@ "  "@̐" " "  Ā  " Ȁ a@!h. @                            w U"#`Ā "``̀ 2 "`  a*` "`J ܀ s c C  ?@O@ \ K  @  E J!  @ ’ ;  `?` @1?`̐"` *! !   @ @3"  `  "`  "  * !  U`` "` U"# ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘   @ <a @" @ <a @   @2`2 " @ <a 2@!$ 2@#`! "@`@ ` ` " `""  ܒ@軔 @?* : `yeA!\*`@        D    D                 T                          ` T   8 p    H        p <      l      8    t t        0         t     H@ m !U#`, e!pђN` ? !$ @  J  JN`@ ɰ?@  !$`!$"@"@  '` @`,@ !$` !$@@a,@ ,@ !$"`"!$"` "a!"a ` "` "` "!!"a @Y  `  @c@v `"`@K` @#N@N`@2``c  @c@`  H <a `@Q &L?N@ c(N` w W"   Jq`  J      q J   2      N` %  N@ c@@ɒN@ y@ " N@ c "a!"a ` #` "`!` @ 2!? ` "a!"a %#`@p  ?    ` ?"` ? "!!"a `@` H! `@e`  `@`  ` ?"` !   " "a"@!@y? "!?o"a "!!"af"!  "!!"a @c@l `"`S"! a!@O "!aD"aa!@@"@ "!a"5"a  w "a!"aN` @ "   `*  "a!"a "a   R "a!"a    @4"    @   6 !!   *@"` "``Ք  "!a" ?"@  @#@#`@ @ $ Ȱ    "a!"a    @4" !   @l    @    "a!"a&!  @P"@  @j"@ `"x"``"q"`! !@ja "!!_"a!@ ?" " UN@"cU# U# ?`?N@ N`?!a@v䠒6 E?@>@֐ 0?"!"!)"!x? &5?m V q *`: @  2` 2 J  7q`?2 * :     ଑*`:  " J   *` *`: @  2` 2JJ  J  J   L  q J@  2  `  "  J 2J "a!"a `` "` * : q   T `   J    ` T" @0 2 ?@)  ?   ` ?"` e"a    @]%#q! 3k'l  J `    $! J a*  * K`   $! K,*  +` ?``"`@#! w * ("  @ J!J! "? @Ò@I !   ` @" 㿘 @?* : `t E#`*`@  | | | | | | | | | | | | | | | | | | | | | | |  | | | l  | | | | | | < | | |  | | | | | | | | | | < | | | | | | d | |  $ | | | | | | | | | | | | | $ | |  | | | | | |  | | | 4 | |  $ |  | | |  | | | | | | | $ | | h | | | | @    ?@     ?@ڐ   ` ` ?@1   ` ` 6?@   &ڰ 0UN@"c N`"`U# U# f FU U# a4  N@ ,`? ؒ @  2 0         ` ` 6?  `  4 0  ` ` ~?@ z  ` ` p?@  l   ?d `q ` ?J  X  TJ   4 2H?0F  ` @   6!  @gJ      % % `   ??,? @GJ`"`耤``4 0?㿘?%#!! `̀ @`? ? ? ` ?"`"!  㿘&@ "    @u  ["  { ( )?  { } ] ?  ?   㿘#`!!\@M ` "a\!\*㿘 "`!\"` `@:a\㿘 #ZĒa Za$  $  @b  $  $ $㿘 `@!` ` & `& @&@㿘 ![0![-!㿐 " "`"`U"" " "` " "`"# #!"u#!4$a0"" "<T"Đ?$a0""a8"#!4"!8!L`T"Đ?@'T"Ē$L!!D!D#Za$!DLZa$!D!!D @!L` @!LT"a4" ?"@"!P *aT "aX"!\㿘`7 `@` 6/? `@` 4"` ! ` @` !? @   @ @w"  ` @"` !   @@k `@"` 㿘  "  @ @X" &@ " "  &" ?  2?,?H 򀢠" ?? ] q T`(` ` 6.` ( "'` `H 2`(2``H 2`` 6 ` ( "H`H ` `଀   J   Qq??H? B`H  ? 4H 4 `( ?,* `( "# ?,  , `( 2 `H 2  ?,  ( "H  ? TqK  6  J "   &J .( "   6"? ( "?  6? H 2?  6 ?( "?  7q`??0H  ଀ 6  J@ H  ଀   J@  ј? 1`q`*?  H  ?6  J?b?! @6$`   " ! @  " "! 㿘`"F?!?@">?"`N ^   `  !\@ "? 0?! @$`   " ! @  " 㿘!P!D*`@ @L qS qQ @) !4"a0 *aT㿘 !X"!X@ #@6 aP$ aD* *  @{aP$$aP㿘  @    !   @T    !@@6  㿘        /-$@@2`@ :`    @' $@$@!@2  : )!   @$@!@2  :   "㿘 `@g@ 㿘    !@Y  ` Q`2 a4   `  `,@ @-` 2,@) J!   M,@ @` -,@`  `@ `  2 ,@ ^,@ @``@,@`    @a4@  !4!@6   ,@ a@`  ,@!4!@%L@N@@ 0@=p"L@0 $0``      +    <  >%LT@!4a@  @oa0 "a0,T!0@㿘!!0* "@oܐ @ !4`@-$!0N@oѲ`!0`@$!0$!0"!03o a0@&a00!4"@@`@ "0!N@o`!0`@$!0"!0㿀  #Uc  ! `  $ $cc ! "$  #\#`  sO!@a?0H*? "`U "co  "`'T. @@Ґ#  ⨒  ڀ   "@ $ `"` "!!"a"! "  㿀  !U#    @  $# !#Uc 2 ! `S $ $c  `X$ `   #\#`  rš`@԰?0z:@@̰?psKz 0i  .`sZ @ @ @,`sM @ @/ "`@@0.`@@&  @rU "c`?! "` "`^ `?`U "#@J? / T"K r "!!"a"! " / 㿀#\#`    r5 or  @>?   H     M-㿘J!   NnI!   n- ^ @n*㿘 "!< 4a8㿘@n n 㿘!$!$   Ta @ڋ 㿘@ɔicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom0@f  ' / / N@ǐ"  N@ b @ "c< N@4b@  @ C%>@ !@49UU#̦ O"-U7UN@Ȁ?? 3 *  ? B B B B @ B B @ B B B B B A @ A B B B B B B B B B B B B B B ?p ? B ? B B @ B B @ B A@ B AP Ap A A B< B B BВ @Ŕ  "cDN b@ /#$$$#$ #$ @$#$@ N  #$!N@}Ő  @ # $#$p"@dX N@qUĀ #$@uТ2` Nc@  @/ `/ `/ `/#$"y$#$В @~ '#Ԑ Nc8@#$ i$#$Dc  "c c/@   @}  N@Ӓc @] 6RN NcP@#$ H$#$#$ $#$@_AN#$ <$#$#$ 8$#$#$ 4$#$В @9 %Ȑ Nch@?#@#N Nc@#$$$#$В @O `N Nc@#$($#$В @ / 2N Nc@x#$!$#$В @ &ؐ Nc@h@Na!(&*  @@@!#( @f #( ,#( ,@p "#8@2 `  O`@>,`@@D` @@& "#8#$  U O@'`#Ȁ  "c`U#Ȑ @ԑ' O@2`@#$  U#Ȁ@,`Ȁ@@!D?c $##$"#< 8 !Dc  "c #P @ #P ,#P *`"`#<@    O@2S`H#$ @ #<?c @ɘ #$  #<?c @ #$(< 8 Dc  "c c$$"c$#$ $ $  O@`P#$$#!#d#<  @ #d<* @*@@ $#d,`4`4`4`,` ,` $` $`#$  < 8   O@p`/Ȑ '/ɐ /#<  @` ( 6DO@b @ׄ D# #<  @M  D O@1Ē`D# #<  @;  D O@1aD# #<  @)    O@1a( '#<?c@7 6 O@1aH@0#<?c@  0 O@1zaX'#<?c@   !'@SXUO!h#8@|  UO!c8@|Ȑ U@\bԐ R@XbD?@?2?#$  @C #! #$  @v''#<,@'   @  '#< @ >" O@a!@#D`#@ @*@ֱ 㿐@= R@bD#D`U# U##@ U#腠BUąB' "  U#ؐ U@ޒbԐ@ping: sendtoping: wrote %s %d chars, ret=%d 㿘-U̪ -- 5 c "c 5 D#5  , 4 'U@Ĥ<#Dc(4 @Đ  *@ * ,#` ̐ @ U#Ȣ @`5`#$$ #d 5 @T5 #< #(@  R@aG#R#c8@{#$   Uc@ԋ packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %xx@  -  @#$!'@QS @W~0Dz&@ ת`Dc c@ "c@#` ">` `/ ` / ` / ` / ` / ` / `/ `/"@'"@`''А"@@'V`DčB?U#B:#U#):#U#؁-:#`U@cĕ: Dc(J :@` cH "cHc@?"c@ `, 4 'U@Ĥ<#Dc(4 @Đ  *@  , #$ J "  Uc@Ӣ p '@QbS!@z`S! @z #`  S@z!( S@z!8U#̒  U#ȀJ`S!U3S'S @ @ !@@z #Ȁ:`!U ?$ @z{ax@zx @#Ȁ`% `#Ȁڒ` #$!  *  @@c @S!@zQ@p  +p @ "S  " S< SS@z7!?` @`` @* ` @@* ` @@* ` @@S@z!@v!S@z!}?b? "b`%b*@ @_; բ`` @` @?a! @a@) #$ 2S@yߐ! ?%@@"!!@S@y͐!Т` @* ` @@* ` @@* ` @@S@y!@!S@y!?b? "b`%b*@ @^ג բ`@y!?!@y @? L`#$ p? " " * @^ p@i" ` 3f` `: +ff:? :8 3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %.3f/%.3f/%.3f ms 㿈 @ p? " " * @^G p@"U!@y c8U"@yc U"8@xc@#H`U@x"P# `#@ U@x"hp# @"@ * *  @ӑ* U@xܐ"p? " " * @^ #@`%#@#` VU# F#H@' …DUUc #\cU?@x"#@@`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set Source Route Failed Route administratively prohibited Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: 0x%08lx) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Bad ICMP type: %d 㿘`W *`@ \X ^ ^ \h ]D ]T ^ ^ ] ^ ^ ^ ^P ^p ^ ^ ^ ^ ^V@w 0 ` 1*`W @ \ \ \ \ ] ] ]4 ]4 ]4 ]4 ]4 ]4 ]4 ]$V@w!0eV@w! 0aV@w!@0]V@w!h0YV@w!0UV@w!0QV@w!0MV!H V@w"0E  "V  " VV "VV@wr"V@wn"(VV@wi"8 V@we"`V"@w` V" V@wY"07   "V VV@wM"0 @wJ"0 # V#  @wA@ܐ 0V@w;#H0V@w7#X0V@w3#p0V@w/#0 V@w+#0 V@w'#0V#@w"Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 , W@v"2`W#02`   @v  8 ?W#P2` @vݔ* W#`  @v  '@M{!W@vΐ#x '@Ms@vǐ#x  !W @v# p? " " * @[ %s (%s)㿐'D#$  DD @  D'@M>" !N@1'@M2" !X@1" TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘l `*`    *`  * X !x  X *`  * !@ @vE patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ qXJଐ  D @P"`J ଐ#\#`#d#h#l#p#t#x#|###Xb@Ġ? #"?#" @6 @ .`@ ò`@. ( #$ X@uː"Ȳ @ X#Wc@u`@&cX@u"؁<2 2 ((  `D`?usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘p"`Y@`@ِ 㿘@ Pgetcwd%s 㿘@[!Y@!Ȁ? P@a!( @ @# 2Y Y@)a@u@!@Ϥ usage: pwd 㿘p"`Y@Sbx@ϗ 㿘@Ihaltlnqd%s???halted by %srebootrebooted by %s~shutdownSIGTSTP init: %s/etc/rc.shutdown/bin/shsh%s: SIGTERM processes: %sWARNING: some process(es) wouldn't die %s%s(can't restart init): 㿘@@@)ג /`@J@ -"` Y@bЀ  D "c    +YZ @b؀?H? 2A*  i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i ix i i i i i i i i\ i id i i ip    !@@)H  `@sT Y@ܐ"` @>@sH"Y@А")Y@V D@@! "Y"D#  Y"В @R3 " Y bY# @R* " Yc@QY#Yc Y@ה0 @ @3 ?2  >@s"Y@#8 @ڒ #YcP@wP ??@+? 2  Y#hYcpcP@' @i @ ?@  ?>" D# Y"Y#>@r"p"`Ycx@%>@R% @@R  #>?@ ? b  >0p@R .  Y"`@c@>" @Ȓ ?YY#Ȱ#0@rY#@usage: %s [-nqd] 㿘D# "YY"Д#p"`[@`@ %s: 㿘'H'L'P'T'XD# HY"Y#!p"`[@a"`@"`[@a @ؐ 㿘@ dfiPRrW㿘@\  [@aD"#5[["T-D %D#D+D)D@Ѐ?=? "6*  o o o o o o o o o o o o o o o o o o o o n o n o o n o o o o o o o o o%$$c$$c%cƦ %#@a!(&*  @@@@ D@ߐ D"c@D@D@X#ȁ%s: %s%sfts_read㿘D#̀   D#  D#Ѐ@   D# 2`@ 2\ @'  #D/[-D +>@g{> 4? >*  q, qx qx p qx ql p qx qx p @q  @ "2 4c̀ "    @qz @N˒%c̀   @ < Đ@[ &   c̀ 2  4  @ <  4    D0 D0 @j  @  #  @ @s  c̀ b [#@N %"  [@&c%s: is a directory8`m 3D8!+D/>-[)D %<@ c Mc 7  ![@p #@NMJ%#   cD#Ā c\"@N<9%#Ȁ  8 @  ", 8 @  D@ # @@ "c̀ ⸀ "@N%#` ?c8`2 `@w D`<   @b ?#@ @`0   @ ?  ?c @p<@ d `@y |D  @+ tD`r ?#@ @˷`0   @ ?  ?c @6P<@ d `@? BD  @ :D`8 ?#@ @}`0   @ ?  ?c @<@ d `@ D@8  D "#[#@M@remove %s? override %s%s%s/%s for %s? 㿀D#  p"`]c@/pD#Ѐ "\ < ( T@t   "P @ @R @瀒 O [!]##\p"`]c@Ҙp@"`p!`? "`@ p!"!  ` p5p!`y ? & @`& @` `y `Y "." and ".." may not be removed㿘 ; #D@%f ? /2 *@@8J@@%X /`J@ .2 J`  .2 J` 2    ^@L~!x $c   &  usage: rm [-dfiPRrW] file ... 㿘p"`^@Fb@ʊ 㿘@Uroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] 㿘p"`^@cp"`^@c @\ route: %s: %s 㿘>"!p"`^@c "`^c@@np"`^@c@; nqdtv/dev/nullsocket㿘@ /_ /__ +F )F'F%F#G@ ?)? "*  }$ }, }, }, }, }, }, }, }, }, } }, }, } }, }, } }, }%c%#$h$$bH Րa!(&* @ȱ@G"bL@!G$"PF#  _ (@- F  @{ F"bl!G@d"P@$6"PF"l 6@_u 8@ K@ ?`'E_"*`@ ~  ~  ~      ~               ~              ~G""P@Z G""P@  @s 0 @K @ must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done xG"P > ""_֐#(F"l@ X T`@J@ -O@ `?`I` *`@ , L l \ l <F '"bF #"bF "bF "bF "b#pb`!_#>@mY"@` @nl0F "bc@ ' ''' ''  ܘ @ _d#P@ܠ2_\#h ܘ @Қ 6_O#pܦF"h  _@n3#F" _@#@n*`P +F)`bh @ `,>F"`G `M 27@G"H 22@ ,`$`F"l@@@@F#  bh @ В@` `L@C@@m  @9@m `@mݐ (@ bh D  Q(ؒ`V .E 0*@` *@`*@? `` * *D#defaultiso %s(%d) %s㿐VbԀ  "b#Ea@b!!  Ea@u .a@k  E*!Ƞ  2 Ea * `* `* `* `* `* `* `y*?`ja!*`@  8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8   '  a F#Ā ` @; @uS . E@laȀ ",`!E'@CԐ!E @uW  $, @>"@@h@ E Ȓ!a@`1E 5E Ȓ!a@S1E ȁaf %d: %s㿐 ?`m a#*`@ H H H  H H H H H H H H H H H H H H  Fa$ #Ā !?  0  ??   2:@` :``: @  2` '@CP!E"@tӔ "$, @"@$@@l E"Ȓ!a@ܔ1E E"Ȓ!ax@ϖ1E"ȁ㿐 `"Jb!*`@ ` P @ p F" F# F# F# F#   F#  F# @F# Fc"cF#Ȁ FF# "Fb"bFc 2"c @k$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐b#( 'G"P (> ""_А#(@N gF"l@u ? c 'F%V /G `@J@ -F@ `? +*  p <  T   4 < H t , | h   $ $ $ $  $ *$ $ ,$  $$D %D wdF"# F"#Fbd "bd`@ @@abh?2`@& ` ?2`@ ` ?2`@ `y ?2`@  `p ?2`@ ` @@Lf@?2`@ ` @@> Fc| V"c|?2`@ `@lK?@ې F?#  F@ @:#  @0@jE@ ?F# b@@~c0  b#8bc@b@jX%D %D F# 2%Db@j#pb@j#%D @ @? 4`F"d 2 F#| 2 ``G"D "` !>'F%F$"N@" 3 2N 2NM 􀢠"N`  `"T`@ç ߲`N g>@Ļ "F# 0 b#b#b#@jCM  b#@j;` F"  F#'@@Րb@j(#  b@j"#耦  " c 7 "b0 "c0 #  @hc@j ( F  *  ?#( ?* ??* ??* ? ? ???"`F$"`($*`J` ` H  *@Internal Error%s: bad value pFb 2F "bV "bFc"c?`>ee *`@ t F"F #PF#$G"F"F"pF ",eb pV ",a@}` 2F "*,  F> "!,: c| "c|  1 "?`e"*`@ t t t t t t ( t t t t t t X  t t t t #Fc$ @j ,  ,c$V""4 `4 Fc "c#@@) 44444 4  h  ߰  #Fc$ @8 ,  ,c$V" ",  `,  `,  `, Fc "c#@@ ,,,,,, , , , , ,, &   @6@   2   ,@J@ ""@,@j} @   @wsq ,,@hj "&@p /  @,@@Z? ` @a 2,@@Zِ? 2$F#|  $'@tЀ  8 @?? F"d @<   "  , @Ր '& ,@@i   p"`e`@7@{ F F& F?8(*(F ($ *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7 7 7 7 7 77 7•V " 2V`21E1f=##fc@gE6#V"ޒ@  Vf#"ؒ@  f##\#`f@g"c@f@gc1E/1E#Ȓ!2f@ܚа#ȁ*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx / / / / / / / / / / / /*   /////* /+V(`V 2V`21F1fN# gaP@fG V"@s  Vf'#"@i  f##\#`!F"6g@faXL"6 0 "6F"B :  K 0  @F",g@fax1F*",1F !2gF@Gb, actual retrieval of interface tablex ' ''' ''  ܘ @h _#P@ܠ2_ސ#h ܘ @T 6gѐ#ܢ @ got message of size %d 㷘F "bhG"H 'F@ %hl@(@f@kluwriting to routing socketroute: read from routing socket: %s 㿘G >""? @"L a c  g   F bɀ  bɐ *bɐ *Fc "cFc*`"` *`FP "P"`F#"` F"""`$"`("`, "`0"`4"`8"`<"`@ "`D$"`HF#"` @F# F " ?`` F"@bF"h h@a8F# F #P ?`` F#P@FF"h h@qa8F# F #$ ?`` F#$@*F"h h@Ua8F# G " ?`` G"@F"h h@9a8F# F "Ȁ ?`` F"Ȑ@F"h h@a8F# F "p ?`` F"p@֔F"h h@a8F#̲$ 2#F"h  @SG"H 29 F"lFc@Q  h@J!@+?) %FF##F!Gl@V"L bP @l "L@l` F>@d-"p"`h@ba` #@ F$$@ ($$J@@8FZF/i (F$"@($ 0 0 0 l 0 0F$, F4F$F F? *F$$F@ F? @ @ *@F"(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘F"h B `j@d"@0: Vb*j"p @d    2jj"@d p" V@  Tj"@c p" V@x @ 0j"  @c p" V@ڔx@v route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘    Fِ"j@c# p"`j@b@0"`k`@  "  @bMp"`k`@@ 0뀢 . L  & "  "      2  2 ?` @` ـ  ,  {k@c! X !F#Đ $#ok@c p$#Ā     ak@c "kk @bk@b p" V@xk k@b` $   Lk! @b 4 $   Lk! @b 8 $   Lk! @b < @!@# $ @  Lk@bɐ!  D!@# $   Lk@b!  $   Lk! @b , $   Lk! @b ( 0 " $@W  0"@& 0 $   Lk!(@b 0F"h " @&0?Hk@b!0!p" W@|X"? "" $" * @G  locks: inits: 㿘l@bi!#pb $!V@Z#0l@b`!b @S#0 L@   sockaddrs: %s㿘`Bl@bK"!p"W@<X"? "" $" * @Gl  #l"@b,b   ? @ p? " " * @GF p@"㿘`Y @>@ 6  , < ?`&  @  `&*@ @G  !  ?`&  @  `&*@ @G  4  8  ?`&  @ > & >*@F㿘W  " @uْ "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; %s: ipx %s; 㿀 ?`b*`m!@ , t@İm?!@6 m9! '@7m1!( 7 7 7 7 7 7@m!8 / / / / / / / / / / / /@+m!H@ap@"㿘@@    @_ `m#А *`: ? *`: ? *`: ?N 2    ,   8 *  ,`  * **".@$NetBSD: show.c,v 1.1 1996/11/15 18:01:41 gwr Exp $UGHRD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x ' ''' ''  ܘ @ n@F @ @1ܠ2n@`x @ܐ  ܘ @ 6n@E @ΐ n@`d  @+ %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐n"0#\n"8#`n"  n  @`: %-6.6s 㿘 MFX  L"X@F    $ @   ,   @  n@bp? " " * @E5 InternetXNSIPXISOX.25 %s: Protocol Family %d: 㿘?`,n#*`@ H T l x `n#xn #n #n#n# `n#n#@_link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s   Lx   "6 H F      2 `xo`@_ Y `  ` @o `6Kx)o'o Ȕ@^@а  ``;x@¨7 `o1 +R'b# zo`@^ @)o'o@`@^ 耦@ @`@^@ xFo @_0#Ā o!@_0o!@_ pn |R | Ж :*R@"` `*`R@ 􀢀 *@^Ёxresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘  @ɔ * .` *.@N p r h"  p p h r .`2 ` .` N p"N r"N hN ,2u  N T`` %`*`:  , . :2 B@]6` .`?А 6:P ,  N N C ``* 6` `, @6` 6`N V` "6`N # V` ``   `, @N V`  `$6` J\2 Є(  *@  J  ЄЅ*(8  Є Ї**8Ѐ4*@ *@㿘@\$OpenBSD: compile.c,v 1.3 1997/04/28 20:23:19 millert Exp $㿘!L@! "! @A @!LL *` @ * $ !LL! @ * $!unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )qG"X@=( `q @ -ax0     *`:     L  `*`  L #"G G@  &*  *@$ q!@dL "`$ @  $@"L  2L *`:   " L L  `*`L ,2<$ "   *`:   "  L  `"*`@ l $@L ` L  "L L  `  $L 2  q@ a ,W"J"  L@L  ` L@  L@ 2` qa@ tL`  qaL@ k`` 0Gr#*`@ ̈ , @ T Ǭ Ѐ L L ( "   *`:   "  L  `*`2` `*` * $ "$  2$ *`:   " $ L  `*`$L G  `$ q@ b@" "L  2L *`:   " L L  `*`L ;"l L G qb @LG "L  2L *`:   " L L  `*`L \ qbP@L "L  2L *`:   " L L  `*`L  qbx@L@AZ$ "L  2L *`:   " L L  `*`L  q@pbq@b$ L ?,$& @˔!?%$>@Y" qb@TG "L  2L *`:   " L L  `*`L  q@0bGq$bࠄ "L  2L *`:   " L L  `*`L $ qb@C$    *`:     L  `"*`q@$b$ @Ӑ  q@ߒc@G L  \ q@Вc@ $@L`? q@’cP?@@"L  2L *`:   " L L  `*`L ;hG$  @"L  2L *`:   " L L  `*`L ;2L O ?G q@rcp9G\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D  j'D \  t bDa D tc@8DJ S, : J@ [DD@NDDt @#c8>DJ@ \2DJ` [&`DJ@ \2 DJ`2D`#'DJ@ \2 DJ` n D .@`D 'DJ@ \ DJ` \D`'D @.@`J".@D 'D .@`DJ@  [  *@`J^*@`J]*@` ; ]6*@J[%\J.:=\` *@`J]*@ "J!` ]*@ 2J 2Jn*@`J J]2 "` RE error: %s㷐, @c &@@&  &@@D  L@A@ u@^bL@ @*"123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   m ,@`$@@ e&`&`L!&` @Ґ  \, : @ <`\2&N u#@@`N "N,@`N`    u@cP`&&` & \2,@ `" N 2u @ݒcp,@` N $@$(I,@I"Y@͒( @ u@cmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #qD J `D` J@   D`'DJ` ` DJ g"  p 9 ; 1 s "|DqD"xDmD wDgDv @Wa d&@ a&`v @La DD@[ǔ U&@` 'DJ` `D`DJ@   `'DJ` `DDJ J@  `'D @*DJ@ * v@a@;&`L D& @p!? &` >@V" qb@ D va@JD Z'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ w@`_2? w4a(c?S  w)aP?  ?q *`:    ? N `"*`?#@j@@g wax@r 0@'  +  (+?#@O   +J &@㷐 @ 'q@P( 8@ O `& J  " J `  `\" *J  " J \2 *$(̐, @ʐƢ@Ԓ unterminated regular expressionexpected context address㿐N 9 \ 06  $ /   j`2&@ x@`h&@ &@ &@@ &`x@ϒ` whitespace after %s㿘L@  q N     N  `. x@ah& @_@undefined label '%s'㿘Hx"l!L#x ?* :  :*  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 4  $  & @N &  b@\ @  2 duplicate label '%s'㿘    `,` `*`K"\@ @'x 2  @j` 2 X@&  2 @ؐ $$ $ $ $㿘 ` ,`  `,` `K"\*`@ "   2  @i` 2$   2  unused label '%s'㿘 K"\'y,` "`   @ @Y2 ``,`$OpenBSD: main.c,v 1.4 1997/01/15 23:43:12 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@G /yy"+L )L%>'L@Ḁ?M? /8Dp*  P X d |%`%!   @$py"`@a@X a!(* @L!  ` @`@ `I@  @@`@ 0@ @ZL! @ p@l"  >@S" y@b @! r%s: %s"%s" ..."㿘W#Ѐ `L  L0# L L "!L    !LFL!L  z@T`L  "`` >@Sf" z`@ LL  "`W "c L h z@v Lz * `* `* `* `* `*LL h"`LL  "`dW "cА@T`La _"aL@ #[L` nWLU"!L`"`L@lR `W"#.La "aD! L dJ@ # LJ` nWL "aLWLL  dJ  ".d  d@W # .a #a. d "da #a "d .װ stdin㿐L AL'L%Lp!)Lz# =L $% % z@Sϒ`  $!z >@R"  @`? "`@k" ?" ?L@k $@]`L!  !L& i  "ae L `"a @U  @L >" " @R^ z`@@}La "a%L'Lp!)Lz#`? "`@jѐ ?" ?%L@ks  $ $% % z@SK` $!z >@R"  @{@` 㿘@) " " "W"@"ȁ㿘@ " W"@" "́$OpenBSD: misc.c,v 1.2 1996/06/26 05:39:07 deraadt Exp $%s㿘@ >@Q" {@=ch㿘  @ؐ >@Q" {@'ch㿘L "@|@ #L$`@`sed: %lu: %s: 㿘'L'P'T'XL!p"`|@̒`p 4 !p  LL"`|`x@!p"`@)"`|@` @ $OpenBSD: process.c,v 1.2 1996/06/26 05:39:08 deraadt Exp $%s%s: %s %lu 㿀L"!)LL 1L9L5L-LL   L$! `L+L 3p7L@ "@ `?Ƒ* : `C|"@*`@ p p p X p p p p p p p p D p p p p p p  p p p p p p p p p p p p p p p p p P p p 4 T p p p p \ 4 p p  p p p   *`' *`@  *`& *` * $ $$` L "-@|!p&`  )$ % @/ ?$ " $@ lL `  ` ` @ϖ @` @Ȗ @|!p` @) @L!    @≖b@ ’  2$@ @  2@L!     @kb@  2@ @`b@ 2@ @ ?$%  @Hb 2$@L!    @7b@\@    *`' *`@T*`& *` *  $` $ @n` $  ܐ t& @) n&䀢 "k@&` 2d@`? ` & @{͔!? $`>@O" |axV` ` @ G>@O" |axF` >@`   `|a @  ''' ''`% $$ $ $%`$$$ $ 2@L` @,  @L|!a@P@`aL!    p@ᓖ@B %㿘L"   2   2  b @"+  2 L``  @  2 h   LL!@"  \ ! X  *@$ L "` 2 L``  @  2 ?   LL!@"  3 ! /  2  L!@ L"   $   2  L``  @n @  LL!` `?!  @`?\%d not defined in the RE㿀L   L 耢 L @ L"a  ~c09L  @/ L " L     k#LW?!L-LL Ȁ` !@ @"@Ζ  @A!@! @! $ !@  !` ! Ȓ  @ !  $    @Ҙ `.L Ȓ(#La $  @ ?a#La L $ !L Ȕ @s   Ȓ@a  Ȓ $ @g L  ''' ''L" `"`"` " `"""`"`"` "`"    p@ `0L 2- ` ?2  & @yՔ! ? "`  >@M" |ax\  L` `@    > @M" |axH  rstdout: %s?c L ܀@@p'L)p? ,`* @  )`,`*  @߷"`,`@*`  @NՒc"` @ = @ߟ"@fِ`L ܀@p" @ >" " @M cLL" "`܁COLUMNS\ \ \abfnrtv%03o㿐!W#䀢?2N@ߐ! " @M$#`h@  W`W"#W <"cN m %p \!(W#䀤@N[!  2$* : q @J  `\ ?`"@  `"*@ @3m 7 !?`"@ \`"*@@3X @V5N "J?`"@  `"*@ @3=  !8@N  N Wp"?`"@ $ " $*@3 p? " " * @3 p" @ >" " @L cfirst RE may not be emptyRE error: %s㿘  L 耢   `P " 耧 J? "?L!  : :L L!  L@@    L  ` Ȓ`p㿘  , q'L:` & \  ?Nq @  ?` \2  N \ &2    & Y & &  , 7 ,` ?   ?"/,` `?2` ?"$,`@` `$ "? @ @& * & &  ,`  @ @8 & , `   &   & &  ,㿘 ` @d&  & &"&  @@  & *@%s: %s㿘?'%>?N  w"!  { s" /"* + ?" @    @K  " ?"& @ "&  @K & 2N 㿘@          x p h  ` X  P H  @  8 0werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard   rprntflushbrk㿘@`J@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀'aH  %@2b  @2] `&` 2 N# @(@ N u2 N@_cH "  N <2  @_cP  @4 ? @Or `#X @'ٔ@ J #@'ϒ@  @* (N ^ @N  ? - `  *(@* ( &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 @՟a@՜agfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘!  @K@ !H!H #  b(@K3   2 @<@7"0@K$:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@S! : 'H H  'H%H@bࠒL @S  =2,@,@`b@۵L c i@_b 2Ls&  i2 L@_b 2Lf& i2L@^c 2 L@یU& $ l2 L@^c 2LH& o2 L@^ܒc 2L;&  o@^ϒc  @a*& (!H!H " @@LJ@2` @^ 2` `? @E`* @ 2@@ HH gttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@^f@illegal option -- %soption requires an argument -- %s㿈L@ -2&` &``'X`  @"2 # 2  ` "@&7@   "  &  &`"@&&@  @ 㿘  D @ז 㿘  " @0"@&   &  $$ >& $ & 㿘@I@ 6 F &  * + * - * 0 $߄C" $ "  " 㿘  D @ 㿐   '`` '``@ & 㿘 @I  @ &    ("  "  $@ ( "   "  $@" $ "   "  "  "  " 㿘 @H @G & 㿘  @0 @A  ?` #&  & 㿘@H 6 D &  `"  ""  $ g" $ "  " %d %d 㿘" D@I F%d 㿘@ @I # TIOCSETD㿐' `@  @cHTIOCSTART㿘@`n  @cTIOCSTOP㿘@`o  @cЁ x p h ` X P H @ 8 0 (  # 3 # 3 2 3 3 # @ @ @ @      -mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5 8 0 (           @ @           x p h ` X P H 8 0  -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk ! ! ! ! !x !h !` !X !P !H !@ !8 !0 !  ! !     @ @ @ @ x p h ` X P H @@ 8@ 0 (  C$ C C$ C      -xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho # # # # " " " " " " " " "@ "@ " " " "-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘    @Z: 2   ` *@&`   L&`  "|"|  @Z! 2   `*@&`  3&` !@!@  @Z 2   `$*@&`$  &`$ !! "  @Y 2   `*@&`  &`&`    tablet disc; slip disc; ppp disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ ```"" @D  @D  @D @D!@@ !@Dܒ!0@D֒!@@@D`" @Dǐ!X @T!`! 4  `!h@]@  4  `!p@R@$ 4 `!x@G@  4  `!@<@  4  `!@1@  4  `!@&@  !@@  4  `!@@ @ 4  `!@@  4  `!@@" 4 `!@@ 4 !@@4  `!@ڐ@4   `!@ΐ@4  `!@@4  `!@@(" 4 `"@@@"  4  `" @@! 4  `"(@@ @ 4  `"0@@  4  `"8@{@" 4 `"@@p@$ 4 `"H@e@( 4 `"P@Z@4  4 `"X@M@  "h@C@  4  `"p@8@  4  `"x@-@  4  `"@"@ "  4  `"@@ @"  "@ @  4  `"@@ 2  4  `"@@ @ې"(2 #4 `"@@ #!"" " 4  #"  4 """А"@4 `"@Ð@4  `"@@4  4  `"@@4   `"@@$ 4 `#@@4 @ `#@@4  `#@{@! @a# !H!H %@`@  d(@e@a` @ 2@@F 0B@C !H!H 2  d#8(#@,``@"` %@d@`@a @dޔ 2 `  @B@B` @ ڀ!#@@Bv#@@Bs(㿘!L!( @Bi!X$!(L"!,%s: %s %s %s㿘!L!(  L!a,@BR$!(@!( H @BG!!@BC  !L!@B<!( $!(%d㿘 ?  1L!  @dx&! L1 "   M* ` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1L! -aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@z'H'a"!$a!(: #a%>a(* H@Pcpa(* H@@(H@x?! e"  f a" a g" a@l]  ' c@Wa!(a(a!(*`H 'H@7  @Ȓc`@  @7c`h@쀢 `@#`` `8'H 2'['''H IH 1 8H[ 2H2 ,HJq @ `  H@@ @&@''c@7   HH`'#@R@@4H 'H     @T  @c   `g@ 쀢 @:#@X usage: stty: [-a|-e|-g] [-f file] [options] 㿘p"`@uc@B 㿘@㿘@y@u@1 㿘@ : : : : : : : : : : : : :x :p :h :` :X :P :H :@ :8 :0 :( :  : : : : 9 9  9! 9 9 9 9" 9# 9$ 9% 9&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@y@@TDb 2??. @@T;b耢 .  @=b&@?`V*`#@ ; ; ; ; ``JL@ `J@ !J` /!L@4`L!0 (!LR  %`L@"a42`?`J@ !!LJ` `@` L!0 !LR   `L`@"a4@ !L`$!4@`@(`?!4@  `$!4` @c%s: %s%s㿘 J  @ɾa0 a8@ɹ 㿘@"!L!4`$!4@` $L !4`$!4@` 2  ` a4?"a4㿘@!L!4`$!4@` #L !4`$!4@` @ a4?"a4㿘 ""L@ !4"!4@`?argument expectedclosing paren expected㿘  % b %2L!L!4`$!4@i`!4`$!4@a` &P nb0K!03LR /LLa4"a4  Yb   L!4 'L!4L!4@ #`?!4@T@@!4@" L!0 " LR  L@ !4@@ 㿘!L!4 $!4@ L!0!4`$!4``2 b?* : `y!D*`@ B B B C C C C A A A A A B B4 B\ B B@R]`?@RW@ @RR2 @R 4L  0I@@A`?@ސ@ې8@ @Ր@Ґ60  0-@ː@Ȑ4&  0#@@$  0@@&  0@ݒ @@8`  @h͒ 2n a(@h e `U#|*`@ C C C C D D D D( D0 D8 D DX D D@ DH DP D D D D D     @A8`?+ )'%#!0&($$""Ȁ  ̀  @@Z`?  < `? @ 㿘  hL"!0 "!0T @Q L  L"!0 '%s: out of range%s: bad number㿐!>$"@A< "  a`@ǥJq @ ` ଒ `'J`   J  ax@LJ ؠ @g  @g8 X@4  ؠ @gܒ  @gג8 X@&  ؠ @gȒ @gÒ8  8@< `?㿘@%s><@=!:illegal -m option format: %s㿘@ ΐ@  2 $>@;"@@#h$LbD 2MM"bD""b""b$ $ @; cp $ i$ @$   @?ߑ* :  9*   IH I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I\ I I< I$ I\ I< ; $  5 $     $ IJ`N@ : $ `@D :.@`@m$ N@ $ , 8 $    "$ #x@$ 㿘L"D`I"|%=` "` @Pz 2;@` 2*  J J J J K K0 J& TD` `?TD`6   TD`4   TD`$   TD`&  "@``2`㿘N B" @;{%s: %swrite to stderr: %s㻘 @f  >@:"#@B'%>@ؔ$ @?@:@. >@:"#@#@㿘p"`?` "@ . :  `"*@@ ޒ tset: 㿘'H'L'P'T'XH!p"`@p`А"`@q""`@p`@ 㿘 !M@+"|"|  " , M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M"| `" * M||?# @#@"| ? "? @k" # @a"  @a kbbcbsos㻐'# @sJ` #(@s`J`  @@s#0` L"< L@s#8 LM "  @s~#0 L b<?"b<Lb<  b<, :  " "b<"M " ML"<  M"|L"<"<   `*M " ML"8  M"|L"8"8   `*M " ML"@  M"|L"@"@   `*UCLCEPOPNLHDpt㿘@s!H M " || "| @s !P  Mb|b|*"b| ?"Mb|b| ?"b| !& @r!X   * & @r!`  M|  "!M"| `& "|!$"|  & `& @rѐ!h "   ?& "| >$"|@rŐ!p Mb|` ?"` @r!x Mb|` ?"`Mb|`  "` pcrsisrfif㻐'#H@r >*`@\M" ,`'#P@r  #X@r  @pDh '#`@r} #h@rw `Ґ `p"`?`"@&  " *@ p@"`@ stctchcmOOPS%s 㻐' @r> @r8p"`?`"@  " *@  @oݔh @r  @rM M"4p)%`  @p6J@ O  M"x@p)J@ O  @oh p"``@nS @oh M"Ԁ`p"`?`"@  " *@L   TERMunknownTERMCAPtset: terminal type %s is unknown termcap: %s㿘!@T#(@M "@ /  @p " #0!@8#8 " NJ /"N@Ʉ#8N ? %LN    @2%L#p!x@p  #@b`@mڔ@$ ?L>" " @7#hL"x&@ Terminal type? [%s] Terminal type? 㿘p! @%p@m`@ p"`!L ``@m0`@ma@c!8!@8P 2 !8 @m`@ΐ @@| 2*L!8 2!8 standard error: %sreset-a:d:e:Ii:k:m:np:QSrsarpanetdialupplugboardcoli|:%s%s Terminal type is %s. EraseKillInterrupt%s SHELLcshset noglob; setenv TERM %s; setenv TERMCAP ''; unset noglob; TERM=%s; TERMCAP=''; export TERMCAP TERM; 㿈@p M@b|  L>@6"U"LHMb|b|"H " " "  " " " " "  $"$ ("(@v!=4#D@@ђ / @Lq`  @7b M :"b@ؐ       !>L"<L"8L"@@z ??Ӏ F*  ] _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 ^` _8 _8 _8 _8 _8 _8 _8 _ _8 _ _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 _8 ^ _8 _8 ^ ^ _8 _8 _8 ^h _8 ^ _8 ^ \ _8 _ _8 _( _0 A"8>"@"J@ ^ "J`  ?  `"J% "J@ ^ "J`  ?  `"J%"J@ ^ "J`  ?  `"Jm$@ "H$"fc a _ ] @oZa!(&*  @@d@쀤=@o"X1M"&"@o"`!M"x$"x `h@  "x  "    77 `g@U!M"|LbH@Y ,   @ "|쀤 L :@4bh ,@2 ,>@5""p,"x@6`p"`b@k" @R " @M " @H  "@6w@쀦 @ΐ""@?@JbȀ 2"###0@6X@@6T@ %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐M"@L"X@:"0"81p"`@k@b('"@@nɒ O O  "`@k,bH0  p"`@k#bX0 p @"`bh@k0"`b@k-e^H-i^C-k^U6H-2(  "H-2  Heik2 H2 Hi" "ke"" ""  2Husage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘p"`@j`@ termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@= : 'Đ! * '!H!P'%D@rpN D@3X D`@5F"?`"@ : " :*@h %q#8!p@EahN   N "N倢 E*  hP i4 i4 i4 i4 h\ hp h i4 i4 i4 i4 h i4 i4 i4 i4 h i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 i4 h i4 h i4 h@4Ð!p@4!xHN@4!CN@4!>N@4!9N@4!4N@4!/N"?`"@  `"*@ @ǒ N "?`"@  `"*@ @ Nd "?`"@ : " :9*@ 6㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@m? @5"-M +M)M#>'M@v?V? 0O*  k k k k k k k k k k k k k k k k k k k k k k k k k k k kx k k k k k k k k k k k k k k k k k k k k k  %%b̠ b%"Y"<  @'b @b$@ya!(*` @   M@gM"Ȁ  Y"<  @"H   @ @\@ 2 `@ @/㿐@[ 2 @Y  %,` L@ Z "@f < " @, L 2 ,`%s%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCx@tے x!h@] h @Ք0 @Δ)"!p<    @h!p<    @h !p!@Q @h hbH@   M@; @ ,@ȩ @,@; :  ,@ȝ :,@% M"Ā !@2M" 2h M@jb̀ h!h@ 0ZbH@ޔ  2T "Q M"@2K , @   /7 @@  ''?'d'X'\ab X@ lcH""l?@"bY "b"# Y"  Z@"xY "bY@ "Y" ZY"x@@b0C+Zp!)Y'l%#m`LT €T f 6" ⤀ bȀ@ Z@Y"xY &"b""Y" Y" p"``Y" "c" "@!p@A"`"`cx@a-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8@?c !Y"$"!@}#( #0<  0Y"  #(#(???? ?(?0?8?@?H?P?X?@ @0Y" 2AYp"`c#0<  Y" 0Yp"`c@`%Y#2`&Y" 2#lY" 2lY" 2Y"`  sp"`c@`\Yb B @"bl#\"bl"Y" Y" #H "@Y" Y" Y" ! !* `* `* `* `* `* `*@5 !# @U!Z?"bxp"``@` @z#Y "b@"# Y"  Y!Z@"xY  "bY"  !ZY"x@b@"x0Y" pRb$"#@ Y" ll" Y" bY" bp"`` @_"lb YY"`?"bY" !@Ȑ#  @Ð#  H P#p"``@@_-Z!Z+)Y'l%1m#YL"x€c 2Y" Z⤀ "Ȁ@ Z@"x $b""?"bZ@"xY" 2 Y@~# Y@qY"? YY" F@LY"0B" 8Y" p"`@_L`XYY"  #c"  "c" "@p@R`Y" pY"  p"```@_#p"`@_cxY" @#(%s: %s: warning, name truncated 8*'Z 1"!%Y)p+@ Y@ xI ""Ȑ@T!?$#@\@x$#@{d "``@^b@L@x@#@Kא$& "@ Y " Y"  "`cb@^"     $@#@K"@"0㿘>""Y"  Y" @T=0@T*_z-z-gz.tgz.taz.zzpZ #@=a "`@ %&В@'@@Ш@@ $@J?׀ /%@=r@ "`@  .Z㿘Z !#@'# ?Y" >"  #!#  #@ Y ("b@C##@=9`8 "`#%)Y @'z@j `.@ @'m@y%"  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘!"@',cZ"Y" L .Y"  YY" k Y" fY"  YY" 2] Y" 2X Y" DYp"`c@]9Y@@<a @<a 28, , `,  `,  `,  `+, "Y"  Y" YY" bp"``@]{Yb     "bl"""@&͒c %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐Y" Y" m"Ȁ@`"m" @@x /m"Ȁ@ ` m"Ȁ@`"m" @@` /m"Ȁ@`"m" @ @P/Y?"bc  "c "#l""bH@I   bP@I  Y"m"Ȁ@`"m" @@$ $Y"  p"`bX@\u!YZ"`"`Lmc"Ȁ "cm" @  p"`b@\UY "b?p"`b@\FY "bY" ?p"`c@\2 Y "bY" Ѱ?m"Ȁ@`"m" @@ m"Ȁ@`"m" @@ * m"Ȁ@`"m" @@ * m"Ȁ@`"m" @@ *  Y" l""m"Ȁ@`"@x m"Ȁ@`"@m .mc"Ȁ "cm" @] m"Ȁ@`"m" @@N * Y"  p"`cH@[Amc"Ȁ "cm" @. m"Ȁ@`"m" @@ * Y"  p"`c`@[n??!#m#bȀ@`$#@ ??#QY" 2!Y" Y" "!# !1mm"#"Ȁ@`$# @@ڐ *  #1@V"!-mm""'#Ȁ@`$# @@ .*     #@͐#Yb  `2"b@ m"Ȁ@`"m" @ m# nY# g"c#c@H  !# m"Вc@G  2$#Z"`"`L@ r?Elc@G   Zǐ#h"`LY 8"bc@GՔ   Z""`LY ""l'""c@GĔ   YZƐ""`LY "b" Y" Y"  Y""Z! "`L"#l "bY" &# Yp"`c@ZrY"""  Yp"`c@ZbYb ? "bdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐Z`Ԁ `Y"`" @$"Y" 3?@$".?,?Y"`Y"ĀY"  #Y"  YY#(b@$YY"c" Đ"@p@@$#80""#l"`1$cl" -l??@~a  ?#$c $c@}  @* * @*` * * @*` "l@" * Y"  Z`ؕ.`#H @$u!##(#@$nb# YY"""#$b $#`#@"2 YY"""#" "cĀ`"@"#c" "@p@|#X@$8b` @`?8@~^ @?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?* @N ʒ@ *?name too shortcan't recover suffix .internal error in shorten_name㿘  @~Y"  @#]*?d2,@#,l "b?@7` '! !,? `,? `,? `,? `;,'@ئ /  @cP㰀?L 2 L 2``  `,@ `@؀ .2L`@Y#L` @!ےc%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten >""1!>"@M  " ?2 W""Y" 1"  F""@MӒ  #( )#@7Lb "Y" ##p"`a p"`a"@XTYY" >!7H!p"`a@X# p!@rV   "`@Wb@q"`H O@# OHq @  `Y pOH yp"`@Wڒb0Yb   @Dѐ"  p"``@W@2"Y "b 㿐`'` '@ݒ !<`  Y"  Yp"``@WYb Y "bY" @"%s: time stamp restored 㿘Y" l"`! Y& "  p"`a@Wp!" "@( o Y"  Yp"``@WYYb Y "bY" @"" @ Y""@DA# Y"  Yp"``@W3Yb Y "bY" @#%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@4p"`c`@WY <"b+Y@84@6 c @6cx @|@| #p@ %  /*< @ 0"`c@V˘ %b@5㿘Z Z@| "`!# "!Y@xf$#!Y" @x^$"@{㿘Y"Ȁ @z#@C"א 㿐77Z""x"#l"Y "b "Z *b"Z"?*@ @Il"Z" *@l@:l" 2 lb"bZ"*b@l@'l"##"Zlb `* "#"`2 #* l"Z"l b*@@l"Zbl"2 * @l@l"##"Zbl* "#"┑2 #* l"Z"lb*@@l"Zbl"2 * @2 @ @e M"b@ sY@)bY"@7l"Z"*@@l"Z" *@l@l" @ܐ#3lZ"!b`&b*@b2N@xN  1l"@"c"#&"ZMb `* "&"`2 #* l"Z"M b*@@Kl"ZbM"ґ2 * @l@:l"##"ZbM* "#"Б2 #* l"Z"Mb*@@l"ZbM"Б2 * @l@l"##"Zc `* "#"`2 #* l"Z" c*@@l"Zb#2 * @l@l"##"Zb* "#"2 #* l"Z"c*@@l"Zb#2 * @@c @"c 㿘Z"x@x?  @0M"bc"cbad pack level㿘? @Y!@M""-"Ȓ @y@M. Za "l "m"b "b@  l@ 6@l""""!M#l"€@ $"?MM ""M$""""M"!M1M!M@"!"܀ M""ؔ Ml"#ؑ*   "؁㿘ll␲l llll✀ @7`lmȰ] X @S  `M ` ` @6'` @/'` @('` @!'` @'` @'` @ '` @@*ɲ`'!  >l  @ ( 2㿘ZM!b"l"$?#lA?b?"@;l"b@w l? "b $b " -"# * @ @2 3  * "# * @ @2 3  * M"܀ lM"lb  €MM "bb"b㿘l "bM"  )M%ll"l"#"-"'Ml"l"/"ؓ*` @ @%"ؐ * *`@2 2@" "@ Ӑ 8 0l""@@y?"$M"䀦?$"ؑ*   %"ؔ ** 2 ?2$ %"ؓ*` @ @ %" @L @?$ $  ⸀  ⸒" @Ĕ %! M"܀ #M!Mb!"܀  ""`l"@ l"b " @ 㿘 M"耢  LXM" l5M%l"l"#"-")l'M-ؓ*` @ @&ؐ * *`@2`2@%"l" M""䀢@" "@" @8` "l""@@8 "<@ : " @ "" $%"$ؑ*   &ؔ ** 2`2"? %"    4$`l"@ " @ $%` lb@y @ `lb`  " @ %  $?$! M"܀ !M1M0"!"܀  Z؀`l"lb @> "`l"@ l"b " @ 㿘l""""YY"!"aQ!Z Ė  U Z!X T!ő*" (6 Z!X *@*   *T!*  U!<Z!̄ T"ő*" (6 Z!̒ *@*   *":U!<Z!̆ T#œ**"@ @?(  Z!̒ * @ ?*@* Q"l*```2  P ؔ Q"l.  2  `  2` !P ؔ Q"l.  2  `  2`!!P ؔ Q"l.  2  ` !2`!P ؔ Q"l.  2  ` !2`P @#! Q!X . 2 @   4@ M(0 O(0 QЅ(0M 0YY YYY "!Y(Y (㿘Q.`.`S9QSQQS) . ./ *  ....*Q.`  .`. .`SրQ.` 㿐 '      Q"l.   2 S#Q"*@* <;2 Q"l7Y5Y,Qb ,  *   , `2 . @ 2@ $* @, @jĐ  &Đ @j@Ȑ &Ȧ<Α,`CQ"lQ"n-.   . Q"l?.  "?. @ ?2@ @  2@  ?`2 !Q"lQ"%Y.  "?, *  `&@jS Đ $4`?. x  Q"j*  * 2 ,  "  *@ 2@ 6 , 㿘@``? S"#S"= "cSQ"S#, @  c "c* " , , @2   , S# 4)&`SQ" S#YYc #c* "@ "  " * 4@ *!Đ?#!Đ  Ȑ" "S# c&`S#2  :   1Q? 1QQ"/S-SS#"【%〓*`@&" "%* "%*`"@,, *@@  4@  @  ,, @ *@2 2%`_   4"S#"#Q"*` "@0㿘?       +? <0Qд.  "- .0 .0`@ 0`@ 4`H`D0`D0`H         ˴㿘?        @OQ!Ц-`   "A`  ,@@@1?2@&  ,@$`?Q""@`?   QQ""@`? ""@ `? @        `@㿘ZM"PbZO#KbZ"Ȱ Z"Q! *    Y? 4 YĒ` * @"ā㿘>@ɒ @ƒ @Ò  MZ"Q! *  @  & M"]?O#Yblock vanished㿘Y!U!Y a*l"?#@2Z@YZA"Z>"Y!Ė 2Y!Ȕ 2YaА@ "aЖ `  @p Y̒` ,  "̐@ 0( @^ P Q@ĒaXY̐ Ya@Q Z"ZbĐ `~`M"O@cY̐ YaĐ " Y@Ya̐ "aY!̱6 㿘Ya"am"Ѐ  *M".``92?T!@aM*`@  2@ O #T"> T# @*  T"> T# @*`O#@ 2Y`""*`2@YY a *Y !* +!Y! YYa"aU!Y ** +!Y" &Y!/2#Y* l"b" O#Z!̓. @@@g`  @YY!2 a@6`4@* Y!#@ Y! @ 㿘   Y! J U!m"T!Z!XU "   ,`*` @*`d@od`"-`@h$@-```T" @4`T# @*`@@@V`Z!`U!<$@@KY! Ƨ4$@C$-l used on binary file   M(  M( @ lM( l2``?0Y Y0Y?  㿘Y "a@HY. !ܒ@3!l#!ܐ"Zb `* ℐ"!ܑ2 $* l"Z"Y a*@@ l"ZbY!ܑ2 * @Y@Y. 2Y " :3!ܒ@ "YY!. ܐ 2ܒ@ #! 0`* 2 㿘Y! 1l"##"ZbY * "#"ܑ2 1* l"Z"Y a*@@l"ZbY!ܑ2 * Y! l"Z"Y a*@Y@Y2!Y"!㿘`l# "Zb* ℐ"ℑ6`* lb"bZ"*b@l@_l"Z"6`*@l@Pl"# #"Z8* "#"2`!* l"Z"8*@@/l"Zb82 * @2@5lZ"!`&*@ @  %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘m"@Z""x  *   * @`  "m"Ȁ @ *   * @*` Ґ#Pp"`$cY ` ""`p"`c8    "cZ 2  "cZ "c p"`cx@JY "b out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈  Z""x"# @֒ Z# Z# Ym" " * @  * @*`@  *  * @*` Y" Z@U  q!qm!# gY" dm" " *   * @*` *  * @*` # m@ m" " `*  ` `* *p"`aH@I @!` #?%-mm"3ll"' Ȁ@`$ @@s b &b*b@ ?@Z!@uZ# (Z !'mm"#Ȁ@@`$# @@F   .* @* @*`@ * *# *m !'m"#Ȁ@@`$# @@   .* @* @*`@ * * @*` Z"@ޒ @@!"@!Z# H# m"Ȁ@Amb ` * ` ` * * Ґ#P2/ZY" Y"  Yp"`b@I#Yb 2Z "bp"`b0@IY "bZZ"#"c ZZ"#"c ''''\ @n' D*`@  " 2'@$  ,  ?   , * ,` ? ,`8$  *,  ?@   .`,`?@,`  ?@ "? ' "@`   ,  :`":*`@ "z`@ * '? 'h @  '|-`?@L  '%@.|"-`@`@"  *.@i*  Z  @h b| #b|'@"-  "p"/ /'&4@l, "@ @ "`@ 4 %@/+`   c/    /" * @ /" * @7%@4@ ., "  " .@@4 @@.? @- @z  ?&+? @- @ z 2?a`@Z-``  @ 㿘?@iu ? x''l"l"l"[ H/`@'/ @'-1mm"l"7 "Ȁ@`% @@: *  *   % cm? `$4"Ȁ@`% @@ * [ H, @ * ` ߢ `4  $ `- ʀl@=""Ĩ :`"Ȁ@`% @@ * `[ H, @ @$4"Ȁ@`% @@ΐ * ܐ *   ' c2 `p $?4"Ȁ@`% @@ * [ H, @ * ` ݢ `$4"Ȁ@`% @@ * `%[ H, @ $@4$# @@&& % %@@j@@ @-`? `l@"" `ߢ @!l""l""l"" 㿘l"l"l" & 4#)mm"c"Ȁ@`$c @@1 *  ?# ? 4 '+mm"bȀ@`$ @@ *  ?#*@4 3 (?'+mm"bȀ@`$ @@ *  l", 24 l@'"" 4 ?l""l""l""   .    ";  ! .    ";! ! .   !";!   .   !"; 'pp#\x! !ZTZ#t*  .    "; 'hh#\x  Z[ l tt0 lph  t l  incomplete literal tree incomplete distance tree 㺐l"l"` !)mm"#"Ȁ@`$# @@J *`` `4!)mm"#"Ȁ@`$# @@0 *`` `4!)mm"#"Ȁ@`$# @@ *`` 496 $m)-m"Ȁ@`%# @@ *``#Z#, @*`@ "{4    Z#,  *    "; '#\    ) 0[ H*`@  )3mm"bȀ@`%# @@ *`@ # *  ' 4$@  . ";t  ) ` #bȀ@`%# @@ *``  4??T. ";?? K5``8 #bȀ@`%# @@Y *``  4{?"; ??. # bȀ@`%# @@8 *``#  4Y?"; ??.   yl""l""[ l'#\!ZTZ#h 4p"`@D_`0[ p'.#\ Z[ N p"`@DE`}{0   pn  㿘l"l"  `%)mm""Ȁ@`$ @@ * @ `&? 4`%)mm""Ȁ@`$ @@ *  @ `4`?l""l`""2``@ 㿐l""l""l"" !Z$"| ""|8 "$"|l"  l⨒"?`"lb@"b 㿘>""m"Ȁ m!m"#"Ȁ@b"Ȑ $b@gu $"m"Ȁ? >" @{b"# [?`x[| (0  [ x8l m    㿘m"">"")Z!mm"% #""x@g,$ ` "Ȑ@$"m"Ȁ 2 ?@.mbȐ " "cm "Ё㿘!l" #Z@%b" "$"㿘#lb`!l"Y" #"@ blℐ ""℁㿘@f”?&@@JqJ@଄ @*@`J@㿘@³ / 2 㿘@ª . @"` _J@ ."*@@ out of memoryargc<=0㿘@ @d^ @g@ @ N  @MN @M!N .N 2@@d75 $@ @Bp 2@@1 @&@@)!@$` 3@L˒`$ N $` 2@$ %s: %s: %s 㿘p"`b@B=%s: %s: warning: %s%s 㿘Y"  p"`c@B"Yb  "b %s: %s: unexpected end of file 㿘p"`c@B >" @q#0p"`c@AT㿘p"`c@A@Z"E%2ld.%1ld%%㿘@1  @4 . "* * @]#@] ?`&@ - & -*@ϒ ?`&@  & *@@]w @Ms ’`P@A㿘@c(J output in compress .Z format not supported 㿘\  \ " p"`@AvaY""  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.x''Y"m"Ȁ@`"m" @Ԑ $\Y" ```"Y"  Yp"`’b(@AYb 2Y "bYb "b , 'p"`’bP@A Y""A m"Ȩ !!'?  #* \ !!"Ȓ @f! l",?<,<mȒ"  6 Ȑ m *  m Ȁ`? mВ@@d mmȐ@ c@"c`mȐ@Kے$, Ȓ @eؔ!!- ?@Lv$? !!'ȑ*  "À`5퀥@- ?@L_$? Y"܄ (? (?'<mДm  * @ * @ :@ @ Z,!\ 퀥!Y 2 Y Z?&Y" ",@  "Ȣl ,@,  8l  +,@3&@4 Z@d1Y 2  Z& @  ݐ&@ Z@d܀@6 ȑ-`2 l-@`D@`<Y" 2  ZbĔb"b 㿘Z`*2`Z %Z'Z!Z %+mm"#Z` & *@ 4bȀ@`$ @; % ?"$  $` ZZZ` ""` 2@ 2㿘Z` "@> 㿘Z2 Z" Z"  Bad table  * 2?ؖ  @ *`@ ؐ  27  * ؐ#@ *@ 2 "0  " * ?:@2?& + 2?.  *@ #@ +2.?:  * * 6 "  ?*@-""@`2+`??@ @ &+`* 6+`+`?3* @ +222* * + 2+`2?*@㿘E @  Y!, &, Y",   2 0>,'ZY!* 2 ` 2 @`2  `` ,    ? ,  Y!, &,Ya Y㿘    Z",@`a$,@ ",``o2 0T@Ba'ZY"-"2 *   "Ȁ ,  2`Y!y  4Z        ? @Z",@?`@"?,@`@a !Z",@`a$,@!Zb Ⰱ㿘1Y" Yv  &"-!  '   !?Yb?"bZ 2`"*`@! Z -""Ȁ .   !2`Z" 㿘Z 2`Y"*`@  Z -""Ȁ .   2`Y! ?! *@㿘#Y""㿘Z" Z" 㿘 Z`? "`Y#@.@   9"`? "`s! Z +"`#Z.@ $0?$`!Y&??* $!`? $`Y#a@.@a   "a`? $`0ρ㿘Z""x"#Z  l"#Y!Zb    !   invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘Z"  -Z %)mm"* "Ȁ@`$ @ @  %@Z m"Ȁ@`"m" @| $Z  #x Z @ Z!'/mm"+ZȀ@,``$ @\ %,```@!g#Z Za*  "  @ ' Z! Z!Z +-m,`" m"ЦcȀ@`%c @' ? ,`Z @,`Z Za*  " Z` ZZ Z: *`  `ZXZ 4 Z X(Z @ZZ*`"X (*2`ZX@*`ZZ*invalid compressed data--length error㿘Z""x"##ZZ""`Z""\Z "X*@Z Z!*`@?5Z)ZZ"\'-mb`X@b`m"!Z"\* Ȁ@`$ @ %b``$b`"X@"\b`X" "\2@ @Z" @`",3@X`,  b`b`m""\* Ȁ@`$ @a %b` $b`b`"@"\2 Z!.`@@*۲`@lZ @ℐ "lZ! .`@Z @ @+  @b`tb`"$b`nZ b;#@  J   (8  J  Zp(\( Z" *Zbp* \Zt "bp( Z" *Zp(Z\ t( " *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘\" \ #ZZ ""bt"pZ""hN - +Z "blZ""l @\# Z""lZ "blZ"h "ZJ Z"l /!\ZZ"pbt  \ @Z \Z\"t` Z""p\ " * @J@ -J` Z\`""t!\ '* @@oc !\  $ ZZ"pbt @ Z ZZZp"t@Z\ "pZ""t\" \ \ZZ"pbt2"? * @J@ -ZJ` ZZ"l \?\ "* @" Q "h\ *  @ J  -`? @  " \ * @J@ -!ZJ` -`""hZ"h    @  `="`L@  @  )Z"h @^$@ 2"h$@M2   \  \ *p"`Ȓc@@9@ !Z+"h"h $"hv\ `" L@ 3 \`V"`\ \ * ?J  - \p"`Ȓc@@9~!Z * ?p"`Ȓc@J@9p!Z"h"h $"h  )!Z\ \\"*@"`  \ *p"`ɒ`@@9J!Z"h"h $"hN :@? :!Z"h"h $"h'`  "@ ` * @J  - Z"hJ@ /!Z\ \ * @J  - \Zp"`ɒ`@@@9hZ * @Zp"`ɒ``@J@8"hZɐ "bh\` "`i !Z"h`$"h @uJ@"hJ \` "` :2J\  . p"`ɒ`@@8Η:\. : "`A :2=. J : Z"hJ@  \/" "hJ@ \" \` $"`\ \\  . p"`ɒ`@@8:\. :`" N :@? :\ "* @"Z""h. > 㿘   㿘 _HiStOrY_V1_  "    "    "  "    "  "    2  㿘 "@]M @]J@Y  @o`@ @Y  "  @1㿘@2` @Zg`"``` "` @Y`@Y ?& 㿘@Y & @澐 "`  "` "   "`  &   &  㿘  & &@    @㿘@Yk `$ " " " " " " "" &㿘   2& & 㿘@YM $ޒ ː"x& ː"0& ː"T& ː"& ː"& ̐ & ̐ ,& ː"& 㿘 ː"x@ ˄x2 ?`6?  㿘` "" ` " ` " ` " ` " ` " ` "  `  @ !˲"x@~ ː"0& & ː"T& ː"& ː"& ̐ & ̐ ,& ː"& ?ː"x@2`p`& `& ` & `& `& `& `& ` &  r㿐?@ cX @Œ˒b @\  @ @.@€.@ @w%s㿘 @ݒ`?" @ @ #͐`@6 @ @ؐ㿘   @2 㿘   @2 㿘@[Ɛ   @[   @ 㿘@[   @[   @ 'L'P'T'X `{L͐".`@ 7L 78 6| 6 6 6 6 6\ 6d 7 7$ 7 6 6 6 6 6  €\      @O @0J&A\O<\n<y72- ''''''''' \?"``f㿘&" &",&"$"0@Z ", ,@  0 (   *  ,(  (: ,@" ,㿘 (@  , 8"@ `"`"d@  ( (*@` ,@( @ ,"& ,㿘 (" $ *" `"`"d@ ( " ("*@` ,@( @ ,"& ,*?_-.[]~=㿘q @   @!  q 2   㿘? ?0 "? *㿘   0 "  8㿘'#q@@ @2"@`@ "@ "@:`@  "`@*@@(㿘65qb@ @ @  @8@@@ @2`@`@   `@  2`2b@@:㿘"@ ""@"\&"`"@&"@"D`, (  " "D& (@v `"@  ` ` ` `&"  &" @V (&",&"(5 q "    : " :   ଐ  :  " ـ ?㿘@U$& $ @Y$ $& ( $& , $#& 0@Uߐ$&"0 @Yw$&" &"$&"( $&",&"@ $&"D $&"H@Uϐ$&"4 @Yg$ $&"<"4&"8"\&"`& 4& 8& @ & < ". D&"T?&"L@U (&"P  $" ( $" ,"" ""$""( $"",""@ $""D $""H $""<"\""`" 4" 8" @ " < "* D?""L""㿘@U $& $& 0@U"0&"0@U"4&"4@U"P&"PՐ㿘@Y "? , 0 ? N@`& (@*@`N@ 2 ( 㿘` $@ (@  ("& ( $ *& (㿐 /@В @] @ O 7    / #"*O # 4  ( $* $& , $& (" ?& (* (& ,.@?@0 .@  (`& (*@ (& ,@/O .@ ( $2 (  $ H " ( :H ("?㿘@ ,* 㿘`"X  , <  0 * <O   4 "$&"$"0 ( *@ "0"$*@[ ?  (`& (*@& 8@P) 4    <&"$"0 ( *@  <&"$"0"$*@9 < < < (`& (*@ <??& <@, 4 2 @)F  㿘 ( $@2 (  $ <rᔠ ( "4 @*` (@ &"8 ( "@& ( $*& ( 㿘 ( ,@"p  $@"  (@2 ( ?& ( < ( ,@ *  $@& (  ("4*@` ,*""8 (" , 㿘 ,& ("p 2  & ("@ "  㿘 $& ("p 2 J@q @ ` " "@ (`& (J`  2 ("@ "  `(`, `$ `("`(`$`(  `(H(`(( 㿘 ( ,@* (  < & ( , 8& ("p 2  "@ " f 㿘 ( $@2 (  $ <& ("p 2  "@ " K 㿘 ( $@(  <"@& ( $ *& ("p 2  "@ " 1 㿐@$n@ @$    㿘q @  "<  8 " , D 32 < А"@@4-  <*` * ?А& <$   0 * 4  ""$&"$"0 ( *@ "0"$*@Ԓ   (`& (*@& 8@ɐ q@"  8 <@(  (Є " <" < " 8 㿘@@        㿘@ ,`& , *@ ,*"p  $&"H 㿘 ( $@   < ( <" & ( $ *& ( 㿘@,@  㿘  㿘&"  ,*"  " $@:#"*# , $" " &"" < &"@  @@<  㿘&"  ,*" <" &"@ &" 㿘&"@&"  ,*"  _&"2"" $@#"*# , $" " &"" M "" &"    @ @  "  &"   `"@$" " $ , @U"   , $" L @h 2`""  &"   " &"@1  㿘&"@&"  ,*" C " ? " &"    "9 @:# % $ , @U_"   , $" L @ 2""  &"   `"@݀ 2 &"@" 2&" @ސ 㿘ː (J@ " $@* < $J@ 2 <? & <@ :J@ < #  $@ J@ "`@ :J@` ,@ J@   ` @ *J@& ( 㿘 ( ,@: < ,J@ 2` <? & <`@ *J@ < `  ,@ J@   ` @ *J@& ( 㻘 $* $& , $& (͒  (`& ( *@ (`& ( :*@ (`& ( *@@ ؐ@*| $* $& , $& (@ ?  㿘@Q'"! @T"V`& & @G&p"`& @t@ D@@Ӑ"@ @@ @ڐ&  㿘 @@x@ 9@@ސ[@@@ @@Q@Q㿘@!+bindtelltcsettcechotcsetty'L'P'T'X` |LԐ# .`@ SL S\ Sl S| S S S S S T Tؐ@ 0g@x0c@E0_    ?& V  * `"?$*`4Ԑ#*`@ T T0 TP Tp TԐ"' @602Ԑ"' @0*Ԑ"' @0"Ԑ"' @Ĕ0Ԑ"' @!0@Q@ 0@V0? $/.editrcrHOME㻐`%ղ! @a @R 21?@Pِ! "+?@#/@S$"@a@ta"?@.@   *?@?@t?㿈' ' @S@^耢 @ @S  ^D㿘 ( ,@ $@ Ւb@  @ð 0 @Z  ` < ( , 8& ( 㿘 ( ,@2 (  , <˖ᔖ (@ "4 @*`@ &"8 (;"  ( , 8& ( 㿘"8"4@"" "8"4"  ,  0 * ( &"< ("8"4" "4, `"8@* @ < "& (  $"4*@` ,*""8 $" , $" ( 㿘"< 2"<)  (  "4 *@"< `&"8 ("  "<"4*@` (* &"8"<" "<& ( "<""<  ( "4*@"< ` ""8"<"4*@` (*""8 `$`(  `(H(`(( 㿘 ( ,@2 (  , < & ("p 2  "@ "  㿘 ( , <ᔖ ( :& (qkJ`@  !*`@ `* *J& ( ,8& ( 㿘 ( , <Жᔖ ( :,& (qkJ @   a*`@ `* *J :& (qlJ`@  ",*`@ `* *J& ( ,8& ( 㿘 ( , <ᔖ ( :& (qlJ`@  ",*`@ `* *J& ( ,8& (  (""<  ("<" (""<  <Є@4  " 8 <(" <  " @  4`?" 4 㿘 ( $@2 (  $ <'ᔠ$@ : & ( ,@: & ( *@  `& ( 㿘""@ s  㿘""@ k  㿘&"&"@N$&"&" 㿘@N!"&""""" 㿘" 2" $"@o# $*#"""  $ & ,"p 2N ,L $ G "" &"   `; ""  &"   `"-&" "&" $@<# $*#@Q@ $ $ & , $@("pJ 2 ,& , ,J 2 ,& , , $ *& ,"p 2 , $ & ( %d %s㿘" 2"!?  &"   " !" #@+""  &"   2" 㿘@Mh$&"&"@ 㿘@M"&"&"*"""""㿘@i"&"㿘"@key_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed 㿘N@  @+a02 " 2" @+aH0 2"@SN@&""@㿘@ "\@"X  "X@ "\ @ @key_delete: Null extended-key not allowed. 㿘J@ 2" @+Ibp? " @" Unbound extended key "%s" 㿘" 2"N@ " "*@"@   b@+㿘N@N@2``  @&  . ` `&` 2.``2N@& 㿘NN@@"`   N@ J@ "  ` 2   2 @N@$  `N@ 6 " @}&   "    0     " @Lq@M &  "0 0& @e& @L 2 @pN@&   㿘LN@@    N@J@ " ` 2 $ ``N@ 2 ` $`  ؒ 2  2 ` &$`$ @  㿘 # &    "    0    @K@L@K㿘@K * " " " " 㿘"2?N@ 2N@=( @  "@  `N` 2?" "* "* "@d `д ?Some extended keys too long for internal print buffer "%s..." 㿘 ""*@"* @)ђ`( ڒ``@)"' `2""?@k@` " "* "* "`@``` ϔ``ɔ %-15s-> %s ""[]no input㻘2 \""t0"!\ 耦!pڔ!x@l   \  20@K `\ `ږ@)[  ^( ; @q   ^( . ?,@^\ \( $ ^  \(  qH` \( \( :0( :0(  0( J*@`J2  ^* @*JGq ^ ? \` " J*J0* ,@^\2J*#  `H2* * (80* 00* 0* J J" *J** 㿘@J=!&"X@J:!&"\\ &"d\"&"h\!&"l@J.$8@%R&"t@L$8@J%!h@%L&"x@L!h Z&"|@e 㿘@J5"X&"X@J2"\&"\&"d&"h&"l@J,"t&"t@J)"x&"x"\ q H2*㿐"\"X @ /   $ @ $/ @ /   $ @ $ "p   //  @ "  "  /l @   $ @O ,@ 㿘"\"X"l"h &"p"\&"`Y @ , , ``$ @ @5 @)㿐"\"X"d&"p"\&"`>  " , ,@ ``$  ///# (J @  @emacsvi㿘@`x ʐ  @ߒ` ? %s -> %s 㻘N N "t @ܖ  20  `@'0_%-15s-> is undefined %-4s to %-7s-> %s 㷈////@ "2"t<ep @'ra01  )ܦ!p@ 2  MH!@'T0 2@@I !ڠ!`ڒ4p@'AStandard key bindings Alternative key bindings Multi-character bindings Arrow key bindings 㿘 @'b  "\ @ ?  $"\"\? @'c  "X @ v?  $"X"Xm? @&c(!  @&cH@ %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. 㷘 ?"\   R ݮ!x#J -L,  ?* :  8*  u vD vD vD v vD vD vD vD vD u v vD vD vD vD vD u u vD vD u#"X!   Z s "t`h@&p  2   `p@&cJ , 2J,  5 , ,  @   C` @,}?L`  @ @ 2 @ޒo  "k-@ ,   @$` b[    ", 0ON, @]   ݒ`@&C? :@і, @1#@d?  ݒ`@%%? @ L`   3 @  -@ N @-@@H 㿘"|` 2"x$?@G, &"x, @"t@G|*`&"t"|"x, "@"t, @*`" "t " "t "  "t, * "@"| &"| history㿐@"j @"@'@"㿘`$.?@i :",@   \ @  \#  \#, @@h  ,  2, ?J"?J\z^ Ѕ(8Fބ$( | | | | | | | | } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } |@ |H } } |x |h } } } } } } } |X } } } |p } |P } |`6 4 2 0 . , * (   JЀ* Ж??2J q଄" JJ? J#㿘'HHJ \ ^ ".HH0 TH?2.  'H . 㿘 "t@ 2   ?] (㿘"@  *` @}:`L  "&""&"߄"""""" `2""߄"""""" `? 㿘"T "!@E&"T!  㿘` "L  &"L"P* "@@F@㿐@6 " @/ "& @?."` 2"XQ  0"X@FO"X  "\&"` "Ӑ А.@?㿐 @kbL 6 !* @J 2$ *` " .@ *@J " $@7 !> ` @G ?2 .@` `" 2.@ ?.@㿐/  @B@t@" i?F"|@?"x*@€O `.. D*` x ` 8 P& <& 8@("?@֐@Ɛ& <& 8@?  , $"@@1@z& <& 8& <& 8@ f@?@@  `@&`2&@   $㿘q @J  5`  ` @3 &"" ,&" q@) " 0! @   @ ^` ?`@@ \>` `@`0>` `@ `0``0@" ("(""" H  " (( """""㿐&"&"?''Y  $"'"'L  ,* (?2""'"'"&"Ē  ,` @@  @@K H`"@$ " "@@ 4&" @ @   ,`@G@ S *`" @"&" @ o@ 㿘@ f" @ @ @Ґ@`$" @4`@ @ ?"  *?*@ @ @  `  (     *@ @  @  *  *@   *` 2J@㿀''K@   J 2J M   J 2   *J /@K 2  : 'K? 2'? *K?'+M  L 0?JK@8 M 0-* : K@2$  &@JJ@2 &@*J&@" 6  *`#@$     *KL 0-* : J@2$ &JK@2 & *J&" 6 *`"@$   *J'@ %'$%@%& P  %%%@@ P䀊 &%%%@@&䀢 %%'$%@%&@ /-" H '@ c$䀥@ P%  H%$@ ٔ%%@ Ҕǔ06+ %@ ; @ Ӓ H%@ @ %'@ @ " 0i&@ @ @ @ %@@ %@'@ @ o" 1'%@.+@$䀥$ @ Ք%  H%$@ ^ %@ VK@&@ @ %@@"%@@ :  J@*`    *  *㿘"" $ (: Hq  ( J ' *:  2 * !   2  :   "*    :  J     $ `  `*Π @@P@ ~㿘@ r  *` &  *   H@ &   & "  &" @ \ @ Z 㿘 (J  ,@,`00: q @   ``@ ?ʒ ^, :`,`: q @J   \,`<  ``0<   0 ``0@ #" "  *`(` L@& "" 㿘 P @ܒ  @w@ K H " @m 0@j" @  @  㿘@A$&"&"?&"."&" 㿘@A"&"㿈@(  @?[ 2    @<[ `?@{k㿘"㿘 D? ""p  "`"X `? (@ $" #&"#&"" "@0 $""*@@D2"&"*[]?㿐 (] < "" ,  0 Ϥ"  ] :*`<"&"" .*@ "&"" **@   , & , *]  8] 0`& , *@ L  ,`& ,] <*@"`"@ : , ,`& , *@ "" * , ,*ђ ^  "` @?`'J!D*`@ < P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P $ 0"#("&""*@  ,`& ,P*@ g  d " 4`0O ""  U M]Q I]@rM , ""  5 ( & ( , ᔠ (J@ "& ("#"&"" ( *@  ,& , (`& ( @* (@*J@& ( ,*I ,@8& (#@ L  "*`@Ԓ`@  , $@  J@  & ,*@ , $  ,*"?"  ]/"(""L [ ]2? / 8L" }O [z "2!"]J < ?#&"&"` Z2  $ , (? & ("&"" .*@ "&"" **@ ""*@ ( $@  ,@ "`@  ` 2". D쓒   `  2 $ ,& ("`@"?&""*@ ` ]@"" & (&" "= & (] ? :*`<I `  `]J < ?2``:" ` ]* <&"" `&"א  `  & ([2 ` ` "(" `㻘 ./ */ $* $& , $& (&"&  (`& ( *@ (``& ( / ?*@2F  <3*<" 2 " $* $& , $Q& (J@ .8 *6@#/" .*" ** " @ "* "  &""* "`&""* ""*@@  .*@  **@ *|"@ϔ "* @A"&". D $& ,` & (붒  0  ̐  Đ ,`& , *@ ,* 㿘 (  $' 2 & ( $    2& (N 2 0 㿘. D $`& ,`   ͒  ^ 㿘 (" $@ J@"@ 8J@2J@ $@* J@ 2& (2`& ("@ 2 (  & (U 㿘 ("` ,@ J@"`@ *J@2J@ ,@*J@ 2& (2& ("@ 2 (  & (# 㿐? '> "b *@@' @@  ]0!]@ J D D꒒  D@I ]W D]@$ D] H? ] H*`  ]`*` ?*`] D"*`@?E  @@U  @?㿐' ' '@ ' ' ' ' ' ' @@-@=  $&"] H? ?] H"*"@* ?2" @@  㿘@="&"㿐' ' '@ ' ' ' ' ' ' @?] H? ] H 8,`@>ɒ@`"",`?,`]" D @?̔ 㿐' ' '@ ' ' ' ' ' ' @?] H? ] H",  " @> , ?2"]" D @? cursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabspt㿘& P! "  ` `@  ` " & P `  P "& P`@& P \ "& PJ 2`& P \  " \J 2 ` \ x "& PJ "& P`& P \ 8  J 2  \ 4 " \J 2   \ " PJ " P  P@& P \ h " \J 2   \ "& PJ "& P & P \`T" PJ " P`p`"  PJ@ "  P@H   ?& P \`TJ `\` J@   P@- " & P㿘@:(& T@:(& d@: @& h& X@: & \ @>0 @: & ` @>* ] "a̐@M @? 㿘@: T& T@: d& d& X@: \& \@: `& `@Out of termcap string space. 㷘 \] l&@>`.`@N R$@=ݐ  @=4 X@0@`'3 T  ``"@" @  *8`J  *8` * T@<(`'& X @`p0  T X $@ῒ X & X㿘@> ` & H@4> & L@㿘 H L @9*   L6 `@@9 , $  `&@`* $& ` @9ڑ*  @9Ր , $  `&@`* $& 㿘 `& @  @9  @9֐ `& @  @9  @9Ő㿘 @ \ L@X&@ ``  \ |` J@  @'6A& @k  9&  \` " \J   4  \`h " \J  \  @@&  \ h "& J   6& %  \ h @Р & \& 㿘 @ H @`2 @ {& &@` ` \ ` `J@  @SE`1`$ P \ `"  PJ@  @@2 P `  "  ``@  `&   * @ @ @:&@ 6&   $ P \ `" PJ@   @@ &  P  >``@  0  @ &  6 &  @  & 㿘 H  N@@`  & 㿘`R P N H@J \`x " \J `4  \` " \J   \ x@. \ `"  \J@   @- \  " \J  \ !  @!в \ $` J@   @ Ё㿘~ P z Hv \` " \J 4  \`4 " \J 2 \ \ @\@Аm0T \8`/!J@ ", \( "( \J #  @ǔ & N@@`2N@ \ <`"  (J@   @ \ ( @0" \ 4`" N@J@   @!N@@ɲ`  &  \ <`" J@   @!д2 \㿘 P   \ ` J@   @u0 6  @   @& 㿘 \ "  \J   ``@W0" \`0J ` J   ``!@@! \ ` `@:!0@e @c 㿘 \ t`" J@    \ ` J@   @0@G TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. 㷀'@' @:T`'@7א ȲN@ 2 d  d @:( d@^ 40ꀢ?  @`   `@w @sa  ` P"` `" " " ``"`] l l "= ` `@ 2 `@ې! `"@@֐  `"`@ѐ  `"` @̐  `"`@  `"`@  `"`] l l " `@@Z`@  `` 4 ` P"` `` 4 ` "` ` & L ` & Hb@@= @9 @% 㿈 ` & ` &@ `h@8?  2& 2&@ `h@8ܔ耢? ꀢ 2&耢 2&@ ` @  @@  㿘 `"` P"` ``"` "`N"downleftright h    (     (    $ (( , 0  4 (8 <㿘 h ]aД  ]aؔ  8]a < (]a ,]a ]a ]b <]b ,"p 1]aє ]aٔ ]a <]a ,]a ]a ]b <]b  ,㿘 h . @7@  @"`"`  . ?㿘 h  . @ @  @"  . ?㿘 h N@ , @ @ 2  , @  @ S  $N@㿘 T W h"\ S"p 2"\"X2"d"h= , \* @ "<L 7  `A.L  "  @  `2 ,    , "2#,` , `,  ,㿘]@"á㿘]@-G!́ Your terminal has the following characteristics: It has %d columns and %d lines It has %s meta key ano It can%suse tabs not %25s (%s) == %s (empty)㻘 @=b @9b( ` bH@2 P @"" @&bp P "" @b] l l   \"-+  ` J@  bؐ@    @!  yessettc: Bad value `%s'. 㿘"? "? }] l l  @ "    b ]!! " @̒ "   M]! )@`(  ]!$:  `*  "@b  `0@+?]!$:  `* "@ϐ `@ڐ]a$ :` `*`"  ` & L ` & H2   ` ?%s %d tabsmetabaudrowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d). 㷐  p' lJ@ -2 J` s v"   "d J _@b 2]"  P  (" @@K @b 2 ]"  ` @b 2 ] b@!/ @Ԓb @Βb 2 ] ` b@ @b ]] ` b@   l$:  \* @ l l   @ ]   @L  2? bn "h+L %c  ?ۑ* :  MU*  ˨ ˨ ˨ ˨ ˨ ˠ ˨ ˨ ˠ ˨ ˨ ˨ ˠ ˠ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˠ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ˨ ` b @ L L  %`"``") ".% J KV  2J . @@J 5@=  c`@Δ J @! J  2$? @c8?@ J  2? c@ ?@_@а chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarteol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoxcaseicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonocrocrnlonlcrolcucopostimaxbelixoffixanyixoniuclcicrnligncrinlcristripinpckparmrkignparbrkintignbrk㿘  @,y!?"?!&!l!&!p!&!t!&!x!&!|!&!!&!!&!!&!!&!!&!!l&!!p&!!t&!!x&!!|&!!&!!&!!&!!&!!&!!&!@!l&!!p2   &!!t ##`?&! t!l*@&!l p &!l !p*@&!p | &!p !t*@&!t  &!t !x*@&!x  5&!x!Ѐ!$!@r!R  aR " "  a9 2*a9    aR " "  a 2*a   !l@s!   @i?2 %?!l@g!  !*@&!  &! !*@&!  &! !*@&! Đ &! !*@&! А &!!@H!9 㿘&! ."] lb@3a ]! b@3\ K:㿘@ @ *@ *` *` *` *` *` *` *` *` *` *` *` *` *` *` "*` *` !*` @*  `*  `*  `*  `*  `*  `*  ` *  ` *  ` *  ` *  `*  `*  `*  `*  `* " `* `* !㿈!9!//"\"p "X"l"h"d ]##?9@/  /*`:`* : @"$ 6O , /O"p , $O ,@ O"p ,@  ?2@㿘! 2  @+!Ā?"?!̐ ##`?&!K!&!H!l! !lB!! !l@?!@8!!@8!@1!!Ѐ!" !!t@"!&!t *@&!t  &!t!&! Ȑ*@&! Đ &!!!x@"!!@"!&!x *@&!x  &!x!&! Ԑ*@&! А &!!!l@"!!@"!&!l t*@&!l p &!l!&! *@&!  &!!!p@ !@"!p&!p *@&!p | &!p!&! *@&!  &!!p " P&!2  &!!ϒ!R  !R ! @ :  ܑ: 2   R @2*9 :  "*a9$ ܐ !ɒ!9  : 2   R @2*  :  "*a $ !l!   @gє!? &! ?㿘! 2    @g!l?"?&! 㿘! 2!> &!!&!!&!!&!!&!!&!!&!!&!!&!!&!!&! !Đ*@&!  &! !Ȑ*@&!  &!!!̐*@&!! &!!!А*@&!!  &!  @g{!Ā? &! ?㿘! "    @gh!? &! ?%s: Unknown switch `%c'. %s%s %*s%c%s %s %s: Invalid argument `%s'. 㿘  *?>`9 J@ -6J` 2J d" q a  x"       c J? J -J "J? x? ]#h#h b #@/ܑ*" *   #H * *  @ l ,* @1 l,*  p  @ `  t  `+ -`"& @1`   H@  cP@ |,`:  cX@ p  c`@ i  2  @ `cHv  ch@ W?0m"l *" * *" * *" * `^J@ + - @`]#h#h   @K "   Α,`:  + - %*` *` *  p @ " p *` * "*` *   p* " p *` *  t @  *   p* " p *` *   t* " t "@"! (""@""D""$""("0 $*"(""( ,* ""  $"", $" , $`" ("\""` ""D""@ 㿘"$ " `2  ( ( ,@`& ( (ռ  (   , @/   㿘ޒ 㿘ג  㿘 ( $@  $ <z!& ("@  ְ 㿘 ( $@  $ <a!& ("@  ֗ 㿘 ( ,@  , <!& ("p 2  "@ " | 㿘 ( ,@  , <!& ("p 2  "@ " a 㿘 ( ,$qJ   & (l",q   "  ( (& (k!* * & (*  㿘   $" (""H ("", "" "\""` "\""` " 4 ""  ("",""$""( "\""` " 4 ""  ("",""$""( 㿘 <"\&"` 㿘 "\&"` 㿘 "\&"` "\""` (""H ("", ""  "\""` ( , " ( ,8" (   (""H ("", "" "\""` ," ( ,""H ,"", ""  㿘  㿘 ( ,@2 (  , <& ("@ 2 (  & (է 㿘 ( ,@2 (  , <& ("@ 2 (  & (Վ 㿘" l"   "  " "s  "  @.g ,  ,( ," & , & ( $$p$" $   @ ,@`, & ( ,: @ ,@`,  ,6  ,@` ,  ,(  ,"& , & ($0$ "-  & ( @. $$$ 2  & ( ,"@&   @ ,@`, $ ""H""@""D" 8", (, " 2""$""(" 4"X""` ( $" ( 㿘 8  <"@@*`  * ?А& <   $& ("@  Գ 㿘"H "  ( <" "H@ ӵ  ( <" & (  㿘Ւb=  㿘 $"4*` (@* @&"8 ( $ӑ"  $& ( 㿘  㿘  㿘" "  㿘" 2"     췐 㿐-  &"."O <  հ 㿐 2 &"."O <줖  ՚ 㿐 O <ɖ  Ո 㿐 O <쀖  v 㿘N" 2"  N" <좖  N" <e 㿘N" 2"  N" <싖  N" <N Editline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next^"_"`(`$2```"`$`"`` (`"`` ( `"`"``$"`$ 㿘@$ (#`@Ӱ$$  $ @$ ($ "@$ $  $  $  $ $ $$ "  "  " " $" 㿘@$@$ @$ @$㿘 ̢ L '  ' \ ""$ $4 $ k P $ ?, $ ? $  ?& $ *    L H  & & ? & $ `!$*`@  L  H 8&   ?& $ `!p*`@  L    y&  v&   &  *o& e& ?& $ `0!*`@ x L L   $ & $X&  $ & $ `N"H*`@ \   H  $  ?& $p  & &h f d )& ?& $ `)"ܓ*`@  L L H @1L "   `&  \*@&  `&   *@&   &  *3?   *!  " @# @"  * "  &  &  & @& &     &  @#“*`& /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐 8@̾`Hg P h-$@ Y@Ե #2,@\@`X@&  "  @\L 0 ``@]L  ` a   @\h `   @?@ @\R@% @\F@l/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@&e@"P@[ .@[2`  >"  bX@@Z =>" 9 bp@2$*;@  - b@͖0!+@#@А  @ @b @ %0@vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@  6 `n!h@ < @@ `0#@v$/@%z $px@툘 @%m@@v ;@%f@ a ,{`;!@]T @Ӓ !>" `@%L@*{@Ò 6`!h@J5 !h@C. e`e@$   `!@5@$! @$. :  4  `!@ . :  4`!*`@N` %sr%s%c/dev/%sr%s㿘&@t5>" 1 L@ /,@! a#!8@@#@Y >"  !@$ΐ#c* #@E#& >" L@ /!#!H@@Ș#@)#&$Id: logwtmp.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/log/wtmp! @  "@p А@y ؒ@u @q @@# $ $@័@#e$Id: logout.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/run/utmpp" @˔ ) А@#  $ $O؀ @$  @ȟ @Ȝ @h??@# @"Ӕ $ް @#$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@W`a@" ??@~ @~ @~  $ @" 㿈 ' ' '  @$> ?㿈 ' ' '  @$* ?㿘 o Nq`  q , * N ?а N  , , * N . * Nq @  q?Р N @ ` " N N  2 N *2 @  *` ƀ: N  =#D* : `2  `"<*`@* : 2 @: @1>ƀN ? OOPS㿘  1"*!N` !#/>!`%Nۀ M *  @                         d    X                                       0         (``%`` `c@ d 0,@  d@  0,y@ ~  0, "SQN@ N@I N@ ``` )> !@"  M `""0@ِ`` :?1,ʦ ``:41,@4 , @ /  `` ?$@* $@N`*  $#@"aa >81@ƆaTERMCAPTERMPATHHOME.termcap /usr/share/misc/termcapp"!@b"L /"@Y"@R# @!/@"$@ /,@`$@ "c" 6"@ `/$ @ )*`:   :2`,@` @ *`:   :2L@`L@  @L@  $ Т`L@  @$L  /" 'l@v 6'l0?'llp@w2l l@ϼ#-#@| :?L 2,?  l  l"a ?@B? ?㿐!@z ?㿘!@v :@ 㿈/ //!@y찒&  @@ŧ @ &@㿘=#\#\    㿘=#h#h   =#l`*` 2`@ =#h, ?, @ T"㿘a  "a *:  :: 2@   㿘   ?   b    8   b   S @ & F` @  & & `@ & :`  @   € @` €  ` : @ & F` @  & & `@ & :`z ?s #@? ?#@  2@ # @  @2   W U " . 2 * 6. 6.    @ @` @  `@ =` : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82         b 㿐`? )@  0?@ `㿐?``  0j` `D' …B' @      @, . @I  `6`@ 6  @ @>@`聩?&'` `D' …B'   @ f0`7`F' …B'   @ F  ` : #dd`B` B B#dd``BD# * 22 2@   㿐   ?   b       b   U & F`  & & `& : 8 @Ò    @`  ` :  & F`  & & `& :  ?}#@? ?#@  2@  # @  @2    f[" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f. 6 @6  ?   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘S @ & F` @  & & `@ & :`  @d   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`z ?s #@? ?#@  2@  !p @  @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     㿐U & F`  & & `& : 8 @P   @ #@ C@ `@  #@ #@ @ `#@ :   & F`  & & `& :  ?}#@? ?#@  2@  ! @  @2    f [" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f . 6 @6 ? &  @   @    $OpenBSD: setlogin.S,v 1.2 1996/08/19 08:18:11 tholo Exp $ 2 *b,@= cP㿐' `v@/㿐`w@& ?" ( " $ " "  g"  ?"  ( $$OpenBSD: swab.c,v 1.2 1996/08/19 08:34:30 tholo Exp $2":J  *@ `*@`: DJ  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $  ( + 8: " ( "$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8J2J "$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘@Oa $OpenBSD: strmode.c,v 1.2 1996/08/19 08:34:20 tholo Exp $< "$ b(" c p ? d ?" l0  - ? s ?*@` r -*@` w -*@@@`@  - @ s  x S*@`  r -*@` w -*@`  - s x S*@` r -*@` w -*@ ` "   - " t  x T*@` *@*`$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@Ӧ$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/shx!'!'' '5 '@L`@N'ܰ?  @LH$?@LD>"@t@6 @  @ @a @L.ܐ @ߒ @ܒ??$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘q @  ` - +  L@` 0 L@ x XL`` 2? 0  ?@#?@  )q/>     ?А   ?ɐ?8?2  ?? "%⸤ @< @آ`4 `&@$OpenBSD: realpath.c,v 1.2 1996/08/19 08:33:47 tholo Exp $./8!!P@0 !P !P. . @Ɵ#.#@se /@` !X@(*`J@ /"*`@MF ^>@   < (  @3$ &G>.<   @M" :>!`@@l`$ />N / N `?O @P@M $> ?"b`@aX@@LȐ > "@-0 >"@L@&>"" $OpenBSD: rand.c,v 1.2 1996/08/19 08:33:44 tholo Exp $㿘!aq!@ jbm `9 $!1 *a $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘=#L  =a!,J )=="#La!( a* @"a,J -a x"a,?,J` `",J` - =a!(`"!( x",q?=aa,"a,J`:"@@Ł 2!J =#@ -a\?!,J aaa( "a(a!$ N ?N :J@=p"`/` : >""a!,J 9=3aa!,J@ >&""aa( "a(a`x"!,N :a  :!$  @=p"``@9@ ?>a!(* @"ba x"a,aa( "a(=#@$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘>@ @  $>>> $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @ $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘>b2" $@\ 2" ?>b""b "*  "  㿘p"@㿘 @? @"㿘  @  x@''ax' ' '' 'p"@耢  ?㿘'L'P'T'X@uL㿘` ` 2 `@  > "b?`?` &``@ . :  " @ &@* `@a㿘 ? & `& @@ӑ$OpenBSD: auth_unix.c,v 1.7 1996/12/14 06:49:40 tholo Exp $authunix_create: out of memory Р@ (Jp@!Da"& & $>""$` `$``$`` & `& `& $`H@楒 H''''''0P!@T @9 24@< @0$` $@@t $`P@@&`& `& @͐0p"`@͒cH @& ?@@ps/@JE @J) @  * > ">x㿘 $ ` 㿀@ ' $``@   "@9$ @ș "  & &   '@Ȍ $ & &  & @f `$ @2 8  $ ''  @Ǹ @@ '' € @"  $ $ $@1 '@{ `@㿘 $@   @@ $  @@ǐauth_none.c - Fatal marshalling problem㿀 $`!@b @ @ 2 @a#  @$a  `@`     $ @ @@@: <  ! ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@`  @㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@7@0@% "|Z@@@ 5@@ .@ @ܘ" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #q 3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @٠ 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 @ N * @<   )q @ N@@"    2        ,    `    `    0   ` @? `    _    2 _    `_{`     {_  {  @3@  @  @u` &  `㿘 0 @ N * @  )q @ N@    2        ,    `    `    0   ` @V? `    _    2 _    `_{`     {_  {  @3@ 2@ @  @u`㿘  ى(>)' %#!$ . @"~%@"h @"I(@J@N?~@ @V @@@m@ (@^@ꀠ@@   @Z"@p&@(@ v82rm   2kf e b( 2a\ 2]X 4YT (  Q `J G(( 10>; &7(( 0(( *(( (   5>3$ @(@2 ((  ( (( 5) `     $ @ @@@: <   ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@ 1` @ +@ )`$ 㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@V@O@D "|Z@:@3@' 5@@  .@ @" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #q 3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @6 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 ( , 0 @ N @  ,@ @k@ v +q @ N@@^ "    2        ,             0  @?  `  _  `  2 _ `  _{  `  { _  {  @ߚL@ @@@@Țd`& L@ ` 㿘 ( 4 0 @ N @  ,@ @ +q @ N@    2        ,             0  @f?  `  _  `  2 _ `  _{  `  { _  {  @&L@ 2@" @@$@@d`㿘 >%' #!$ . @%"r "J) MS?~ʶ „@ b @w@"@"n 造 @  h"~@&(" 82@   2@x w@r  2r@k 2l@e 4f@_ (  \  U@P  @.  @O@@ F/@("C&> @.  @@@3/@O@/ (   5>3$ (  @ @.   ( "@@@/@@@( `㿘<"e@  @4"E@2 `( "`    "   '*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@3 a##  !@ !` @  !"`@ @'`!@Ccв@ @*?0%d㿘a## " @  "  2 "@`1" 0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @@z!S4v *`  $`@o* $` $`` 2$`@f $@$`$`$` *`" `` " H!$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @!$ H@  `?$ @:  @o @ @ ʔ `?$ $@ @ '@ 5@ $ L4"E$ D& & <"e& ( @  ` "`@;`㿘  @  @* :  |" :`" @H @:  @ |*  2@ޒ  @&J@ |!` & "@    @ c" @ " "@ X   @ " $@ J"㿘 `& @?ܑ* : `X $#*`@ x L  @ P  @ @6   D`" D  D ,  " @Ŕ @J@ ) ) ,  " H@ @`&J@ )"`@ [@  `( "`( `, "`,L @  `( "`( `0 ?"`0@ ;@ݒ 6   @- @o (@$ @ @’ `&J@ @: , J@q`  @ , :`@ @  @?֐ , :  ? {ѐ` J`q`   &@ , :  +"%  ? *"  ) {G"@& @" "@  "@ @"k "@  @" @%""@ڔ  @ $@є K@* @J@ ,`&J`q`   !@@ @d @ J@ }2 `&@    J@ }`&  @ @ @  @  @?֐ , :  ? {`  J`q`  @Ȓ 㿘 @ @  @   `&@J@   㿘   @ J@ ^ `&@:  `( "`( `, "`,  @ @  `  J@J` `@!   ` ?& @   `( "`( `0 "`0 @] 㿘  &J`\a) @ @L `& @aa)ya)a{`." `[`*`!a("( a{ a}a9a1 ~0`[0|  @dy @ t@Ip@ k D`" D  D ,  " @ @ `  J@ \J` ) \A ) ,  " H@ @ ` J@ \ J` )`)&@ʒ %?Б, `H @^` `@D`H@U @    "`H@ @ƒ ~ @:"J@ *2`& "@N @/" "@B @#"|  @ r` p`$J@ \l`$J` {h`$`&@k J ,& @qJ`   !@R@O !@ @ `  J@ \ J` }2 `.&  @ @  ` : J@ \2J` }"  &   @ @ @  `$   㿘   @! J@q @ ` ` ଀ . * ?Ж #J `J   `  @Ւ [:<:]][:>:]]㿘@Ր @  (b@  2& @ (c@   2 (@I  & @: J@ ^2`& @:J@ ]2 `&@ ] ` *] ` ] @:J@ -2 `&@ - ` *- ` -,`  "J ]"     J -J ]"@ @ : J@ ]  @:J@ -2 `&@ - ` *- ` -,` @`&J@ ]" @.   t ` ,`?,"` %q @ `@  "?@* :  @ ` * ` ,`? ` @$/  ?,  @ `@*@* `" ` * ` ?,`   " ` @ ` *@* `?,`` @@  @@@=0@[@X 㿘 @ J@ - [2  @  @ 0* :  : ="40e &  @ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0u &  @] J - ]@S @ @ @I  @ ` J@ = J` ]`G&@3 0B@  J -@ :,`J ]",`& @ J -& -@,`:`, : @@ ,`: , : :` @ ` * `   .`㿘 q  J@  `& "b  @@, 2` @J "@` @ @ 2`@ 0 @ ` * `.` L   `@@* L 㿘@K = @ `@ * ` .`㿘 @ @  @ ` :&J@ [ `J` .``&`&J@@ . @ ` J@ . J` ]`&@V , > 㿘 @   : J2J ]"  &   @  "b!0!0  @@~ 2`@J "N``@   @ 0L@ql ,qk* : * H㿐 && / ]//&& 㿘  8  q @   ɐ* : ے0@g`    4" 4,㿐 &&  ^/ / ]//&& 㿘     .2``@`, *`@ d x x x $ $ $ $ $ 0  $ $ $ $ $ $ $ " p&  "@%`   @" @C""@  @: $@ 0K "@  @" @$""@ٔ  @ $@Д `@   "@ۖ @"0@l0@b0@  "" ""  㿘 ` "`     M & 4 @’   2 @ۑ,   @,  "`   2 @͐ "` @  "`  ,   @:``  $ ` "  ``%@  @@    - @  @q:`  &   %  * . . & &  ` (    (*   *` 㿘`  *` @  (  2    @` @ @ @ @ @   *   &@>    @ `  " * :       @ `  2  㿘``@}&`` @&` @*`&` ` @ 0?@``  *?  8 `         ` 8 `          㿘  (`8? @ 2   " `4`&`4   ,@ @ 2  ǔ 2,@  $ @  $ @㿘  @c   * .` @. & 㿘      `2`@:`*`@E  `&  *`@" 㿘  ' ߐ ,  *`  "` *`H "`H *.   "  @* "    (@> "@㿘   @B.` 2&  0& 㿘 &`  @1*` &`  &`㿘  v ` >1)'%##$" @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@  &`<&`@ &`(`<`@`> @  @ *`*   ! `>     4  2 `("`(%lx.0.%x%02x㿐   7 7!"/a @@>"    @` @ @@2 @ /@a( `/@a0@1/L 2  @`@֒!8@*L@/@ʒa0@ 1"  M/υ(85@(  *   J ` H* *`@@  1/@ # #@ .@ :  *  . : . '. ""4`4 `4 `4 `4 ` 4 @I  24@ 4` 4` 4` 4` @ * b@0 b@+ ""4@`4``4``4``4`` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\0a@/#!#\#`0a@/!!Ք#\#`0a@.!!0aȔ@. '''@! @ h0# 0ӑ* :  KY`*   ļ ļ   ,@  ,@L@  @ 0!+` 0N 000!"!#N  L@ `" 4 @k  ,?ܐ @.8,@?@./!@㿘`    @ߒ, `4  @5&@0/ /&/㿘`@@   `@Ò .`1#А  ?*`: &? *`: ? *`: ?N   2    8  % ,   4 ( D X X p D D D ?,@` ".`,@`  ,  ,@` ,@`@*` @$@$@.`.@㿘"  @   @q    :, @c . ",   @` ` ` , :` @ ,  @ , @ 뀤,1"㿘#9`  @ 2"DА *`: ? *`: ? *`: ?N 2    ,   h t ` ʄ ʰ ʘ ʘ,@`  ,  ,@` ,@`@*#8 $@ *#8M   *` .cH *@ `*`8*@`*@` * *@#N%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈*` *   *     #\ #` #d *`  #h1c!2cX@b !`@@ 1/@ # #@ܒ .@ؒ :  *  . : . '. # #, `,  `,  `,  `,  `,  `,  `,  `,  ` , ` , ` , @a  2 ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` * @ * c@< c@7 # #,@ `,` `,` `,` `,` `,` `,` `,` `,` ` ,` ` ,` ` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\3b@@+#!#\#`3bP@+ؚ!!Ք#\#`3bh@+Ě!!3b@+ '''@! @ h4 D 0ӑ* :  KY`*   ј ѐ ѐ ј ј ј ј ј ј ј ј t t ѐ ѐ ѐ ѐ ѐ ѐ ѐ ф ф ф ф ф ф ѐ ь ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ | ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ф ф ф ф ф ф ѐ ь ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ ѐ |  ,@  ,@L@  @ 3"+` 3N 033"""#N  L@ `" 4 @=  ,?ܐ @+ ,@?@+!@㿘`    @鱒, `4  @&@/ /&/ * ?*@#d?*  @ ?*  ` #dd#`? *@0 @  `?# @㿘>@+"@+@ `  @   0耦` > @ݒ >" @+㿘=@,#`@,<=@Ē =  @   0=#` @, 0'ش  ?c   D$`  $> @ђ @#"#"#? E #@@9@, 3/@ *     *      2?@Ԙ&l @ f$@M @ &&?€Q>$`` C1c"c;" ##"/  J .  N .  2  J 02  "` b` @`*@G``Ԕ @ox"c1#  &  "b bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap>  @?ؐ@>"X@L O؀ 2 6`@  @J7 j f"_4c  b2` `2]    * 2"?"66( $6$@6$@$ #\$@|  @WD$&    `"" 2```" @ 2  $@ 㷈>  @S?@C?>"X@ټ O耢 2 6`@  J7 ' f4   b2 @$/  @WB$& V     @  Ǡ  $ِ 㿘>@*"@*>@ >  @ڒ   0>" @*㿘>@*"@* >  >" @*LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@f !" 2 7@" $""J  7""b ׀`   ԑ. 1d 0Ӱ Hd 0,`@@@``$,`N@ J d . @o@dJ@ `d@e 7J@ `7@["(7J@ . 7"0.  H@  z,  d ' H,`@?"HJ@ ,`H,`@ ``, ^  .  H@ R, @֒ /  H,`@ ``, ? L /"L O H$  ,``@̔,`*`N@ /"`  `/"N@L  N@ 2ސ$` ,` H (@ے`  @Q @L 2  2` ``  @ %s/%s/%s/%s/%s㿐!(d@`P d Pd 0)+8d d Г. @n@  !(#\#` b  @@ `1  . 1!(POSIX%s/%s/%s㻘,` Hd`0 @I +,``H 7@?b0 8@9b؀  ,`1d 0@H@]@ 0,` Hd`,`$8 @;  㿘 | x  1e8 &  d .` `(>`/``?$`   x .  ..@@(``?)?$  8dP .(.?$ Xd .(.7$ d(/$ xxe + xx+e.&&&& e(d8@  (@ '@' ( !@ @``$@ ɇ. + Ƙxʖx+. & & @  ``(@'@('``$@.΄x&҄x& "@  ``(@'@('``$@.^ e($ xeȴ . .. ' e(@@(&``$@.$ e  ఁ쀢     @"*2`㿈''  x 8'7`x*`7` #@7` `/`@6`x/ 6`x6`x`x.`@x@@@@x@x@x@x@e@/-~' % xxxxxxxx`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1"x*`1 $ #@1 (  ,/`@0`x/ 0`x0`x`x.`@%x@@„xÄxĄxńx@% 㿈e sϐ/ / / / / / / /ј''.@.`.`.`.`.`.`.`㿘e 2>   "x"|""x""|0ƒbx,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @ʒbxb@ dfhj@ln   к xи"xѶ xѴ"xҲ x"8!Ҩ"x+da (@ %@0@ .6   %@,`) 2 !2 +Ϊbx+Ϫ`x@2+Ϫbx@ *@2@2 a@@2 !@ *@+ax$+a$@"  $  &  (  *@  ,  +֪`x $  $@ 㿐 e +      + $$+ $ 㿐e ^  e (+ "? +  @ `*@"$ @  + ` ? e ( + +  *@ @ .    㿘  h l1e p&!t ֞Ee .` `(>`/``?$`   ג֐E֞ .  ..@@(``?)?$  ׸eײxְ .(.?$ ָe8ֲֶ  .(.7$ eֆ (/$ fQ + +fPטx.&&&& eePז@  (@ '@' ( !@ @``$@ ɇ. +  +֔. & & @  apap(@'@('``$@.&& "֒ @  atat(@'@('``$@.^ e׆D($ fPמE . .. ' e@@(&``$@.$ f  Xl l h   ׀ h@"h*2`㿘f X 2   """"""0 b,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @bb@ dfhj@ln    " " ׮"׬"8"+eap (@ %@0@ .6   %@,`) 2 !2 +b+`@2+b@ *@2@2 a@@2 !@ *@+תa$+תbx$@"  $  &  (  *@  ,  +` $  $@ 㿈''  ת8 תxׄ'7`*`7` #@7` `/`@6`/ 6`6``.`@@@@@@@@@e@/-~' % hעۚߖ`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1"*`1 $ #@1 (  ,/`@0`/ 0`0``.`@%@@  @% 㿈f X  / / / / / / / /ј''.@.`.`.`.`.`.`.`㿈N@ $fN` 1@/Ւ?@)G; X 2j* *  " (ϐ 2" N@ _   N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڤ  N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڢ@N #!֠ A   N  *` @*"  W 2 N !֐"@ ", @ ON` z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` : `- ң*@@*""N`  "*֠"ߐ   2C 2`2`f` , 2` ? , 2` `? @ ,  ? , * 2 ? , 2 ? , 2 ? ,  ? , * 2 ? , 2 ? ,  ? ,, 1" $OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @]$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@<6 0`㿈`2@ '`'''@4/var/run/dev.db@Hh @; 29 <  B0     @ #P @Ӕ 7P'T'X '\` X` 2 ``fb@;d`@1f"@@/dev/8B@j!袒& @92@^ `@!f" @?@ @@`@@AH @ E* , , # @c&* , , @c& ?@ )* , , # @c& * , , @c& @ 2?* . . @ےc? I @*`2`Jg" 8o-"M XO+"KL* D`H*  u2D*  !00    ** **  *  +  +  "   *"* 2 㿐M@ O?' @A@  ,`@2 8 @6  @ 8,?M@q`  / @ * 2 #` @  А `M@  @ @(, $@ ,` =/@ 3 0@ C#,` M@ g"d8 o a" m  u"iM@`` +` - =*`:  =" }  *`> @?* :  *  |                          0 8 T   t $`"Ъ``"ɪ`b II @ᡓ, $@ ,?>@6` =" + @႓, i$@ ,? X@d6`  @k, R$@ ,?M@>@M6`<=="  @I, 0$@ ,?>@+6` @1, $@ ,? X@6`5`M@  ,`,@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *   - +  X@2`2 `7 J@+-X   J@-+`8  X`8  `( `** 2   ** 2  "J@** 2 ͐ longjmp botch. 㿘 Ea8@f 㿘@@⇒%u㿘 ?* c  #N  2# #c @2r  $c@1+2&`1 # E@# @@z .  㿘 ?* c  #N  2# #c @   $c@ n2&`1 # E@o# @@H .  /bin/shsh-cx''N@ r w>K` > "bg @߬ '` @ @.?` ;K@@@@߲I K@ r2  @= @  "@= @@#(  '`@R @`'E# Ec(E0@? @+ ? " `"c($@@=???c  @ ??˰?#@J °??@ ?# @! ?E??#@!=?#@?@ ?# @! ?0??#@!(?#@?@ ?# @!  ???#@! ?#@?@?# @?#@ t??c@ٕ ?#@?#@?#@?#@?@?# @?#@! ?#@?@ ?# @  ?j#?#@ b??#@?#@?@ ?# @!  ?G?#@@ ! =?#@? ?c @ ̀@?.?#@@@@ ̀@"?#@? ?c @! @"?#@@@@! @# #? @@ @ @\ #@?#@?@ ?# @!  ?H ?#@@ ! >?#@? ?c @ ̀@?/ ?#@@@@ ̀@#?#@? ?c @! @" ?#@@@@! @2    ?# D?#@ b > "bm??#?% #\    @    , , 4 $    2J@ ? Հ =?3  @ߺ/%)@"" ` 2J@ "@ݐ 2 `$  `, `4  `? ,   2􀤠ۢ` ˀ@ߏSF ӄF @   "  ?b   @ ???#Ȣ@@Q 4 4װ?ɐ "?ch@@ ?#?c@ ?  #\  @ט ?```*` *   ?#@ ?#@* * `  * @  #\  @ߥа    , , 4 $    2Jk   @ߙ ?  ]?[?7@?#ڀ@ȔK%E@`"> "9@ J@ "3@  `@ 2" `$  `  "       ` ,  ,  ` 2  24  , 4 ? ,   2` @ށ㿘 g!<, €?  (, 㿘 @ ?@ޑ㿘!>$" @̒  "  ? @㷐`"@`"`"`~"` "`"`d    \2 2   \? 2  `  2 *`2@0@㿐 {   }  @r {@ @ 㷐@@2@`@`    )`[2  ] `" `]` "  {2` }2 ` `܀`[`  @R&@M@ [" { ,#`?` }`9``@ ] `"@`@`]`@ "' &`#``@ ,2@ ` 2@ 2@ `R&``@(@& HOME㿘 ~; (7.?   "* /" **  /*N @A J@~"(@@+ "!  @* 2 J @2@`@ 02@ `@*2@㷐$@ a  [  !  - ?"?`  [ *"?` K I  !" @D ] 2 4@ [4@ !9`7 !`4@` 4@ - ` ] 4@`4@` ]` !&`   ]!&`   ?!&` @    *@"  *4@` 4@@. "@!` 2 #"2` @  `* ` ,@ "@ K@1 㿘@@㷐 @  8 5$@2   @X € @? <: @  "Ā"% J` . . `4` @4`  @_ 6@?V @ @0@㿘` @ ` *`@v@3  2`0? 2&``` *`,&`??$&`  @ `"@@:  @ܒ@ &@` * $`@ * $@?㿘@g  ?  *  [  !  ]  -@ `@I E"L ܔ "C   >  -  @`?`2`@*`2 `  ]@ @ 2 8 ``( `" @*`2` @  ʰ @*@`?㿘 ` *   `@ؠ??2@@ؚ .㻘 M X7@:` @2` @0@㻘@* @2$@_0€㻘@ @2(@=0€    *@ `㿘@@@ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘   !@u #q #q#H @~  @S 2N `? "`@   " •? `    N  2 N " #"* #0"#0@ڐ$ N $ $ @ϐ#0"`N "`@Ð#0" " N #q#0Ma@   MN `  M ?|$ a@   MN `  M  j$ a@Δ   MN `  M  X$ a@ڼ   N `    F$ Ma@ڪ   N `    4$ Ma@ژ   N `    "$ Mb@چ   N `    $ Mb@t  N  =2 @r$ @)N oMJ  #" N #  N "  " #0"`N ""`@M 2.1#0 JA"`6`2 J\2 J ""  *`'# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@ =   /etc/ttysr㿘  "N@< 0 #N@ܒc"`@ 㿘  ! @ 8$ @ /dev/ttyr+ `O O@`p"`P'Đ 'Đ 'Đ @mT @;Ԧ   ?'T @ؔ@eA@<   ? $ @?`$ @? : . .TO`@J Ԑ 'T  @Ȑ @- p!1@v1 㿘!    @   $  `  @ ٔ "`-  * `@!%#! " @  * @$` $`@  $  * `@ & 㿘=#P   @ }  = "cP J  㿘  @G   @ 1  ā㿘@6   @ Ԁ  @X  İ 㿘@  @i  Ԁ  @?  İ /etc/groupr㿘 "P@;"## "@c"#   P@~`"`@ 㿘@ 㿘 "   㿘! @$ "## "@2"#group.byname%dgroup.bygid: ` '% 73#Ш+P  c @4 `$@   .`J #\#`P@5Y@ &'$& & P @3I耢 $"$@2P@4$@  @Իc@@Գ*'̐c$@~ 2' @ Nc`? "`@9  " y?v +rM :S  O@2 b  ^$ @3n W @ɐP Pb@} @׽Pb@4蠒2;c@A@F*'̐@5b( Đ@5b(%@5b("#"B%@|>%@2q @5nb(  " @   $@a! @5Zb(  Ā"@k @5Kb(%@5Gb("@| %2̀̀ ے  % ")"#J , ̀` *" J    ``""*" "̐  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%d%s-blocks㿐Q#Q@#Ф`"L \@} &PR" J@ J` 1QJ M"(Q k G"Q K "&! QQQ k m gQQ QQ# 1Q#! $#$1#@X" @R @X @! 1 R 0@XQ#Ȣ""1   RP@%&@ .㿘> "b@ (~ @ֈ (& `& $`& $@$$@@ fRb8@K ]?42 @ -  @O@K>@9@6`2&``@&` $@ 6`4* 2  "6`4 &` &`% `@ ؤ@Rb8@  &"  2 4 $ R"@ @ &  $  & $ "b@@җ@ҕ @ғ 㿘`&6`$`@ @@0 /@`N`A "  @`@@Δ 6`& &`&``,& 㿘 " ` @` T 2 6 @Z  " @  @N@L  $  @ ;  >" @ԟ @< $ 2  `>""? ..㿘 - $")  8`6 8@ϔ 6 4`2( 4 4?* 2   @ 6 4* 2   $ R"@ @ & >"&  6 4 6 6 6 4 2T`"  6$ @" , @" 6 "@<  " @O$ 6 4 " $! >$$@A$ @~? >"&  6 6 6 "X$  &   2 @   $$" A$  V@ѕV 2 2 8$ @  2$$ 怢 2$ @. 6 4* 2   $  R"@ @N & >"&  6 4 6 6 6 6 8 R`2  `$ 2 `J / /  $ /* & @@՞H$@A V 2?2 $@;>""$*@V 2 2  6$ 2, @ " " 6$  @  !>"@{ $"@w   2 $ 2  S@ '! " $"d$$   6 4$ >   2`8 㿘`a> D"b>"" $"2>  4  8 26   a@Ga  $!& $ T 2   J / $ @& R"@ @ @& @ 2 @  x' $   @ ?  44>"9$2 $ ` 2 ?` 0 ''܀'2'@* 26>"$6 46'>"'@  '$ " T2  `2$J / $ $  /  . T2`     @A  $ L` . L` ?`  `@m ` > `@$ `@ > @@~@=>"  $ " ? ` 4 $$ 4 2 `  6 4 6쀢  4 4$  4 47$ "  $܀" $ `    $  @ $  #4 4 $   @ $  &@ @$ @k  4 4* 2  *`2  ``$ %k @Ր @% $   @8 .䀢%2* T2   $ @n    S@!   44 $"& $ 2     44 @~8 $ `<`6   @Һ `84 d  $ `@  5>`@ 2 &`&N @   >"&` @ҕ `A  <  2) &`, &`( 6`0N`@ .2`N`A  ?`@c  2 `! 2``,"&@`R`2 6`( < ( 2     <    㿘  (&  @*` & &  `"    @  "`" 㿘 $ D@΃  @ @ $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘 @΃  㿘 a@& @Ζ & `? " @""2  @"""R26㿘 @ѳ8  8 $ ,  ` @  ?@ ?`,@>`(@> "b?@> "@u>"" : xxswufsswap ,rwrqro㻘7WW"5!! $9W;W+WW"W" ! $@wO W @uJbx E@ &$J #  @&  @ & @("   & @!b W"W"&  @ؒ†@vZ&  @ϒ†|@vQ& { m& k& i& g& & d`@b &$J #  @b&  @b&  @b U& & &  @b@v"&  @b@v& !@t`0 W@b,W"W"W"@п W@ @ @ @ @ W @]b`J  @v OA 㿘! @@   # 1!  $㿘@0 1!   $@h  $ 㿘@ #!! (  `(@Q ? /etc/fstabr㿘! "X@3% 0#X@vc(! "` >@"  㿘!! @$ fstab: : pX#'А 'X#'ؐ 'X#' '@t@ ''X#' ' @+ 㿘'L'P'T'X@<Lvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx! @Y!''Ē@$ !  @@s!'Đ@ ,J |J@ :`'   *`J@ | :*Ya@'.Ya@')Ya@'$  Y@a 2X    Y@ b X $XYb@$ : "X $XYb@'?"$(Yb @'$0Yb(@'$,Yb0@'$4Yb8@&ޔ h@ `$ 4Yb8@'͔? 4Yb@@'Ô?,@0$8$8YbH@'?28@4$<$<YbP@'?.4HYbX@'? 4JYb`@'? 4LYbh@'? 4NYbp@'? $PYbx@'u? $TYb@'k?$Yb@'a?$Y""7 `/Y""7 `/Y""7 `/Y""7 `/Y""7 `/ʢ ` a/////Ē@'2?8&&Ē@'(||& Ē@'"x? x & Ē@'t 2 t@! . . Ē@' p? s  . Ē@& h@1`\.  * :  p ,`: ?4Y""7 `/\ 0/Ē@&ߔl? l& * :  4  !W$$@eİ㿘@r@ "&@`@ Nq`   > @r㿈 2> ''   @ ? `@ 찒  @ ? !>"@$"?@{t*?@  "b x'''' @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`  @'`'` `'@ &㿐'D D@Ĕ 㿐'D D@̸ 㿘'D@D$OpenBSD: killpg.c,v 1.2 1996/08/19 08:19:27 tholo Exp $㿘 @ϐ > "b?$OpenBSD: getwd.c,v 1.4 1996/12/21 22:23:37 millert Exp $㿘@ $ 2 >@q"@zΔ#.# $OpenBSD: creat.c,v 1.2 1996/08/19 08:19:18 tholo Exp $㿘.`&@:2$1 *b,@$ *b,@$ *b,@$̈́ *b,@$< *b,@$$ *b,@$9 *b,@$ *b,@$ *b,@$ *b,@$Ä *b,@$` *b,@$R *b,@$S *b,@$ *b,@$ *b,@$ *b,@$ *b,@$8 *b,@$ *b,@$7 *b,@$ *b,@$ *b,@$ *b,@$ *b,@$ *b,@$j *b,@$  *b,@$ *b,@$ *b,@$u *b,@$d *b,@$' *b,@$Q *b,@$O *b,@$/ *b,@$ *b,@$+ *b,@${ *b,@$| *b,@$# *b,@$  *b,@$) *b,@$ *b,@$ *b,@$" *b,@$  *b,@$ *b,@$OpenBSD: sigsuspend.S,v 1.2 1996/08/19 08:18:15 tholo Exp $ o *b,@$OpenBSD: pipe.S,v 1.2 1996/08/19 08:18:07 tholo Exp $ * :"*b,@"$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B *b,@"` h`''' ''''' '$'('`'ДȲ``` >  >` ` `@ɕ "b?$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘! !ܠ?@T  0,@O  4?@H  0,libcUnknown signal: 㿘^"(@t q.  @ut @xg .` ?^@ug0@xZ .`@\ "@xu@u$OpenBSD: strtok.c,v 1.2 1996/08/19 08:34:28 tholo Exp $ 2 J!耢 2J'   "JH?!  J  !H  2*? #! 2HJ$OpenBSD: setenv.c,v 1.2 1996/08/19 08:33:48 tholo Exp $㿐N@ ="`@@"l @*6@,`  _ >" ` 2!!  !>`"@Ǝ*` $"H?! "!`@D* !>"@V,`$">",` " '  `=$ L  $@% >*` " >b* @L =  = ,   =, @,`   㿐!>@w * " `"  " @'L'P'T'X 7'@b'''_"'''@'ؔL㿀'@''' '@G耢 &@R㿘 ( > "b;?@ @2 P (     ?2 2 $? "  : @ c  0 "  < :@ c "  `"   "@: @ C 㿘<"e@' #4"E@&$  " @y  " @s  " <@m < @g@eNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N " >'@ș'`!' '>@ "@ȍ$$  `!$ $ ؔ$ : @Resolver internal errorUnknown resolver error h` "X0h`"p* /etc/servicesr㿘!h#x  h`"`@n$b$#x@+0#x>b"b㿘!h#x ">@($#x>""# ,/㿘!h#x  h`"`@mb  $#xh!!$@n!x2LY #`@lcp"."!`@lcxh, L "  " `@lch. @m8"a* 2 "`"` "" "``@kcx".  "#`N    $ @kӒcx.  2N$1"!/etc/protocolsr㿘!h#  ha!Pa@ma`$#@*#=c`"c`㿘!h# "=@$#="#`# 㿘!h#  ha!Pa@m^a`  $#h""$@m2LN #a@k{a#.""a@krah. N "  " a@kba, @l#b"`#""` ##0!aN    @$@`@k@!.  2N$@1#"/etc/networksr㿘!##8  #a#a@lc$#8@)#8>b"b㿘!##8 ">@$#8>""# 㿘!##8  #a#a@l̒c  $#8###<$@l82L^ #b@j`8#$.$c@@ܐ c@* b@jڒ`@#. N "  " b@jʒ`@, @C>$c@"`  "`$#P"`   $#!bN   @ $@`@ƞ 8. @j @.  2N$@1$#@gethostby*.getanswer: asked for "%s", got "%s"-_/㿘*& #b ( (А (:`bP@tA 2  .2  N .2 *`߰  gethostby*.getanswer: asked for "%s %s %s", got type "%s"p'''%"!   "  2  ?# @ %!'$'耢` > @\貒bT쀢 `>x %@ %"!@'"''%!"!%!" %`t"`t"   @,*@\\貒bT쀢 " @]* 2 @]* 4 @]* 2  q4 1 %@@\.$bT %@`@ť '"'@Ŝ 耦@4Ϩ @i% #&#@[$& @]/ " @y 耦@4 @i'Ԑ'"' @9 @9@9 %bc@G <%09%0|@jJ쀢  %bb 8@[貒&l @\쀢 e % %@%@`?T @ '"I'@j쀢   %bb %@G>%!@29 %@   '" '  "@'@&!@ %   ܄'%@j'"'@ "  ݐ(!%%@%! >@Ķ 耦@>@h$!'"'> @%!@N>""1%!> "b 㿘>  >@X?>@ 0 @@   @ bf㻈>  @X?`@Ւ `` >   ?"b> /"b > "b %!" " @r  . 2L@@*p2 L@q   I4L ."DL@&@> !%!@r , !'#'%!"!%a""a%`t&!"`t""> @ @>""1%!J@q   `.2 L@J@ 2J@J .&L@q`  D@q : 2L@L@ :DL@ )L .<&@>g ~!%!@q , !'#'%!"!%a& "a%`t&!"`t"& >X""J@q   D2`:. `J@ 2J@J .&>"X@' O  db@q   J; * f" y b  2 `2 @ @($ %@Ғ   ֐%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈>  @WX? @˔`eb@!  ec@!      >  / > "b>?"b  0)ec   @hB # )e #0 @h82?@e#8 #8,@ `,` `,` `,` `,` `,` `,` `,`@ >"X@` O耢  db@p   &!/%% tJ7耢 E f"9 y b 7`25`22`@ِ-  @'$%X & & @#%t%> @@  &  & >""@`` /etc/hostsr㿘!i L  if"f@h6b$ L@%B Li" P㿘!i L` i P @8 $ L# 㿐!i L if"f@hb $ L> ?i%!$@h2L2L> "b #f@f'c(.f@f c0>. @   &@<   !&@<! > @!@    %`t&!"`t"%!" " " N "  " %!"!%!"`f@eޒc0%.  !#fN    $ @eƒc0.  2N$> @ %!'$'%!@Y>""1%!㿘> @@   @ 㿘# G @f   @fy   0㿘     @Ȕ  㿘%!"!%`t" "  " $#%!" f@e?c02 ,%! 2V$@W  $@YsLL "  " g@e c" %L " , %a %"a!@{ %!@ $@`  %!)fL    @$@`@d#0,  2L$@$1%!%u.%u.%u.%uhosts.byaddrx%!!   @ * h`  @f % l '%@Ll$l#%@aha@܀  Ql> "bhosts.byname㿐%!!  @i  % p %%@p$p!%@z!ha@Κ  p> "b㿐@  .@  ` .@`.@`@ 㿘  - ) &  &   ! @ $ 6@&&@" &@@&@ &@?&  2@./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345 *`2` Ai(0     / ,( 00*$   ` ( `<0*    `(* ǔ%2.2u$㿘 $. 2. .   i@. @ݕ6㿈   . @. 2 @*? * 2  2` ( 1&"@ ϖ "@OrpheanBeholderScryDoubt?#ib@k `N@ 241i`N` $2 1i@d *#?1i Xc S` @;?#@/ @  ?#@?#@E @@A `  ?#v2@ ?#?#v?#x@ @@, @  "@ ?#?#x@@@   ?@ ?#?#x?#?#?#, @ @ *@@ 2 "@ *@@ 2 "@ *@@ 2 "@   *@ &! $*! 2. .   i@ߖ ?c  @  @?c @   *2 /hЅ(0@ 0 *   (2 *    ( * 2 *  ? * ِ *@ (`0  2(2 @2  ( `(0  @@D@"@"@  (`0  2(2 @2  ( (0  @@""@1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#jc#@ `H@ `H  *`2`*0 : * *0 @  2㿈7 .#6, 2`@@ "@ * 2  7'' 3 C, 2`@"@"@ * 2    , 2 ,.`2 &" `* 2   * 2   㿈7 / #7 , 2`@@ "@ * 2  7'' .2 % x@'q@', 2`@"@"@ * 2   .2  , 2 P 'I '.2 &" * 2   * 2  ش 㿘.:6㿘. * 2 ` * 2  `㿘. * 2 ` * 2  ` i `?* 2`$1$$#&$b!i@ b@ 䀢 &@ bԐ $b&&b"" @  $&&&"Ԗ ؀@  &`" `  $2&%&"Բ"@@6@@7 !i@ @7 @68@6@@6@6@@6@7@}耤  @6ڒ?   @ @gi @6Ŕ <   i!&"X@\`&"Xb@fl"Xp@\`@6 8@6 8@> @6@  &8b@6@   @$@6 8 @@6| @68#!&1&@ "X"X$"**`   "А $"**`   "А $"**`   "А $"**`   "А $"**`   "А $"ޔ "А`$"*` @Ք %s: 㿘@!p"`qaX@`"p"`@p"`q@a`@ѐ㿘@& 㿘? @  Ȩ Ș Ȉ x X P @ (   Ǹ Ǩ ǘ Lj p X H 0  Ƹ Ơ ƈUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @H " @@m $ib $ "b  @X 㿘i" " @p 2   2 㿘i" `" "" `@8@@62`i"" 㿘%&'#8'i$쀢` (J@ i  ?@  @"@y i""``iJ@ i  ?@g  `@i"" @^` "" %i`"`` "` `"`r!"```iJ@ i  ?@B  `@ђ" @:` "" ``iJ@ i  ?@)  `@i"" @ ` "" ` `iJ@   ?@  ` @i"" @` ii"" i"`$"`$&&# "c4: 㿐'N@  J `:'J '!s@ p&@ p& @ p "r @[& s@`p "h @[  & !s@ p& @ p "W @Z& s@`p K @Z& $r!& & & $!s@ p& @| p& @x p& i"`"/ i" &` 2& &#4 &i" & &#4 i" & i"  2& i"  2& i" 2&  master.passwd.bynamepasswd.byname`&# @h < @@!&#$ &&#,#,  &@ &$#$#$ "~i " &؀ "M#( 0&@= "ss"Ȕ"&!&&#\#`c, #(0@@#(  &$#(&"#$܀ "'@'"c(&h"c0@#, s"s"&(&0@؀ U&I"#$@p̀ @Q& J &@#, ss"Ƞ"@ЖИ@؀ $+&"$ .&@̢#, "ss"Ȱ"!i@"$@"$@ذ&"#$@3"$  $"$܀ L@*H&c8@@!'&;"#$&c8* 1&"쀢 2f"&#`"# 2/#@ ' '@ RM&"J@ + &J`  @&  & "c$ "c$&"@ 0"c$&"@= i"b$"J@ -&1&J`  @&@`Ԓ@Ồ  Ѐ`J@ L @8Հ"C Ѐ1&" __YP!+pu ' ' 1/u @ '  '1&#   # ؟   㿈i"(?'@x  i&#,#, &@ &#,sbȔ@՚耢  i@\i "b( i""( p&# @ "4  ?&  "c1&3&%&/s-s+&&#,;&&#8 2/@% ' '@͐ "J + -"0c, @]c, &"J   @(N ( @$(c, Ƞ@`M( @$(2"@ ܒ@Ԧ@`?& "(J (W Ƞ@4ؘؖ(@c0 )( "$(@$(""@$(" 7'؀ Ƞ@ؘؖ(@ic0  ( "P$(@L$((c8@c0c0*" ><"쀢 %"7J ``@2"@> ܒ@zԀ  ؀`J@  @" "@lɒ &# !&# @$#"iB""a(&c "c  &# !&# @$# i*"" 1/@ဤ  @*' 4  '@͐&#  `!&# @$#`&" %umaster.passwd.byuidpasswd.byuid`&# @~ "8 V ?vbh@W&  "c1&/&%&)&&#,9&&#8 2/@֔ ' '@~ "J + -"&, @ , &"J   @(T ( @$(3, vv"p"@ S( @$(2"@Q ̒@Ħ@ ?& "(J ( ss"Ƞ"@ȖȘ(@3#0 ,( "$(@i$(""@c$(" 'Ȁ ss"Ƞ"@ȖȘ(@#0  ( "O$(@FK$((#8@9#0#0*" ="쀢 %&6J ``@2"@ ̒@!Ā  Ȁ`J@  @& &"&# !&# @$#"i9""\(&c "c  &# !&# @$# i!"" 3/'@֔ ' '@~&#  `!&# @$#`&" 㿘&"#&"#&"#$&#( "&@&t"#(i"" 㿘 㿘&"#!&# "& @$#&"#$&#( "&@&S"#(i""/etc/pwd.db/etc/spwd.db%s: %m㿘&@ "#$ x x    @n & "c &" & x`@3i& "b 㿐&#  2l &䀢@ a"!&@e"耢 $"\ &"&"",   &"",   &b@#  &b@  &b@  &"#,   &"#,   &"#,   &"# ,   &c@  &@&c @  & "c  $OpenBSD: getnetgrent.c,v 1.5 1997/02/03 00:10:08 millert Exp $*netgroup: %m㿘@ 2&  x@ ch&  & @ P & x@ ch㿘   2 & @ʓ*` & x@ ch  & * "@㿘`  .`@ ` @*@@㿘  , @i   * 㿘 @ q    ` 2`L@  @q  J`  @   "J * :  q    ` 2 L L   L & "``&@ x@ ch@@*? & 㿘@ 2 x@ ch $ ,  ,   )    "@ @@ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀%(8 / @) @,@`@1?''8  ?y0@@8耢 .& x@ ch+ @1#@@ #2" y31y0 y0#X#h#x@"@@ <䀢    netgroup: Syntax error `%s'㿘J "g qJ@ #"b J " @       &J  2 @J (23 &z @0;?9 L  `  J@ "`&J`   `ଐ   "" @ &@ x@ch@@@*? J@  # netgroup: Cycle in group `%s'㿈i  @z"@0M0.. 1 %'5im耢   ?0 0@0 8"` &8@W㿘 ` `@h  `  @h     @g   㿈  @z"@/R Ȓ 1 F '耢 8 ?305" 2 "@U  "@N  @G@E  ʐ@7 @3 @%s.%s㿘@  x@ch xN x#``xN@ x#`{@u(%s,%s,%s)㿘{" {"`{"{@uk㿐` @J" @D @А   ,㿘ז  Ж  Ɩ   # @7{@ "NN? ,2 N`@ZА㐀  @ @ 㿘iib4`"""8#i!i8` $b4@ ""8@n"8  ""8@g"8  @`@^"8b4$"8 !(#8  @$#8/etc/netgroup.db+㿐v'i"4 !(#8  (|!   @j $#8(#8   |a[ 1 @"0@@6$ x@chiib8""4n i8" "8"@8"8 8 㿐'!(#8  (|!   @jl $#8(#8  @`|a  1 `@Ԑ@`  `  3`  2  2 @5  /   ` > "b#@l#ְ  /,@z&@0> ".#@V#$' .-- } @@|E ''>"" @|H "͠? / @i' .,,,@dz}@@ v /,  @h=b>@/ `@h2W>L` .2 `L` ?`   ``@@{ >>" ``$ @ ` @`j$&.@ &@Ҕ`2 `? /, `$ `@ǒ@e,k b "b "b@@` @d 㿘 (#D "(@("#D("#@ @("c@!(@y  $#D("#H @O# > "b?K:  J (82 J" J  JK JK@:  K:ۀ  2K K@` 㿈#\?@ %s.dbtch'''Ԁ \v?(#D @ (#@@ $ Q'(@NcD (#@ `d@$ @'$      @ 5 ~ @r~   @h "@@.&@Q@ǐ@Z@    @z &a 􀤀 @$4 @ @" ?, L  @($,@L \2 ,@,@`@ ܀$@%d@  ' > @Ұ?Ţ@,@ `J`"`#"@ 2`@  2   d @k?  :~aܔ =v  `:! L  ?$#\쀦 耦? @@;0u,?" ?2,??ʲ   `: L  $$L? :"$,$%$@%$$%@*  '> "b@b3@@$@@@@?@H$@?܀  @$@ '> "b?@0 @̰?0 @ 㿈@&''  ? "??J@ `'? &@J `? J2 JJ|: ?  ?J:|?  㿘@@㿘1(#L "(@f&#L("#T("#H("#P r㷈(cT ""cT!(#L  ((#T@Na( $#L(#D` (H !( "HU !(#L@ 8!#L "@f#L @r(cT"cT ( 0#T@N[a(( "cL0]*? qL@ @  2 `:`#(#P J? \(( "cP("#PJ? \(( "cP"#P '( `: :J \ , J  L,,  @ ȒL " @fL @הK?0%*?O J |  :*J *#\?]    &㿘  =?@j d d> "b?  :!*`:   ^2 N N`: ` x* \2t N`: `}?А   *`?N  ?А *`Z*?* :  2N *  * * * *  *  * :*?**  "  @ `dg dN :k*" `? @" "?&㿘I =3?@ d d> "b)? @ : "*@*@`? `"@  @В d dN@ :@*@`"@ ? @"@ "?&㿘 #2N@2? 0  `N@ x X `  @А *`: ?А *`:  ?@  *`: ?ɀ @$`& 㿘N@ :2``.`@`.`㿈   `2,`@d,`  @@ & ,  &  &㿘'L'P'T'XLӔ >@$!>"@$"?㿐'L'P'T'XL@!>"@$"?㿘'L'P'T'XL @)!>"@$"?㿘>@?PATH/usr/bin:/bin:.execvp: : path too long sh/bin/sh㻐  N > "b@S /  G'@;#0#8@/'@cHtL@  #P@@ $ cX@  @ ch@ @t@ /*| @k@,|>@s>" "@ <` & 6`   `,`@ 2``@** $#$$ ` @9,`>#@C@8`4> @)>> b ` "b`@ ?㿘'L'P'T'X@'ZL$ *b,@$ *b,@$ *b,@$; *b,@$Z *b,@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $ *`:`J "J $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐=J#  @    =#&=@,#`?$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "t @ @ `"m N@ "i @ߐ @('b &'@&@*K̀ kW "$''?ؠ @ܔ ''` #\@` l!؟  `` `@3n`h̐?"`h@)ఒ2#&@  &  @*@'@@  '  @@@*@!@X@+d́$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘&=#J#  = @(s! = #& $OpenBSD: ypmatch_cache.c,v 1.6 1996/12/03 08:20:06 deraadt Exp $㿐@>r(#X      2  2 @ ' @8 (#X 2$("#X  " @$  @$ @  $ @ $ @ $ " $ $  @   @    @]  i@ @- $ i#\@$  㿐(#X  ) & '$ @>(#X "  2 @] 2 @k 2 @$  2  yp_match: clnt_callX L@ " @ @`" N@ " @ @2' '@@(̀ = #@]x !k쀢 '@@  '@*Rf @s@@*@@*G[ k"$''''''ؠ @d ''` #\@` !T     `@1a̐?"`h@(@谒2#'@@  ' @,@@* =#@]  @ " !T@W@)́yp_next: clnt_callP\`  N "v @ @ `"o N@ "k @ @($d '$'@@(OĀ kY "$''?''ؠ @ޔ ''` #\@` !؟  `` `@1p`PĐ?"`h@'ఒ2#'@@  '  @@@*@$@  $  @*@!@V@)fā$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  *b,@"` $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@H, : N   *`: 2N@  2N?$OpenBSD: strsep.c,v 1.2 1996/08/19 08:34:24 tholo Exp $  J H  2* " 2HJ$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $Ȓ "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  "  JJ@`       9q;@`` @  `%  4@^Đ 2    "@  ?&  &2   @`xײ`#(,`@,"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d! "d"d"d"d!`"d"d"d"d"d!!!!!!!!!!"d"d"d"d"d"d"d"d"d"d"|!"d!"d"d"d"d!h"d"d!"d"d"d"d"d"d"d"d!"d"d!"d"d"d"d"d"d"d""!!!!p!"d"d!x"d"4!" !"d!"d!"d"d!  4@^$ 耥   ?&  C&h f d @ l2` `] ,* WТ !@6   c1  -c"* ( @ @!  @ "  c  2 @ 2" @     !@    @@]Ð  @#`    `%q  ? &  &@] m   2 `8@#`,`@#t$$%&*$"    @:$@&@] "  @ "& & @T -"? ", J>   ` ?&  &  4 @]G "` ` J? 2``"b J> " ?& `& @,  4 @] "ۀ  @J? 2 "հ,*"? &     !q` ?&  &  4@\ 2    "`    #q ?& `& @,  4@\ 2 , `  " ,$߮8!%i# Հ M* #D ()X()X)X(|((((((((()X)X)X)X)X)X)X(((((()X)X)X)X)X)X)X)X)X)X)X)X)X)X)X)X)X()X)X)X)X)X)X)X)X(((((()X)X)X)X)X)X)X)X)X)X)X)X)X)X)X)X)X(쀥`$ "$" < :-`R <-`R`` %! <  ! ?"񀤀!  =, ? &  &@\ !2s! (ݰ @>ذ `x`X @2 ,  2  : 2"8!'l"p Հ :d* +d++d+x++\+\+\+\+\+\+\+\+\+\++++++++++++++++++++++++++++++++++++++++++++ > "! ?"! = %$ 9!, ? &  &@[x !2!$5 @- `e`E@ @ ,@D  :"$j? ^      *$* !? * -  -]"?0 ]6  -* 㿘 @ 0 2 4@$$& 0& 4  @,& ,` 0@@ @&& 0& 4 ?㿘?.> 2` @` 2`0 "I?`  @) 2@?` ?6` &`&``  6` `0  ``4@& @ "@(?&@*`! ` ?6` ` "`@@( ` 2`&@`  &`<@&`8`@&`0 &`4.`B`B&@ &`㿘 @   ?6 >""8> 2 (@ (>M  A>0C>>0@@ @2 P     ?2 2 $? "  : @ d  0 "@ < :@ d@ " @`" @ "@: @ D@       "b  2 @z (ˀ$ &"d2 V  & @ 2  <   (6 & L $6 2V  >`@ >`Ȫ@ B 2$ 0 @"  P    ?2  : @ d  0 " < :@ d 0 "  :@ D 8 "@ @ d  < "@ @ d  @2( L4% L@8 L @ D4%@2 L@%@ @&$ &  0`[ @@"X& 0@ T& 0 L :   @   ?2& $&  & 0` @@"& 0@ & 0 ?ߤ@46 @YJ    & "$& @ 2 ?>`   ?2 0"? 0` @@"& 0@a & 0 &&  ?6  㿘@2& @Ē" &&@&$@@X $@@"&@&$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @. "?& D& H 㿘  4@X 2F&@ @ $&@  4  "$ 4$  Β`P 2+&@ D@S$@@X  @  @$@ 2&@ D@6 "$ $&@ D 㻈 ?$> 2 #\@/-2#\>B""#`$#d  @ > 1"b@+і6> &"b 2   ` *`@99 989 9 >  > > > "b?㿐'  >   @.>>"">""> "b N  J@ .d?`J@  .@ J .`? >@Ɛty>"2  ? @r 4i>"` >  > >`=`> "7>  䀢 2 ;>/>->@@L 4Cb =;⼀      2    2  "" `@  ֐`  @ 4> "">  ?> "b?%.*s.%.*s㻐>  @.$`>"")?`@?"N .2c @~ *; `$$@?+HOSTALIASESr㻘> @@ @ 2 {@?av @$ /'q(#`$@? dO ଐ  2LO   2Lq  L   " L C,@> Ր Lଐ   q  L  2 L )L   ଐ  L     q `L@   "`@GD$,@.$@W30@W0 H`>  d@-U>""? @= @,Ϩ>2@4 `*` * $*` a > ?$ ?''`E```?_?2]?? ѐ@/Ҙ ɰ$.2 @1' .2 @1"  `B5  ??@/  @1 .2 @1   @1   @1  #5 ` .. 2 @0 .2 @0  @0 /`2 @0` @? 5 &rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4#*`@G$HDF(HDF4HDF@HDFLHDFXHDFdHDFpF|FHDFHDFHDHDHDHDHDHDHDHDHDHDHDFHDFHDHDFFHDHDHDHDHDHDHDHDHDFHDHDHDFHDFHDHDHDHDHDHDHDGG GHDHDHDHDHDHDHDG$HDG0HDHDHDHDHDHDHDG<HDHDHDHDHDHDHDGHHDHDHDHDGTG`GlGxGGHDHDHDGHDGHDGHDGHDGHDGHDGHDGHDHDHDHDHDHDHDHDHDGHDHDHHDHDHDHDHDHDHDHHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDH H,HDHDHDHDHDHDHDH81!1!1!1!1!1}!1z!1w!1t"1q"1n"1k" 1h"(1e"01b"81_"@1\"H1Y"P1V"X1S"`1P"h1M!1J"p1G"x1D"1A"1>"1;"18"15"12"1/"1,"1)"1&"1#"1 #1#1#1# 1#(1#01#81 #@1#P1)#h@"E  !"@qo\ >5>  @ @-  @.* 2  &>"  !`?  '`@ '@ *  @!L㿘p@b;; res options: %s㿘@q"c8  > # " @ @qcH2 `? &`@ &@ * @!;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈> @)?i >"  (2 !>3 j `< j4+ c@  @p{? & & * @ >" (>?`&@ ; & ;*@ k>" "@>@pJ`  @@pB`0$@p;`8"@p4`@!@p-`H @p&`P @@p`X @p`h @p`p>" !>`x@p!?#`@o `@o`@o >" +"? & & * @q>"  "@oϒ` e@)> "  @@o`Ȁ@"   @ @+@$ @ `q@k"  " `!@,ؐ* @ԑ2 @o Т`@X"   @,Ɛ* @ʑ2 @o`" ` "? &`&*@ @"@/?# #\  ܚ$@!#\ @Κ@!#\   0 a0aH@o1㿘"㻐@@*$O ?`&@ . & .*@@㿘"Ֆ.㿘@*& @@J? ."`    .  *`㻐 ؘ$@`0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %d, dlen was %d) ?c>  @'y>@"" A$8@ɒ@+l* 2  @+g* 2  @+g @+^* 2  >" $>`@n>"   @L@n`@=@m``e *`@YZkkZ]ZZZkfZZe<_@a`e<_@`(Z_@ckidg_kcckkkdkdkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkff\f\  2w?!T@z-   ?!P$@`2a?T?!P@ "@@@  @* * ` @mY3 G?`&@  & *@\o2/C !@В`8 `5' \0@@  "?`&@ \`&*@@- ?`&@  `&*@ @? Ҁ?`&@ " & "*@L `G !@z`5% \0@? "?`&@ \`&*@@ے ?`&@  `&*@ @ƒ? Ҁ?`&@6 " 2!@2@la?`&@  & *@" ?`&@  & *@i!@@@) aH@lX@)@* a`@lM@)@ ax@lB@)@ a@l7@)w@  a@l,@)e* a@l"2 K2  @)T* a@l2 :" ?`&@  & *@"2 !@`8 `5% \0@> "?`&@ \`&*@@ ?`&@  `&*@ @˒? Ҁ?`&@ " & "*?`&@  & *@| "+ \?`&@ "`&*@@`6 `30a@>e "?`&@ \`&*@@r ?`&@  `&*@ @]? Ҁ?`&@ "`&*@@I?`&@  & *@5  ?@  `?   @  .`?` @ޒ `@(4* 4  @(/*  aȔ@j2 !!Д@j !Д@jږ !Д@jҖ2ϰ @(* 4` @'* 4  @'*  aؔ@j3 ݔ2 ?`&@  & *@Ô" ?`&@  & *@2k ?`&@  & *@~@R 2P@'a@jX F B!?!T@@v  ?!P@$@@ ϐ@|a@j=  + '   `@Ē  @?`&@ `&*@@-``, *?`&@ ) & )*@?`&@  & *@@'% * b@i2 @iےb @iՒb?X"@ @ ܖ✢ 1?!X ?@i" J?`&@  `&*@ @ 䀌 ?}@&ܐ*  @ב2 @icH @ib@ @5@bH@i@&Ð@" b@ix @&@D @inbp@&@; @iecH@&* bx@i]2 ?X"@ @ `✢ &1?!X ?@i@" J?`&@  `&*@ @A 䀌 ?@i#b(`@ib0@b@i? & & * @&b@h lhl`lXlPlHANYHESIODHSCHAOSINshs`sXsHs@s srrrrrrrrr rrx rprh r`r@ r8r rrqqqqqqqqqqxqpq`qXqHq@q8q0q qr qppppppppppxphp`p@p8p po!oo"ooooxopo`oXo0o(odonennfnn#nnlHn"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘   @12  2 2 &   2&㿘   2 2&   2)#@1Rc`2&1)#㿘   2 2&   2)#@13c`2&1)#㿘 l 㿘  initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1)&'161)+1@"#1+1)$11"1)11)1!!! 1!0!8!H1!P!X !` !h !p!#@0a#0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘 )" "* `.  `.  `.  `.  `.  `. @q= <@9 <@q6 <@2 <@q/ @+ ) # ##b@0U L 2 `  , `##c@0= L 2   `, ##c @0" L 2  2 1)`21)21)  `2,, ##c0@/1)#%ld.%.2ld㿘 2 @p   @p  `j*`@@ @ d@p d1* a@/Ҕ 㿘  @* : q `   `+ @ *`Б*: @`L@   @L@ .+ `L@q @  + Б* * `L@@  + Ж ` *  *  j!,  *j  , ja,  @C 4 * $ 㿘   (8q଄ `(`(Ѕ.8NNq ଴N2(8q଄"`) (Ѕ.8NNq ଴N2(8q଄"[`.`(Ѕ.8NN.2'NNqqЅ/ ((NЅ((Nq?иNq2 N଴N"Nq ଴N2(82\(4444444444444444444444444444444444444444444(` (.  (.  (( ' (` (( (( ((& (82@h(@LLLLLLLL4LLLL4LLL@LLLLLLLLLLLLL@LLLLLLLL4LLLL4LLL@ # ##Nq2 N`N"Nq" "`N2"㿈      ''@'@a]@ 2& `   2 쀢 2  J@ - +?`'J@ +`'Jq @ ` ",`* ?Д 'J J  ,`J .,`'Jq`  'J?Б. * J  ?'J,`@*`@*`@}s@&%b Jq @ ` ଒ @ `'J`   Jq @ ` ଒ @ `'J`   :t.@aJq @ ` ଒ @ `'J`   Jq @ ` ଒ @ `'J`   :=.@*Jq @ ` ଒ @ `'J`   Jq @ ` ଒ @ `'J`   :.@.@.`.`.`4.`4.`4.`.`5 .`5 .` 5 .` .` 4 .` 4 .` 4 .`.` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm@  @,c0/ /߰ /װ * *  *    " * *  *   " * *  *  &%"&%"" ??ڐ!   N S @m#'@}#@m <'@} <@m <@} <` W  E@m#@}#@m <@} <@m <@}{ <@mv d@}r d@|@Uj!@Mj!@E2#\j!#\#`#d#h#l#p#t#x#|##c @+j!j@j!@j@j!@㿘@n   L ." `@ &L L * 2?J? .2 %04d%02d%02d%02d%02d%02d㿈'@&`'l#`` #``#\@#`1* c``` @+` ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 `A %q'k@< ` ."6 +"3 /"0  `/   *  `@  D" А   *  @  D"  ,  .@```Ű  *(   6%* . @0 07* @` 07*6*& @* 㿘   >@ @W /"b?0123456789㿐  /N ( #@3 . @* @*`"@`#2,@  ,@2 `,@ N ް  .@.`.`.`  0123456789abcdef0123456789ABCDEF㿈 @ N :   N :p I   NB ?# @2  (@2  ",O &N:. `DN`>4,@`,@`  6 `2e + Nİ   ` 4,@`,@``@$@   % # @ * -@ @  @   㿘   >@ @$ /"b %u.%u.%u.%u㿈b  @) @(> "b %x8 @_   4`@: *  * $@#* *@@``"?''  ?,` ?  ?'' '??Ā@$''''``,`? ?Ā@''?Ā Ȑ?'Ȣ  :?#@  Đ@@ `@ 20`,, ``,  ,`Ā  ,`,`Ȗ$  . _" "* @ ,`c@)`` Đ@ 2, :, , Ȑ$ 8>@'ɐ "b %d.%d.%d.%d㿈'#\1*#( @K#(㿈 N 0   N x X2  * &'q:`ଐ   @x?*: ଐ `D` *??  *`:`N .2 N@ $@`  q   2$@?$@$@ :  @ **` ?``@  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=㿈`D # @/` @/` @/`2`/ `*`2@/ *2/ ? ?/@ 逢 ?@ ?@ ? @_ .  .  .  .`° `F //񀢀 / @* `2 / * 2` / `*`2 @?/@逢 ?@ ? @c .  .`  =c .  =. :?.?㿘  L@`Z`'#q @  2ML@`=N@0: "`  `09 ,`04o"@* .@/   f"@:`@ .@ `*`*   `  U"@:`@ .@ `*`*   F"@@ .@  @QL@```=5 L@  `  `0- +)?` q @  `=L@```=2?L@`` q @  "?L@```@ ?  + @+@  @0(@( @(     +  @  ( ( ( @     : H";j" &."  v" 㿘 * 2 2 `? 2`*  *` @ B >  @"   @@A  ?@=@ @ ?    @@{&㿈` '`'  `*`2 2 `?`7 x 8" jc k  @T XP   'q @5ک x@. @/`7`@@:1#V@. . 6@  ۶/ .6@0os"/@ Đ/ 7 @=_#@. Ȑ@/`7`@@"*@. ̐. 6@* "/ А.6@?Q!/@ Ԑ/ 7 @`& غ@. ؐ@/`7`@@"=#@. ܐ. 6@?֐#/ .6@"W5#/@ / 7 @!"@.  @/`7`@@?f!@. . 6@)P#8   .6@m !8  / 7 @=!b@  @/`7`@@0,#@@  . 6@ "Q/@ .6@:m#. / 7 @5Đ ]@. @/`7`@@ S@/ . 6@6(y"/@ .6@9#ȸ. / 7 @xs!@. @/`7`@@0#ִ@/  . 6@=5C!/@ .6@V . / 7 @*x!@. @/`7`@@?;#@/ . 6@"ٶ/@ .6@#J .  / 7 @?!B@@/`7`@@!}"@. 6@gX!".6@?yN  / 7 @)/"D@@/`7`@@#@Ȑ. 6@=Ґ#`.6@/ p/ 7 @ &ߐ"ƺ@@/`7`@@:I#@. 6@5;̐ .6@"!/ 7 @6u4 9@@/`7`@@9!@ . 6@蟐 .6@1+"e/ 7 @= H"D@7@/`7`@@ʿ#7@. 6@*#6@ .6@?$ 96/ 7 @V֐!ú@7 @/`7`@@#3 7@. 6@? }6@.6@!a!Ѹ6/ 7 @"O@7@/`7`@@?9"7@. 6@(P#6@.6@!6/ 7 @=ߐ"@7Ȑ@/`7`@@/N"57@. 6@ "6@.6@:ᴐ#6/ 7 @@& &  &  &  @~@ @%s: : %s 㿘>"@!p"`c@X` "`@Yg"`@Xc@"p"`@Xc@~0㿘'H'L'P'T'X@nH㿘'H'L'P'T'X@|H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~k* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #bӔ#k !d: >#"k!`@Y(( @E3(6'@$@*@9(6?@$k!X 2ka\ k@ "a\k!\ @E 86?@$k!X k@{@D@6?@$k!\   :,@`?  ,@`?$@* $':` % N` m `@!d@D̔86?&$`,?`@*`:`,@ϖ6?@k!X $@ '%@ &'#H' ' @9 *#@  kkkaX!\`@/ k!T@%i k!X #P @L @*? > 'А$@&'#`'ؐ 'ܐ@9 @{M/dev/log㿘 k"!\k"!X1kk"!`1k!T?23k*#D *  c@*( k!X    @.! ?&!T @D 3kaT*#@  *cD@~ ?*@{ aT&aT "c@㿘!k@{!T?$!T*"#@k d d㿈 ''@ 㿈 ' ''  @|3 8@?$ *b,@$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@; @` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@  @a` @` $OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@X @T` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@9  @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘@1$$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@1V @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘@0Ӗ$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  $(( 00             $OpenBSD: yp_bind.c,v 1.9 1997/04/29 21:25:20 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D  !@K ?e @ܒ ?>" #@ymX @yi@y_k"(?=# ""# `" @ @v2 `="#k`""(&@D "/ @zE =( #  D@46    D 2 h@v l  @z< l?& \& h  h 2? h$D@B- @J ?". h@l >" #' 'Đ'Ȑ '̐@Q ̒@ @x& h@xm@x"Ͱ @v}ɰ   А @y  /А / 'Ԑ?'ab  @o 2 @ !" @vW # 2 k  @" @vG "$'''' #\@ ÔԖDØ"耢 " p"`a@TsD  @?d& h  @//#쀢   H"Z @v V  @y  . H . I . J . K . L . M . N . O J6 X & h D@'K @. Dk"$2  : '' `? @ ?& \''Đ Hab @( \ & `@"& h \ @A ?@z"=c&"c`2&@ 㿘 ` `@& `?& \㿘 㿘=#  %=@2  2 ` `@`$@$@u0 $OpenBSD: strftime.c,v 1.6 1996/08/19 08:34:18 tholo Exp $㿘@U*"#x*`"#t@ * #x**#t&@%m/%d/%y %H:%M%H:%M:%S 㿘 ʒ#l`%2* N E O2N N`y!*`@||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||(pĬ||| |||Ř||||(PtX ||||||LĔ||L|8TlŰ||@hƠ|ǘǰ(?` "at`*   ` at`* @` at`*   h` at`*   8`'l@n d @E 0 at < !X6쀢 `  @3 0怢 `  @-  ` @' 0ڀ `@^ "  @ 0π `  @ 0Ȁ ` @ € `@^o "  @  ` @ 0 `  @ 0 !hat` ``!p at ݒ @ @ڔ 0 @ !x͒ }!``" @n*  @” 0u ` "  @ 0l ```  $ @n ```  " @^    " 5 @ 0G ```  " @m  @ 07 ` @~ 01 at u+ at o% `'l@]ђ d @i 0 `'l @b 0 l#` 2`@ l#` 2`@@v   *ct??"ct*cx"cx* N ;*#th' ' ' ' ' ' ' ' ' $' ('@Ȱ* #e*#X @]t  0,?@mn @, 㿘* #o*#g @][  0,?@mU *#g *#g ,? @ **tcx (  cx"cxt"t $OpenBSD: strdup.c,v 1.2 1996/08/19 08:34:16 tholo Exp $㿘@vZ @rѐ@uc0 㿘q   -+  L0 L x XL 0  >??X7> ??Y    #q`  ` А  . ɐ' "8?2 @  @  ??? " &⸖W> <@ F ɦ ``` '@㿐'q @  ` - +  M@` 0 M@ x XM``  0  %?%  >V T $ %D    9q7> "     ?А  T ?ɐ?M H$4?   @ ?1  1&⸖WP> = @ f% @?2 @  @  ?1#? &⸖W,> = @ F @`  #㿘`&`` ` 2@@h 2&?@`" ` @i 2? `?&`@`&@*@``  @i 2?@`"7''''@P*@?㿘 @? @$: x N  >'@t'!' '>"*@c@t$$  !$ $ ؔ$ : @1㿀@t'''' '@Yw$OpenBSD: clnt_tcp.c,v 1.14 1997/04/29 08:52:31 deraadt Exp $clnttcp_create: out of memory `@pҐ p@p͐ d2 p"`@O2b=cp "cp>"}" 2@" *` 26 @pΐ0t 6"$`  @&$ &@%k  @   =cp "cp>""?O`@s K`$`$@$` $`$` $` $` $` @D @==`L''Đ '''А`0 @&< @'g 2 `P` $`@r ``L @$`H`P ``L@`L!@'ck#$@%o$$ `@p] @pX X'H''\`L`0`  &`&`    2  "$ $&`$?&  `0`H "`$  €H "`$ `€ ğ  `$  &`$@J o`$@F  &`$f 2b      &`$W $/>>"ݪ '`'`'''@ݐ C@&Ȁ 2`$ 09@'`$`$ 2$? `€Ԁ  &`$  &`(  `$ ؐ &`$؀  $@& `$?" `$ ` @ 2g$`$ $"@("`,"`㿘  " L L@` ```" "    "  """" "  㿘   " P@q P `@ L@oQ@oOP2 ! 4 * @o? ؐ  @r+>@C!  ' 'Ш"@2`* ` * @  $@    @$b@C Ȕ"@'̒"@`'Đ'@'"@'Ē"@`''@'' ' ?`? ?  @& $@nߐ+?b " & $@& (@nҐ?؀@"@nʐ@p 2 6& ( & $?>"& ( & $㿘#> @p?$b& (& $? @$OpenBSD: clnt_perror.c,v 1.8 1997/02/10 00:51:39 millert Exp $㿘1+ +@na!& + %s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u 㿈̠w   €@!@9@q耢`W@!*`@DDD,,D`|DDDDDDDDD$@!$@/@9< $@!"@ 1@$@!&@ @9@qh  @$@&@ @9w $@!"@  @9m $@!"@ $@!"@ H@9[ . . 㿘p"`@Lax`P(`H(RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) !* 㿘p"`@Kga%s: %s - %s %s: %s 㿘=5 #p#p  "=Ԑ `!X@8t =#p#p@ !X@8c  #p!h@8X . . %s㿘p"`@KchhH0Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  * $OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $㿘@$> `@& @#ے` @#֒`  ``  @K`   l hl l#` #d #h #l > >?` d>*`  2 ` ` @ *`#㻐 $@$ @?@* 4 `@* 2  ` @]   ܤ 㻐 ! # !?@$ @@]* 4 `@X* `2 "  P'D'H'> @6? ?'>  H"$'''' < > Ā  )l >଀@6ج9>;l,`> @'-@lh $  lhDH ё* $   )4°?`l>  \   l d 2 \  @  @  % \'" \@   l"" dJ@Ғ' 'D'H' \@+ H` " 7 \@mIޠ ސ"7ޑ*  @ @q" 6-* @i'-@@* 2 ' 77޲ހ * \@m2 ސ"7ޔ*  @ "@A`!>"%""" \@lސ"7ޑ*  @ \ l d >l d  @  @  % \'``>଀ ``` ``   \@f  "-@'`` \DH@ H   /'7 \@Q '``'" \DH @ H >-@  *'@d` '؀ $''ܠ @m۔  \2 * -@ @ "   @Ƙؠ" 0e2'" a'Đ ' \ @Ԁ U' '@Π> $> > (2 DH @ 4   ?  >-@@k>" F>  " @\'s-@>  `> !l@Ill "  #hllDH 2* |$|   )4%?`l `>଀@0,`> &" @ >Ā> ="b <"b""?㿘!l \  @k?$ \l" `l" d 㿘.`` .2  ,`2 . @bA2`@S,4 . 2`@b7 @S ,`6 㿘@6 #+`$`%+?# '@Rْ4+, 4 @62 $`+ ?  22`  @ +2`#+`@R *   4`@5#+$`@Rc4 `&$` h ,2 , 2`@R@*   * 2  (, , 2  , 2  @S4c` , 2`{+2`l2 p!+ @< +  "`lr  ` ? @2r㿘!+ @< l p!/@+  @!+s!+ +@5$ +` 2 "`l p@!/@ ]4l#+)+'+% @a` @Rܒ 4`l`p2`p++ `+`l r. 6 fLOCALDOMAIN/etc/resolv.confrbfdomain lookupsearchnameserveroptionsconfRES_OPTIONSenv㻐  >`   "`>` 2> "`>` >""`> $  ,  54  $ !d<*@ $!d$!`!`(@ @j 2B@hԐ 0; `@ ,!_ `$ D HL `  > : @J@   *@ "`&   `J@ ꀦ @*  :  ( *@` @J@  *@& @@C`X6>"X``@^ !>>!5>>"X> $@\ O ;" #`h@k$  )O  2#OJ@ "` "`J@ "ؐ Ր@$ -@-`p2*@Ǥ `x@j  ?O  9 X@z  J@   N y b f*  , N y b f2  * " Ӓ``@j  XO  2RtOJ@ "` "`J@ "f c!@ .a_!@ 2*@!"L!  > : @J@  *@ "`&  `J@ 퀦 @* : " *@` @J@   *@&& `@jU ,O  2&`#OJ@ "` "`J@ "   @ ,`@"` *` 52```@j$  O  @j``>" @(">!J! @t  @ .@N`)>  "  & @  *:  .d?`J@  @>!>   @ܒ . &  ?&@h >  @  " @g @`>`` "` ndots:debuginet6㿘 J> #*`: N "  " `@i  @  4!d* !d < $!d`@i   `@i|  2  $ * : " N N  ` N 㿘?    H  . \*D?@@:??(@`@/ ,- `. `\2 (@@:)?(@`(@`<  ?!?(   &@&  ? (@!㿘@    @ 2` H "?@u A:`?,  ` ` ?"@7* ?@$@`$@  ,  .\ $ "? >**,2$? $      ? * " ?  ql,* P㿘C`3 ` & `?7?, .+ \" ֦ Ҥ< ` "&`." *   @ `Ѥ & ¦? .J( J.  .`.`Ѐ   Ѐ -2 @2J 㿘N * N  .   㿘N   ߀ ]`. `\ " N` `. J߀](J    (  ( ( ( 2 *@*`2 *@2 *`2 *`*`㿐@ ?㿈'q*: ଐ  s 0   N x X % `*: ଐ   @\?`*: ଐ  D  + @ . 􀤀: $*: ` = q @  6$:` `+"*`@d,X?#* ?# *`* @  * *` *` `2&@                 x p h ` X P H @ 8 0 (     `xhX%I:%M:%S %p%H:%M:%S%m/%d/%y%a %b %d %H:%M:%S %YPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun%s: 㿘@!p"`’b@Ak "`@AԔp"`@A`b%s: : %s 㿘>"@!p"`’bp@AO  "`@A"`@AEbx@ p"`@A=b  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~l,* R 㿐@6T  ?&㿈 ' ''  @f 8@?$x *b,@$ *b,@$b *b,@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@ $OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Д  `@ʔ  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@W @GMTJ( ( ( ll "  ++,l1* ( (  x*  +,,l1 (( (  z,& /etc/localtime/usr/share/zoneinfo/?` @c  N : /N  /"  N /@ .   2Nİ! " ?N :" N /`?`"Ĥ!("?@d@d $@@Œa@@’@T . 2 `@ o  2?@4 ??` @c @cU 2ڰ??  =95&@1&`-&`)&` @ 2` 8?`!r2  2?`@`2?? $ & `* @`* * @` @@* @@@ o  `. @"` `  *%ؒ ``@Y `@ , 'L@Ӑ&@ $` E $``@` @4Z? `.  `  @#L@ *  ` @cL*  @#!L. @&@$` @ * 'L  @L"` ?"`  `.  * 'L` @L"`  ?"` `.  mn ( 8+  (:` Ѐ Ԅ:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ;*`" * @ &@N :   <2@  &@㿘N -   + ’  @ &@㿘N J M&@ `+ 2!N &@ `   "1 N .! ` w "% N . `   ?Ѐ   &@` !m`2N  / u` &`㿘 ` @IJ d 2  @ID! 2  "  " *` * "@*`" * |;yTv!*` * "@*`" * n ?ŒbX,*  **` * "@*`" *    @H  @X d@H d. * * ? @X     < @``: @,`"@ @HҒ &` ,  Ő"X,@*` *@   6+  +  * "@*`" * posixrules`  &8 N:?@aڐ!N ؒǐ  2&@N  ^& (?N  , ; 2N ?1'N , ;2iN ’ذ"?N , "?N ? &` &` &gL &gP&gT &g`&gd&gh`eؤ ' Ŷ"$ $$ .$ . .$ .` @H d 2  @H! .  . *` * "@*`" * `gȤ} 2?   ?gL gL' ` `@ %ؑ* * @gP   @  ` `@ %ؑ* * @gP ݘ  @  + eؑ* * @ S*e\ 2* + X + "@ "@ @ " * * @'L'P     `Ւ@  &gL&gP&gT &g` &gd&gh  &` &`&` &gL&gP&gT &` &` ` "?#L@@@.@ `@.@ 㿘!Ð#ݒ # 㿘:c` ?"c` !+ʒ  zTZ㿘@]"H:#` :"`@l 5!:@`j (  $#`:"`@L@ +`"`" "'L"'T1#@|c0!+ L@ : Z + 1㿐'+ ` "gP`6 gP # `  * * @'P 2* ` * @&@  *@ %ד*@ *`gL@ @ @K & l* cL @"   @&(㿘j 1:#h#h㿘:cd 2 "cd25#2@`l#9"&(㿘 1:#h#h㿘1:ؔ#h#h㿘  L !L!P* @&>@2=  4  * @ &$*  *   @ @2!L * `   *   @ *#T@Va@Fa&@TT! T! ?"T! @U.&@E.@U <&@E <&@E  & &'Ũ" @Eے d 2  @EՒ! ,  , /@Uɒ!m?&* @*`@*`?@ < ?@U d$@U!,< @U d$@U!$$&&, @*`Ő"X@&@*  $  &* 6& & &$㿘ې@@"&  2` 㿘@ &8@Ui@Ue8@T@"@&@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' ('В < 21?Ԓ  2*?ܒ 2#?'l 2?Ԁ )!nŤ"? ؀`4    @D d 2  @D! ,` ,`@`'Ԁ!n*Ť"؀`4    @D˒ d 2  @DŒ! ,` ,`"@'ԐA  Ԁ!n܀  @D d 2  @D! Ţ Ő"X,`@*`ؕ*@@ Ԁ"'Ԑ ''ؐ  ? 8 2?ܐ'l'Ȑ?ŀ 2?Ȑ ; ' p'n''Ƞ ' Ȥ#l@Ȓ ? `?',@" ',@ '耢`D A@2+ #?,K?, * 'P耢@2*?? %, * ,`* P耢@L L" '@Ȁ 2耢@,`?Б, ?@&  5`@ ''@ &?㿐  &  " S && Ȑ#l@2+ #?,C?,`* 'P @27? 2,`* , * P @"$?LL"  & `?& h Ñ, * 'LL"@" & `?& ?֑, Ñ,`?㿘JȒcl 㿘?" 㿘" ɒ` 㿘" ɒ`|+ L( `( 㿘'DDD&㿐'DސDD 'ِ"@D@ 'ΐ"@D@D ??'"@D@D  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈` #H`* @̐#@` #H`* @̐#@`#\@#``'l#d1:#̒cP` @\`#$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @(`  @*$OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $H" @ J2  @*` $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘;@a$OpenBSD: strcasecmp.c,v 1.2 1996/08/19 08:34:09 tholo Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~͘P   @  `    ͘P @  `   "  2  $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @J @'L'P'T'X"7''#''@5L*@㿐 Y? @OZ 0`" &  @@"& 0@W" & 0& & V @W  3\@Np `@V ?@V`2   6 &  C&&  & 2(" 6 &&   &  "& &   & & =""cH㿘'H'L'P'T'Xp"@5H㿐@& @Nz @*! 66 6  6 & &!& $&"& ,&"d& (&"&    @W 㿘`6 "@"&&@Y+,(  @@ 2,  @AJܒ`"&&@Xڔ@ܤ,$OpenBSD: xdr_rec.c,v 1.4 1996/08/19 08:32:06 tholo Exp $xdrrec_create: out of memory 㿘@V" D"p@$ <@$ @@@V  $ p"`@4ya0&    $  @$ (m & & $$ $  $ $  $   $  @$ $ $ $ ($ 0$ ,$ 4 $ 8㿐 `4 `,`0"  &@`4?"`4`,  "`,@%   &@ 㿘  &  @ & & @7 2  & @" 㿘    4   8 2 @n 󀦠  @B @ 4"$ 4&㿘"    "@  @X   $ @ @ &$ @  2  㿘`   @XX  ?@  "  0 ?  "  ," &㿘 ?("  " ,!  "  @  @ $ "  4  0@  (@  $ , 4" $ 4    " 40@"@  ,@0" "4,@", 㿘 @U  @U㿘 @ 4 " & 4 8 2  4@ 2 4   4  8 & 8 㿘 @ 4  $ 4 8 2  4@ 2 4  4  8  , 0`?㿘`   2 "  *" @ " ?  "" " 㿘`@? @  " ?"@  "  2  &   &  㿘 ( 0   $ " ?" & ,& 0 㿘$  0 ,@    ,@V͔ ,& ,@&㿐ݔ   2`& 8 *@& 4  㿘`$  0 ,@ @  `    ,@& ,&@  c(/  ?$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@ @  "C  2; @L   "/  ( @S &@p"`@2#b  @WL : ` @  @S@&@㿘 :     @ 㿘 @  $! *b,@$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ s$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘; "?@=  0,@M}  4?@=v  0,libcUnknown error: 㿘Ґ!p@ޒ m". Ԗ @ @ .` ?@x@ .`@V "@@Ȑ$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘q @  ` - +  L@` 0 L@ x XL`` ` 0  `' #@<@L` $ %   3q/> "`  ` ?А  3 ?ɐ?,'`&?2  ?1 %⸤ @K[&?  ?#%⸤ @KH @Ģ` 'NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@T 2 @Rܐ Ƞ2Ӡ @RԐ!Ӥ!Ӧ" `*`:  :[ %O  ?* :  (F* NO NO O O O O O O O O O O O O O O O O O O O O$O O O O O O O O O$O O O O O O O O$J@ :  @*`J@ :  @*`:  * L  *@?2 L 2 L ?0@% ?*@L "#\@T "?  ̔  @T@T?2???#@ @Q && @S̰?㿘> <  5 @4-@08((@ @@@08((Ѐ66׺ո㿘? > "b ?" @Sx @QE $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $[h[P[0[ [ZZZZZZxZXZ@Z(ZZYYYYYYYhYHY0YYXXXXXXXhXPX(XWWWWWpWXW@W WVVVVVpVXV0VUUUUUhU@U(UTTTTTTxThTPT8TSSSSSSxSXS0Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(`  (02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $J H2 @ @(`($OpenBSD: pmap_getport.c,v 1.4 1996/12/10 07:46:41 deraadt Exp $h7֐?' o6 m"$"$'`'ܢؐ!#\ab @|!/m''''",",'`' #\ הݘ#ր  =p "p  €`  ր 2 = "cp  @䀢?"6 @Ph6 ց$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@ǒ @’`  @` @`  $OpenBSD: clnt_udp.c,v 1.12 1997/04/29 08:52:33 deraadt Exp $clntudp_create: out of memory X\@M  `p"`@,cb=` `d@M@ ``p"`@+cR=$ X@!    mE *` Vm6 "D$$$  $  $  $  $ $ $ ?$ $$ ($ T@$ \''Đ '''в 8 X@ @H -  < @$ P 6$  '  @   '=cp "cp>""@  b~@O $ @K$$  @M9 @M4 㿈''b`#\b'H'D\ `(? @'P``$'P`('T@!  4 * @LN ؐ  @Pw'|'x`8&`8`< €`P`X@ 2@`< €H  `€ D 2 ؀@ @LҐ &`,   @@`X `@2`>"&`0؀@ @L &`, P  >T >|@""'`'`'''p@  Ш"??/!%> @2`* ` * @  $@ @   @`?" 2\'Lx`@'`|` @@'d'`@'d`'xd'|P@xT@&@6@ O@h@ O hp"@'`lt"@`'d'`А"@@'dx`@'X|d@@'\'X@'\X'x\'|P@xT@&@@ @L+ &`,d @```\ @L "'L #"@@&`0@L &`,G (u@`X``@2o@``@ @ *@*`,`,  `€  &`, &`0  $@@ ` @ ئ`8 &`,؀@"`,@KƐ`, ,"@0"`4"`㿘  " 8 8@* ڄ(h0hDhhXhl" $" ( $" ("" "  "  " " " " "   㿘   " <@M < `@ 8@Kn@Kl$OpenBSD: bindresvport.c,v 1.9 1996/09/15 09:31:30 tholo Exp $x ` '` > ."bD? @N/ /`  '  @ఒ, 'ܐ  @ "@ذ` %>    @  &$0 耦@ @؀ >""$OpenBSD: auth_none.c,v 1.3 1996/08/19 08:31:20 tholo Exp $㿀;" 2  < @)/ @;/ "" < *>""& `& `&  & &  & m"l&  ( @~ @0@-  @& < `@㿘;" (` <   $a *b,@$i *b,@$ *b,@$] *b,@$ *b,@$v *b,@$  *b,@$h *b,@$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"mm" " " "   "  "@ "     "  @  "    "  +d+e+f+gd"@ "   # " @#d d( e( f( g( "   #㿘 "  &  @L_ &   㿘 "  &  @LM &       @  @4 " "     @  $OpenBSD: rpc_prot.c,v 1.3 1996/08/19 08:31:49 tholo Exp $㿘@  ``@˖!㿘@ 㿘 @t` " `    `€` @y`  @r`㿘@S " @   @]`  @X`@<` 㿘@K @.` " ` 2  `` m@  㿘&` &` 2 @( @ ` @`  @` @`  ܄Ї* s$rrss s "@ "@ "@  "@ "@"@ "@"`"`    "@ "@"@ "`"`㿘   "    "&@ @ݒ@&@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr.c,v 1.4 1996/12/14 06:49:42 tholo Exp $㿀 ' 㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿘            €㿘            €㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐N@'Ȓ .@  㿐@'ڒ .@  㿐 "     @@ '  €€ @ &@  㿘ɒ㿘% "      ;  b2     2    mb `?xdr_bytes: out of memory 㿘@c "3  2,  "   "    @F&@  p"`@$cx  @F&@㿘$㿘w " @ "  2    €xdr_string: out of memory 㿐 @ 2  "8 @I' .8, ` ` ` 0!  2@F&@  p"`@$ya  ,!@F!&@  㿘?$OpenBSD: qsort.c,v 1.4 1996/08/19 08:33:42 tholo Exp $㿘  `@ `< @>@*@0$ )@$&@$6""? $ **? $ղ$͢@6`@>z`@>s`(v6`@>l-    4  $@@    4  -%@%@    4      4  @&$@6""?  **? @=/ 4\2( $$6""?  **? Ґ0/ &.2($@ @$@$6""? $ **? $$@Ґ(@$$@6""?   **?  $@ ;@=@@0$ )@$&@$6""? $ **? $ղ$͢@@<$$ 4 $2  ""? $ **? $%@"@  %@" %@2  ""? $ **? $( $@=M͖$%@@=BƲ㿘@ union8@ ΰ @>{  ><  > "b @ ?@Cz @$#"`@ؒ  c@FÔ          # @Cy%@ $뀤#``@E@8 2 & @CO@CMg &   `$@   ,`$`** @㰑,`$   ,`  @|  "$  2``2$`,` ,`@C & `@B*  &  $& & @Bא & @B@EQ  & & && @& 㿈;"" ; ' ' '  @F ?;?"㿘@v ?&& @B @B@E$ *b,@$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $ (8J@ `   JJ@`  $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $P''쀦> "bB?'`?'@;"@BA  '0?'@*@;Ԑ'' ?Ā   @;'̐` ?'ĀԐ  ?Ԑ' ̶Ā   ?Ԑ'̲@@ ? 䀠2@@N@J  2@ '@ %@(@$@4(&'- @@(#%@@;V2 @:@@4@@%@@@48= "܀" $ $? ,  ,?z܀`" $ $?h ,  ,?Z܀" $  , ܀`" $   ,  ` 'Ā '''Đ ?2Ԁ@ @9@E'@A/԰ 㿘.@` ?@9ݒ@$`&@9Ւ@%@  ?@9ƒ@$ 4  @9@  ` `` "@"@  @, *@`$ S+& 2" &@"@& @, *@`"@ * ې&$& @, *@`"@ * $   &@"@ ?"`? 㿘$@ $ , *$@@8$@㿘@㿘@@% ;b "b" " "  ;"*""?㿘`*`;"@  @   2  )  @2   @" :   @B  & &  $ @ "  @$@@?㿘  @&   25 &        @+  &   @2 "   " $   &  "   2   2  $Ą *b,@㿐@Œ @   ``  @> "b @7K" 6  `26 !6 6 & &!& $&"& ,&"d& (&"& $y *b,@㿘  ɔ@C 㿘@ " ??& `& @㿘  @7s㿘> 2& @7J&  2S? 2 0  > "bG?"  @7S 2@? ?6 & &   6 ` @@"& 0@? & 0 < &  8&&  2 @64 @@ !x & $  &  ?Ȑ*@6  `4  `2&    @6  Jrrwa >  >      & "   J+b  J+    "@㿘V 2 > "b,?  @6А `" @  &? " 0@>  0` @@"& 0@> & 0 D "6 @>& D6 & & 㿘!ɀ@8 >n6@t@ n6@@  n6@C@ > "b ?d" " " " " " %$sniglet^&8`  > "b@{!ܢ?$a$a  d >@  >"  >b ""b  @?$a>"a @ e   @J>o 2$a o t$a a@@ !?!>l"2j O@!a@2d O`?  a !€ `@ "`U O`(@7@$a@ 2U ` * ` * D` :$aa8 @A<* `"@0@@ $a0  a @ $a4?$a$@= $2& !>"@ِ#$" & "&  & " & "h& "&  &   &`@?a@=>"" 㿘?@ @=r " ? ?>  ⸐?8 $ 8 $ $  $ !$  $ $ @$ 4o t$!  D @@Ɣ  Ē @@” @` @ 8 @ A$ $ - " @ 7$  *@@@$  2$ 4 2$!  2` ဢ@ d"> "b  $ @@?㿘@7  4  & @  * *``" D" H&  & $*` `@J ?& 0& (.`?& ,! 2  & <  @6 @ ܐ  *@ @4& @㿘  @ !4 >"!؀ !?&!!ؑ* @@<!??&!@<!@F `  >"  !8  @<!, !?@>@<`> ""?㿘`> "b? "? !4  @ Ȕ  2 ?@  2?&!0 㿘!4 :!a& & ! !€ & @!  @?2 ?"$?@>W!?!> O"b&!,? , !8` , Ė @IƘ  2?  ,  㿘  @@ > "b#!,?㿘 > ! > "b#!,?  @ 㿘 >     @  > "b",?㿐 @ @ & ?K ` -``  @B`   $ 2   @ ?`  `2  ․@@L(2i `'@L*` ē*`2`@ޖ W   `` @GÖ G `K ?`'` ``207 ` ?-`> ,`   @L՘ " ,` & " !&@E 2 `@G  ` ?@Eߔ  ?0 @; ` ?-`? ` ?-` 㿘   > "b$!,?!$  $!$ $!($!   ! 2! !$ @W "z?$!  2 $!$ $!( ($!$ (?$!$f  !(*    2*` @2 $! $!(     $! !$ $!$"!  "! !*+`     @M  2 0?! +`2* ` &@  ? " &`! +`2 ` & " &`* 2  (+`$! !$ $!$ 2 $!( 㿘 ( & ( 0  4!& (   *!ؒ@2*  ,`&  @ !ؓ,  " "?! &!! &! (@`  **`@`D" D&  ,(& 0& ,@E?㿘@: @> @=&@:0$㿘! € ,  ( 0㿘 @Y   &! .@@R   !>"C$"?6 !ؓ* ** " ! &! @, <'`'d'h 'l'p't'x'| ?"@>l  >t 'lt  |#'tx | @'x| "'||#'t'd'`'| 'l @'x'p| ဢ@dT>@9~"$U @="$?$a|$a$at$ax$a$b@9m $C$` @= $a"&b  $b && !& # & #&  0& !H& "& "& ` >  "b   > $b @ 5 $aaА` >@X?$ab  $b aВ @ ?`a@4 `Ȁ 2à rpaВ@;Q  ހ >L!b@b ?@$b  $b '\_/^/]/\/'X[/Z/Y/X/'TW/V/U/T/'PS/R/Q/P/'LO/N/M/L/'HK/J/I/H/L!b@>  O?"@>_2|>'pb  $b $a$b `؀!'p"'pp@ 8'p` 2$ab  $b $a$bb  $b p$ad` p? `*  'dp* @d *'ddaز@1?@1l?4aܑ* 2   4aܐ aa@+$@b  a@ܖ@3?b  $b  b  $b @b  $b > > O"b` ` "a@8@aЀ?@:@88 㿐 @ , >" 2+?>""@"#?@ 2?$$ $  4 !4  $  @;!@[  @V 0?TMPDIR%s/bt.XXXXXX/tmp㻐@:7 @8s"Р" $@[ؐ?' @:ה@j? @ @:ʔ @#d d$  #㿘  `"" @ & " >!А "b?㿈  `@ $ > "b'?@O? 2#\@@ؔ    @!Ȱ" @"@@@Ŕ 0$ P" `2@0'....'....'.. . .  '. . ..7..7..?2   J *  *`2 *2  7* *    '. ***'**** '****'***** 2  ‘*0f  b*` _ *`2 *2  7* *    '. ***'**** `1`'****'****`'****'***** 2  *P" `2@0?2   N *  *`2 *2    '. ***'**** '****'*****2  7* * * 2  *l  2g*` b *`2 *2    '. ***'**** `1`'****'****`'****'*****2  7* * * 2  *'....'....'.. . .  '. . ..7..7..#t w* v*  u*  t*  #p s*  r*  q*  p*  #l o*  n* m* l*  #h k* j* i*  h*  #d g*  f*  e*  d*  #` c*  b*  a*  `* #㿘 ``@@ $`@. ?")?@@?2`"? "a@5$` $`a "a@5$a$aaȀ "a@5 $a$aa@5@5@7e` 㿘  ``@O $ `> "b?"   " @? ?@`" ?$" 㿀 @ L!b' '!'!'"'" '@9 @  ?$  *b,@$\ *b,@$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @`  ?  2  @'P'T'X`"7''''@.P*@?㿐@ ?㿘@  ` 㿘8@6L 2  ?@e  0,?@._ L X`L X?#@ @ 4``G`A,?L X #<% /L /2?,@ @ :>,8L`*@! &@- ,>" $ @ >" `? aqL  z2,   ސ a  , "b /dev/arandomx@ #h@ @5 x@6!x?.  .   @@В .   *` * 㿘> ;#8  * ``$ **> "`;#8㿘> 2;;c8 c8?*c8  ,   @@,   *` * 㿘> ;;88(8   *  *  * @ `@ `+`8(8   *  *  * @ `@ `* @8(8   *  *  * @ `@ `* @8(8   *  *  * @ `@ `@  (  `? ` `:20(P˴ˠˌxd*  *  *  *  *  *  *  * ؐ  㿘   "   "   ?@ 6@!ؑ* @-  ?  !0    2@$  `?@?}  - $  "` "@!& !&$! "㿘 a a  "@20 " @2+` & @2F a x?v$a "` "@ 2   "j&  @ *  ?    @? 2f   " `? `2@aؓ*` a0  ** * " *"  5 $   2/&  2+&  @ *  ?      @?y 2' $ ,  "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "!  㿘! 2!5 !"1 !   `    @?# 2?`"   @4 @1~  "` "@@1v!2  "`"` *`@` `@ !"`!"@! ` h ``"b @@ $`b > "`(  > `  > "b?`a܀ 8 (`@ Ԁ?' '@5z ܒ`@5v  ` a܀ @ ҔԀ?֐' '@5a @5]  ` a܀ А2 a@`@  "?(`  @Ц2 @ Ц? Ѐ @@+  Ѐ "b "@V?2 @@ ?`@ ?  "    #\@ b0l ?* 2 *` " `@4*  6 -`@ "6 2`  `&  $ , @@4``@4`(@  2 a`@2a`  4`a䀢 2@  2  ?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@   2b @@ b  $b  㿘!@  2& G&!!6 `  ?  "@  @*5&!!䀢    2-&! 2 ?@2&&!@  &&!  6 6!6!  2&! 2&!@  4&!6!쀠 `?& @ @  㿐  `"" @ 4 $ " >G " (?>@4> 6  "< @ x .' ?2   @.  2)? @; `?2  2  2 @  ?@ `? > "b? "  $" 㿐@@ ؔ @ ? " @@" ,` [@ Ô  !?&! "9@  "  `?2 ?@2 @   !@"@!2 ! &!2  @`!"!2 ! &!@  @  % ,@ y @ ה " @@2`@@l@ e @̔ 2k @@"\ ,` V@ O  !?&! "4@  "K   2 @ 4 ?!@"@2  @`@ $ @  ", `?2 ?!"!2 ! &!,@  @ h " @@2`@  @ X &@`?㿐 @V@?   @ ޔ u`?@  2[" " `?2  2 @a \ Z?@  U `?2 @  @ g א `?2 @"  ?#@`4 ?#@ P @ ?"  "  @`4 `?2  @ ~  @ v ?@ q  ?@ }?㿘?# ,!@&! "s@@  "? , @  @  ?"g`?2  2@   4`!4` H$` @ 2d?@  Ɛ ,\? `@  @2$ `4`*` `` ?# 2 *   `?2 "?*     *2*  `?4`@  @   @ ߔ  @ ڔ ?@5 2  @   㿘 (@  . @.  .@q 2l?.   @ B ?"^?`  @` @ 7@ ?2`Q?`@@`   @1$ 6. .  ?#@ 2@` *   ?2 "?*  " ` *2@*  `?6 (@  2   @2  ?6  㿈  ( . ("  `'7  #\  @_ 2 `'7@Ԕ 2 ` W,`?2 ?'7@  ` C,`2`"@ [ %' ?2 ?7@ 2 `" @  ?2 ?2('`"$'@ 8 2'/?7@ 2 ` ,`@ ” $@4` @  '7` #\  @ޚ  ` ,` 㿘``"`@ "?`"`@  ``" @ 2`?"`@   $ *b,@$ *b,@$ *b,@$t *b,@x^7@  @ @`"?ޑ* `"@4`2 `" @ $@ `/@`'@`'@`/@`@0)@@0$@  ,"  @ ?@  N@/?"Y ,!@&! :@Z "E  7  " " 0< 8 : 06 4 ? ?! ,  2)`` 2 ހ (!` ? ? '` '' '!€ ?:  @+``"  :`@  @] @`Ԩ  ?ޑ* 2 *`@ " `@/*` 4`   "  0 > _0*`"4`2* 2 @@/]r* `"@ 4`2 *`2`@ $@ '@`'@`  /@` @/=  T@ ?"{N ހ * @  @   `@@'@'`ޓ*`@`$4`2`, 4 @@%$@ * @  @   `@ ?2 '@'`ޕ*`"@ 4`2*`2`@ ?2 $@ '`@+- "@ 2" @?@?@˔ @ǔ  ,@ @  @ @ @ @  ?㿐@z^ $@ 4`4``$`@$`` $` ` `?2 @ @&` 4`7&?&@*ؠ2@@t 4 $@$ `$  4 4 ` $ ``@ 2@@* & @S @Ú@.H؀"@)&&㿐@@ $@$$`@$ $ $` 4 4`!4 4`` $ $` @&&㿘!ڐ?6`6``@ ?2 @$$ `?6`6``@ ?2 @$$  6`` ? &` @  㿘!ڐ?6`6``@&@ $, `  % 4   `" 6`6``@  &@  $ ,  @-  @< ?  ?  `" 6`6``@ @- $ @) 6`` ? &` @  p'' ڐ* 2   `?2 * 2 t *`2 ''ԑ/`2 '- 2 @2` 6  ",  ,0*  ,0$2  @ @2  @ @   ?  ,2  @   2  @@  ? @)w- 2 @-2 ܀ :%?- 2 @ *  "@6 2  @-* 2 Ԁ    - ,2 䀢  - 2   @6  ( @@-   2,2 @:"""2- 2 8 "7,2`/`2 @N /`2 ,2 `    ",  ,0&  ,0 2  @ @2  @ @    ?,2  @  2  @@  ?@(- 2`@"62`@,, 4   - 2 @/`2 6`6㿘@Ӕ " ?`  "` @h   `0(0 *0(0 @(0 (㿈  `"@@ $ ` #<*`@`` ( @@&> "b? @@h#\!@<!Ȱ" @@ 0$ 㿐`f P*`@t@@ > > "bL?@F @2 ">?`?2  "` 2 &@`@ @ )6`@ &  @ "?`?2  "` 2&@`? ?@ @ @ `?2 ?6` 㿐 (    @WS@ D "# D&@  "  ` *`2`?2 @25&@ @b @ ! %&@ "    , &@ 6``2 @E 2 @ 2??2 ?&@6` 㿐@"}  "Y " q' '@  @ ' ' 7  2&  +@@ @Y 2$@2C? @ =??2 4  ?4 @ "@@є & ?2 @2 @ `2 @ 24 ?$& & 㿘  " (@&L& &  ( . (& 6  ( . (㿘 ,&!   @ 2& k ?2 *   ,`2 6 @.   "A!&Q,` ,`2   ," 2%&, ,  @Z 21 ,2`?2 @2&  @# 2 &6  ,  2?!"@!2 ! &!, 2   @! 㿐`@z ' 7@Ĕ @   @ & &  & 㿐`@V '  ?2 ?7@ @ߔ   @ٔ & &  & 㿘\@`*   7 `  ` @ 2m?( 2@" @"@@@ @%-  @%h@ "R?&@&` @)@@&&` & "A ` @` @  @` 3?/@ 2`" @#` `@(@@ 2`@$  @%-` 2'@?` '`@` @@ @)Y``' @' @ @' 㿐    1    *     2   *       ''` !@A!̀ "!?'!€ `8@  "2  ` `` @@    2 ``@㿐@(ה `@(Ӕ & :! @$M  @$ &#?'!ظ?@ 8@(@ " '@' 㿐!ب? @` @h&?&@&`&`&` 6`6``@(}` @$`@t @&ۢ@g  㿐@(` `@(\ @ 2` ? "!@L  ?`'@ @ "' 㿘"`!"`@&!@+ 㿘!Ԁ` @ "!&@ $!@B8@ & <  > "b  @$( && * "`"` &$  &$&$&$"$"$ "$$mpool_new: page allocation overflow. 㿘$?p"`@Ò`@$@ 2$%  &$"&@ *? *  ""` 2@"`" "@" " 2 &" & 㿘$@ >l @SF? *   2""` 2""@$$ 2"" "2 &  "`  2 &"`$ $ 2 &" &   L,@@$ $@%̖ 2< @29 $@%$$@`> O"b* $ ,? *  $$ 2"" "$ $ 2 &" & $"$$   * 㿘`2` &   "` ` 2`&  "`@" 2@" 㿘   @d?2  ? 2 @$` 㿘$$ @*A$"=$  25  @A?"<  ? *   2 " "`  2 ""@ 2  $  "`  2  $ "`2 $@!  & $ $$ 㿘$ "$$$``$@` $@$ 2?@2?$`@$$$ ?` .` ("    2  $_ *b,@$OpenBSD: calloc.c,v 1.3 1996/08/20 17:42:33 downsj Exp $㿘@}@! @%3㿘'L'P'T'X@hL$OpenBSD: vfprintf.c,v 1.6 1996/12/14 06:49:43 tholo Exp $㿘` @ &`&`&` @ ?7 7 ' ,'̐''$'''@0@ 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼀@''    2  @* > "b.?   V   ' '''''@ϔ  %@@ $$@'  'e ' ڲ` ' ?/'N@``X #$*`@00000000000000000000T0T0000P0000000X000000000000|TTTX00`0tt00\00O' 2N@ /'`  *  : * ?Г*`:`  L?Ѐ , L $2 '@``- @ `- @ 6_N@ [` +X/'N@*;`  *  : * ?Г*`:`  L?Ѐ , L $2 '@`- @ `- @  ? * ?РN@`Ѐ (, $   ?` , * ?РN@Ѐ `$2 '@۔N@``@N@ l2``` @`- @ *``  `''`@ `- @ *  : `- @ :  Z ` -U/'g  G" `- @ ''Ĵ@ޒ o`?  -/'!( @ !0 a#\#`@8gGe?$ gg E e ef'@q' `  `O`@@ ` O `` $@  O 9 -7/'`  `- @ :`:```@ `- @ 2`- @ "``  `'' `@ `- @  `- @   `- @   !8'`q x`- @ !P  @ } "@$/'@!``  `'`'d` `@ `- @  `- @  1 !X!8`  ''@'D@` `@ `- @  `- @  `   2``"/'`/''  ``W'`1` `70G ` 0,, 4` 4  2`2`<'L 07 04,  `0,   ` `0, `,, 4` 4  2`2'!p@!L '?Ħ@/@ /'&O' `2`2O'& . o@$ $ '  ' ? o@$$'  ' O' '$ $  ` 0/8/98$ $ '  ' k ` 2& . oP$ $ '  'ɒ N? oP$$'  ' 8  - oP$ $ '  ' ? oP$$'  ' ae$$@;o`? BT!$ $ '  '^ @`` $ $ '  'D ɤ? w oP$ $ '  '* ? oP$$K `!$ $ '  '   $ $ '  ' {  - oP$ $ '  'ܒ a? oP$$'  'ƒ K$$@' M$$ '  ' 0"@ - oP$ $ '  ' ? oP$$'  'z `!$ $ $@'  '_ !$ $ '  'I Τ$"@$@l' 4 `"M$ /8 ./98$ $ '  '! o`? B3 $$?) ? 2 oP$ $ '  ' }? oP$$ $ '  'ݒ b$$'  'ʒ O`/& , o@$ $ '  ' 4? o@$$'  ' 2 &'耢  '耢 ~ '`@" @   @?' '   @t   N%_  N `XU #4*`@+4l4l+4l4l4l4l4l4l,+4l+,4l+---------4l4l4l4l4l4l4l4l4l4l.p/p4l/p4l4l4l4l.4l4l04l4l4l4l4l2h4l4l3l4l4l4l4l4l4l4l4l4l4l.8.t/p/p/p. .t4l4l.(4l/01.04l2,4l2l4l4l3l  N * ?L@ `L@?Ѐ *`L@N*2   N * ?L@ `L@?Ѐ *`L@ $ @* 4f`@ * 4[ZNЀ XNЀ  Q * * ?Ж NЀ  $C> <:@86 耤@ܒ* 4"!N 耤@˒ *@ 4N@ *@ 4N@耤@ *@ 4N@* 4N耤@ *@ 4ѦN@~ *@ 4æN 耤@m *@ 4N@] *@ 4N@耤@L *@ 4N@> *@ 4N 耤@, *@ 4qpN@ *@ 4a`N@耤@  *@ 4PON@ *@ 4BAN耤@ *@ 432N耤@ߒ *@ 4$#N 耤@͒ *@ 4N@ *@ 4N@耤@ *@ 4N@ *@ 4N 耤@ *@ 4ҦN@} *@ 4¦N@耤@l *@ 4N@^ *@ 4N2N@j* & >  *"@ /*  5x5x5x5x5x5x5x5x5x5x5505x5H5`5x5x@'`'`@'`'`@'x`'| `@'p`'t``$쀢`@@A 㿘@  * @&@+@@@L&@* @$ &@ 㿀?\`f`  `e`E  oh聩 9/? -/#\@ `g`G`f&`fN 02 @oh聩 B  '@@oh聩 B3'   0`'*@@ `"$`,`   -,   +. ` @ے  0.@֒ ` `0.􀦀.   & 0. `0. &㿘``"    2 @@ > "b@ ``" d$ ,$@`" &` P ``" " @*@ǔ "& &- @@ @&@R 2  @  , $s  @ "& &$@`" &`a  ` ` ``@ @ݔ"@` @    @ @b&@ 2-    , $    @G "& &2@ސ   $@`" &`   @6 ?;`` @  ?@2 d2 #;`` ( d`?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: memchr.c,v 1.2 1996/08/19 08:34:04 tholo Exp $"  `  ?2  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@$OpenBSD: strtod.c,v 1.9 1997/03/25 17:07:30 rahnds Exp $㿘< H,`@   "@ ,, @n & & & &   < H(" ( 㿘   ?# @ /@4 @ )4` 2 *  @$ &-    *  @Ŕǐ- "  & 㿘 @_   *`  "` "``   N   ж       В&N ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘 "  " 㿐 `@6  `  `  .: % *% , `,`@'@E ?#@  @@ @  44`@ 74  4 44 $@  @ ! 444@  @   4 $`@  . 2' ' 㿘` p`0*  >``$!< ``j"q$ $@`" >`i>`` @ 2Z$@"㿘>` @   *  ]  "   * `@ " @* "@`@ 2  " @"`@ ?$H`(`@" ?8 㿘     D       +``* @ ?# @ "@@ : 22"  ` :`33 @  ?# @  : 2`@  :`33   ?? " ;hh?0 $ #`#d:  4?8#` #d #`   ( #d`#㿐  * @?# " &@ " 4 ' ?,  " 2 ?,  "@ 3 @  ' ?+  " 4@'''㿈?\  ?*@' *@2  '' '씒  "@ *  $@2 '$@$`   &  ڐ$@ &    ΐ͐& 5"  &&.`?.`"@&㿀p?l?"@ `" * * '*" '?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC`@ '  ''' q`    q    2L - + '2LL "8L 0  L 0"L *    ``,*   ?4`+  *  ?Т`L/뀢9*: E`=L0ϦL0`π 6e  )`    `,* `4+  *   `,*   ` +  *   LЀ (ӖЀe EG``2 `2"L+ -І LЀ ,0ϦL0"π  *` *  ?ЦL/9$ "@" 2 ` `2 %@`w܀u`s`` '?p`HB?  8- @D?' p`HBD?`1 @ 3 2-$@`A`  -`@"@$@%@ `* D?-` D$?  *`@?$@ G  *@D??!4$ < > ""bq (o? y  !8 * D?<  ?, '!8*@D? @(8>$(#'N? K' I   *@??;<  &  !` * D?<  ?!`* Bp`@F?D? DF?''> ""b 0B?' ')#;p  *  @Ԕ_ `      쀢 &$@@?d3 6"@ @ 44& $@ $   o  ے`U % 6   % 02  @?  @ ''   ?@@'?' р Ldp`@ B9?0 p`P@  /?Ȁ p`X?c'?J' 'p`X@ȁ  p`hJB ??@B?  &ȓH' ȕ€  ? ppp`p@ȁ  p`x  0`ȁ  xvtr0omkig܀`2 @Ԁ`㿘r -@@@F`/  ?#@` @4 @~4` 2  @" :`2 ":44@  (& "&Ғ 2 ` ?#@` 4 4`@2 @ " :`2 ":44@- (& "&InfinityNaN0(?'''!< @ < D" * "Ȑ $ @ 6'@ '@ *@'  ##@  ?@! !0\`N    \#@p` B  #@\`!8 #@2 g ??*@ '|%'@d2`   @"*@2  "*@' p`B?? '{͚ 'p`p` Bp`B' p`DBH'p`  B# ` ' -`@ )'"?    ` '& 'Ԁ` 8'Ԁ` 'Ԥ  'Ԁ`( +`@dddede?'? ''̀`̚ '' '̢@``'  <` " D<`D "`D,  (`D< D<"`@ޢ ?`"  ` *`=` @ !X ?   !8 ,` B<  `?` *`@D?` ?!8 ,` D?<  ``p`@ 9' `p` B?' ?Fp`ȅD??0 'ؤ p`Љ?؁    ~``, x-p`@؅?آ p p B?'`0.؁ 6 Ɓ {`@67 H?؅H? x-@D?آ p p B?'`0.@ ؅H -V?Ɓ 9?N 0"? `J??  쀢 T`S -`̀`@   p`Ѕ B  1  ȍBH?'`0.@ B ?H`?" `?N 9 .  0/p` Bp` B?ˢ`'`$ Ԁ` `$3 6"@@&$&@@' 6'@ 3 ` @4&'@%`` !M   `Ԁ`4 2'?@2 '@ ''`" *   $@ `` "```@|`   `  Ԁ`     1ͪ8  1. Ȫ```@'` `* ` @ -  O 0aw`  U` Ԁ`   9- 4. !`Ԁ`` `` ,4 `2h."e.:  9_. 9 9.F U..@-  \ @  T  ' M ' H ` ڒ 0.@   8 ` ޒ4 ? ?N" `?N 9  . 1/ N 0"?  `@2. 0/  .`#@\`2#@$OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $ "  J` ? `    ?"J@J@"J@@  " *   J@J@"`    ` `*` 㿘> 2 @ 2  2 -? "  0` @@"& 0@ & 0 ?6 &  &  6   2 @ " &   &    &  㿐 2 C@&@ =  6  C&&  & ""cH&& &   @V  2  6 8T  &&@g  &<  `?&؀ 2&@$&@($ L<  ( (&"d@"$㿘. * "* @O  % ## ? # << `:::: : (:(0:08:8@:@H:HP:P?X 㿘> p@Mp"   V  X 2 $  6 && & & & & ?6 & 0& 4& D& H㿘@zpb " `   ` "@`4` $㿘@ #d= H>  㿘 2 @#d  >@  "b?㿘V `"   ``" & &   @6 ? &  $ @ 4 , $OpenBSD: localeconv.c,v 1.2 1996/08/19 08:28:20 tholo Exp $pc $=p       $((()(*(+ (,!(-"(.#(/"c p p="X"""`"`"="y8y0y0.yhyhyhyhyhyhyh$OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@+dd0(#h@ĒȐ8@  ((((( AAAAAABBBBBB $OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ *b,@㿘 `@j error: 㿘# b= "c!@@  @( !=@z#4 @!#4@t @@n @@ warning: 㿘 "=# !@А!@@U  @ !=@N#4 @#4@H @@B @㿘@  / 0. @ 2 =6 =""@"="#,=#@*@  㿐. 6  %=* #\  .  @w?!="@*. $"$"@ǒ  /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. P !!1q'= ! p@ ?$*? @ 2!@ `>"`"t-=+=)=L@ lđ* :  >^* $$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!4* &!4!42 &!4$$% % %c( %c( %#$%#$$! $`2L@k=#$ = "c(!=#\   @??$"! !=@ /2 ?$"=$"c=b "bqa4 2q "a4q!4*` "!4!=@ $#0㿘 /0=# * `""`"@  """2 6 4 =""="* "  @ ="  * `@ "=#(  @֕. ` =c0 "c0@㿘 (  ?>  2`=",`@ p=d 2 2 *   *,   @ @P  *3 3 23 3 #  `  ?2*  "  #@ 2 6  2*  (  @  "  26   +@2* +@*@" ?3  ?3 $ 6 =""@="*`" ,` #"   =: ",`@    "   *`@  @" ?6 *   =",`" &": *  ,=#(   @  allocation failed. 㿘=" =# @  (+Ӑ=#  2=#E h=#$   @ٔmalloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘=# z =" 4` #`!H=""@` #X!p="@#Q!=*`"@@ 2o#D! !  =# 7@50@20? (*# ?@#$! o 2@2`*  ` 2 #" * =# 2`@ 2`@ 0" 0" @@page is already free. freelist is destroyed. 㿘 c=" =#!H0Z# W6 ="" #!p0M="#y!0E="*@ Ҙ  $k 807 #e"01/#_!0+="+  "  *   ="  * "@ * @  =#( *  @!=#0  $#0=#0"`"` "`= "@"`" P##0=# "  *  =0" " $  "@6"0 2 @$  @$ "* @2%  $   $  $" 2 @$ $   $=c0"" $"c0 P 1%q 4@*#= c,@&@ c,@  4 $ $ @  $c, 2 ="#=?  ""="b* "p0l/ 4@ ?#!0c4`*  ` 2 #"0W=#(  @ 4`* ` *  "  4 = *`* 2    " " ` ` @ 2$""  @2" 2 =b" =b*  "  in malloc():recursive call. 㿘=%b"#4!=#8   $#8#8$#8 %"=c8?"c8  in free():㿘=%b"#4!=#8   $#8%"#8?$#8]=c8?"c8 in realloc():㿘=%c"#4!=#8   $#8%ې"#8?$#8 ?`2 =c8?"c8$OpenBSD: getenv.c,v 1.3 1996/08/19 08:33:31 tholo Exp $㿘L   J@ =>`J@ `>"  '>@˔ 2 @L@ =2 Ⱀ$: &@   㿐͒$OpenBSD: abort.c,v 1.3 1996/10/25 03:09:15 tholo Exp $㿐=#H "??' ?' @R @@  @7  @G @@{ @Ӑ 㿘T @`>  P@ B < P ?Đ*@4 㿘 !" V   @  ?Đ*@6 V @'㿘V  @ ?2  2  ?Đ*@6  6 >P㿘@VV 㿘p" ? T` "??`X2x ?`'&#*`@(@T0  0DXhx\p ' ' @耢 ? d 'g  ' w'  ' p' ' k' 'R  ' b' ' ]' ' X' ' S' ' N' ' I' ' D' '@' ' ;' ' 6' '  '  '  '  '   '   '  ' ' ܖؘ @ ? ܀ ?> "b ? ܖؘ @ٚ ??܁x''>"̐? '> "b? *@ @ @ ` '@؀ ?؁$ *b,@$. *b,@$: *b,@$ *b,@$I *b,@$% *b,@$6 *b,@$ *b,@$„ *b,@$ *b,@$ *b,@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿈'XX#\#`#d#h  Ŕ@d㿐#\  ǔ@Y  $OpenBSD: sigprocmask.S,v 1.2 1996/08/19 08:18:13 tholo Exp $@2@  0 *b,@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $qb@4   :q*b,@ c$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J  J@`J 2J $OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $($OpenBSD: exit.c,v 1.2 1996/08/19 08:33:30 tholo Exp $㿘>"`=`?, @,  ?, @`2`=#H @/usr/bin:/bin:/usr/sbin:/sbin㿘 @uh  a>`2]>     " )a@w L    D "?  ?`6)"*`@$,P4@@@@@@@@HP#?###    (","  "> "b?$ *b,@$ʄ *b,@$Ƅ *b,@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $q   : *b,@"$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $> b??8W"V?ߒ &P?  ݒȦ , D?3" ƀ    ?Ԑ `$@ 4` ,`    .  &?  ^Ȧ ,͑. "?  &@㿘@ `rΔ&Ѱ  ?>''''''' ' !ؐ  !   "  "&  & . ``& i& &`G9>'"  N ?2#` `" 2``2q>  & *cЀ h&  @"& ,"- &  T>  & x M> ܐ ؐ !& ."& -#H& +#@& ,!& 8#P& +#& ."&  ͔ &>`  2  "`   Z"  )€??>0> "b> "İ`>C>"" 㿘  `"" , & " (>" "b?㿘  `" $ `7+#*`@@p$H@ %>(" ( #  $    ( " "  $?2"I " )2"!€??>?"> "b7?" " )2 "!€2&" ـ8  ?@[  ( , ($ $@" @"@@֦ $ 㿘  `֖ $ >@ 2"> "b-?" )"!$ €2?@ ?  @" @"@@a $ 㿐!" !Ȁ ؐ  " &!D?"&!!'"'"3"!!`? "`~!!" ?2,@?2,@"A@  Φ?آ`*"*"  !&"  㿐"O"!!!`? "`?!!" @!'!Ȑ$' (@ p  ,?2,!ʠ$!̒!&!!Ȁ !O  !̀ &!ȑ, 2 !Ƞ , *!Ȁ*"  !&"  㿐!" !Ȁ %  `" &!3?!&" / "&!!'"'""@"" :" " !Ȁ *@ `  "@  Ԣ`@ 〤&" 㿐"" "@$" " !&"   ' " * $'@ ז `?@  &" 㿘  `* $ " (">@`">"@ @$ >" 2 $ @ $?$ $ "b ? "  @$" 㿘@ 2?@  ܔ 㿘. @   k ?2@E?@  `@  $ `6`.`: ?*  ` ?#@ 2@` *   `? ? @" : ?*  "` ` *2@*  ``?6`"?&" 㿘` `y $ @$ ?"?" $ "D"` " ( @Z! f" 2?ɐ?"?p  `` J $ ` 2"  ~  "" v !2 "!€??"l?"   2d?`2a? $ 'ܐ'" " ؔ  4?"䀢 G ؔ  """?"' ' ؔ ''") ` ' ؔ  "?$ $"  e  "?  "  ?" *@$"  ?㿘'L!Ā ! >  y  "K?&! &!!L  &!& "= @`*    `  ` !ѹ!̀ 2+?'!" @ @ !̀@!Ȁ 2@  A` 2&!?@ &!!Ȓ`o@@' !' `' 㿘 ,&!  Ҽ L> &@& 6 q  ?* 2 *2   * 2     8!!"!2`! &!  ̒*2   ?*2    "     )" ,!?&! `>@\ `*    ?*     "   !>"" 㿘,  `$@,`2 @` , 2 6$@,`2  , 2 66, 4 ,  , $@2 2 㿘`.  @G.? . "@ # *  ` *2 @# ` 2. 2`@2`@2.,*  @4 @`@ 24 8?& 8` .` 㿀  Q   J 2 x?-.3 @q3`  .   -g .   - '  @   ߧ,@ '% ',%+  ` , 2 @@  % .``$6 @2`, `@@' " ', ,"6* 2 * @ * %2`* 2   ?.   ?- p* 2       #\@ 2?܀؀  ),`2 @  2#  `" 4* 2 *  * '2* 2  Y   @\  ] ,`2   (W,`  ' %@ ' '  " ' ސ2  @`*  @ @ǒ";?j .  @`*  @ @2?M .`* 2  ,`,`2  *W @ 㿘`  5 *` 8.  & *  @ *     Y *`@ ږ "R?``2 ( @`*   @8 `@;"6?` @`*   @ Д `@; 2?` .` 8   & 8 (^` 4 $  @ 㿘 4@@ `2  & 4 & 4` .`@r,`2 `j  &` ` ` *`*@`2`*  ?2`2`2`4`㿐!?N K < *  @6  *@  <*@  *  @ :@     ?"U??  > O"bF?2`2   2  6@ ?6` 66` ဢ@1`  :  + *@ '.@ @*`*` *` 7**    * 7* @  *` 㿐!? @ѐ 2q?  ဢ@+!   :  $*@ '.@ @*`*` *`@ *@ 7.@ @ *` < 1*  @6  *@  <*@  *  @ :@     ?"? ?>  O"b?㿘 !! &!<  ,  \  V"?* $ $.2 đ."!8      (HASH: Out of overflow pages. Increase page size 㿘` -  D?``=@ ?` * ? `$: 2. !8@H2` * ? ` * ?`$  :  ? ?j*`` *` ӑ. - `D$`$`D "`D `@$'$`   $ $`  3cc 1 -  @" D @" @ ` * ?2%`` - @ J i - @`D  '""`D  Ր $` -  @" D @" @ : *   ?$ *@ @$ :- C  : *    $  *   $ ` 鱓*` `$?$`$  .  D  .  . @ @$'4 . . 6  㿘` '2 *  @@ $@&& $  :@ * ? @*!8 @d   : *    ?$ *@ * " *㿐?' !r"!`?&!Ӑ!`! ה   !8@?㿘,```%4, 2 @`$6, 4 64`4`*`` $2* 2 㿘!@6 $ .`@ "a8.`.`!8Ė  <  .`!8,!8  ?*@   *  2@*@ 㿘`e*2 4*  $@,`2 , 4 P%@*44*2`@* $@2`* 2 * 4 x`/*  %4*  "*4* 2 .4 %@ 4*`@`"2`* 2 * 2?`` .`*  `?F*2 @4*2  "*  $, 2 ,`4`۔*44*2`@* $2`* 2 * 4 :2`?* 4 ` .`*   ? 㿘 ` ?* 2  (   *    2*  ?` .` `@`` 2+  ?  22`$$?$?2+ 2  *` " 2*`@  ?2`  `,0+ 8?& 8 㿘`. $* 2 ( . @  ", @ A2 ', 2 &. @` "?` " * 2 ܰ , 2 2 ?. @ ?㿘@   `*`    2&@*`@  "  &@   㿘`.   .*`@ ʖ "w?`  .   2*`@  ``B * @  2 " 0,`G?*  &" 9& 2 &! !$ &!$ .&!(*`@ | (&!  &!(!   2! !$ &!$&! ,`2@?&  >,`! ]2!&  "b?㿘`  "@  /`! ʐ D&!2 &!( 2&! !$ (&!$*`@( -&! !   2` !$ &!$&! *`@ $?`  >! `  "b?㿘 @ ?&!& ?㿘`` " ``?* 2  ! ~\ .&!  "` $?@*`@ И$?`  >!``  "b?㿈'P\ 2d?@ P4 * 2 ` P $ L?$ ` ` *`"``/`  `*`2 6`*`2 66*`2`@2`* 2 $$ P` ` *` *   6* 2 2 * 2 P ?6P`"$ $ 㿈  `"" ( & " ""*" "%8Z>!̀ !Ȁ 원  " L&!"&!!!" "#" !'"' 3'9 T.@ ( >! $@2"  @>"@ >" Z > "bU?"<" )2 "!€?"F?" ," ""'." '"'""'" (" @( 2#?"`" "+@ 2 "& $"  &"   x! ˔䀢?/' '''  "@     ""@b?2 2 L?`   " ` ,`2 #\ 25 " &"0  ?,`2`* 2 *` " `*  4 ,`2`@ "4 2`  $  * " &""  &"   %W% (Erasmus) %G%T.0.8.(8p. =.=.D.X.-h--{`-H-H-~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$OpenBSD: cmds.c,v 1.20 1997/04/23 20:32:57 deraadt Exp $>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file33aYYb ϐGTYYBYxYHc,YXXdʰXXe8XxX`X@f X(XgWWWh$W`W8HAHW WiGVVVj VVhkHDlHDLmτVXVHV8n"πV VUoC UODUpHFDPF|Uq(UU`UHr!U Ts!ʬTTS!ʴTTtETTETu"ψTXT8T VGw!SSx$`SSXA\SpSPyTS8SzRR?H Ę (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t9290@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $$OpenBSD: stat_flags.c,v 1.2 1996/06/23 14:20:21 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.7 1997/04/01 22:59:38 deraadt Exp $P.<$OpenBSD: print.c,v 1.6 1997/01/03 22:36:08 millert Exp $$OpenBSD: util.c,v 1.2 1996/06/23 14:20:22 deraadt Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.4 1996/08/14 03:49:14 tholo Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.3 1996/08/02 11:16:47 deraadt Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.16 1997/03/10 04:27:42 millert Exp $@x`XP@80( @  $OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.6 1997/04/19 20:10:13 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.5 1997/01/15 23:41:20 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.4 1997/01/15 23:41:21 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.8 1997/04/12 17:30:23 michaels Exp $$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.14 1997/02/23 03:51:25 millert Exp $xph`XPH @@8 @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.7 1997/03/27 17:15:27 deraadt Exp $>......$OpenBSD: ar_io.c,v 1.13 1997/03/25 09:30:19 millert Exp $$OpenBSD: ar_subs.c,v 1.6 1997/02/27 23:32:57 michaels Exp $$OpenBSD: buf_subs.c,v 1.4 1997/04/06 06:11:10 millert Exp $ $OpenBSD: cache.c,v 1.4 1996/09/15 22:34:06 millert Exp $$OpenBSD: cpio.c,v 1.3 1996/06/23 14:20:31 deraadt Exp $$OpenBSD: file_subs.c,v 1.8 1997/04/09 01:59:00 deraadt Exp $$OpenBSD: ftree.c,v 1.4 1996/10/27 06:45:11 downsj Exp $$OpenBSD: gen_subs.c,v 1.4 1997/01/24 19:41:21 millert Exp $$OpenBSD: getoldopt.c,v 1.2 1996/06/23 14:20:36 deraadt Exp $$OpenBSD: options.c,v 1.24 1997/04/16 03:50:23 millert Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ  Xڠ̔`|&< LPXʈ̄̔P`|&< nXdt̔P`|&< nHdtԄP`|&< (p(*rm*v`mmqH (zzL{4mzmm&<$OpenBSD: pat_rep.c,v 1.8 1997/04/05 22:36:15 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.7 1997/04/05 22:36:17 millert Exp $$OpenBSD: sel_subs.c,v 1.3 1996/06/23 14:20:41 deraadt Exp $$OpenBSD: tables.c,v 1.5 1996/12/24 03:44:13 tholo Exp $$OpenBSD: tar.c,v 1.9 1997/04/05 22:36:19 millert Exp $$OpenBSD: tty_subs.c,v 1.3 1996/06/23 14:20:44 deraadt Exp $RpR|R| / P$P(xX PH @0 (  xph`PH80xpXP80  _@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.16 1997/02/04 16:44:14 kstailey Exp $8x. Ad@@@@@@@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: pwd.c,v 1.5 1997/01/15 23:40:24 millert Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.7 1997/04/11 09:06:42 deraadt Exp $@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.4 1996/12/14 12:18:15 mickey Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.18 1997/04/10 10:09:02 deraadt Exp $0123456789abcdef ( (  h @ X 8 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD H ` P H @ 8 0 (                 x p h ` P H @ 8! (" # $ % & ' ( ) * + , - {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. x00 ( 0$OpenBSD: cchar.c,v 1.5 1996/08/02 12:10:03 deraadt Exp $$OpenBSD: gfmt.c,v 1.3 1996/06/23 14:21:50 deraadt Exp $$OpenBSD: key.c,v 1.6 1996/12/17 19:09:30 tholo Exp $      T x T p  h t X  P  H ( @ T 8 T 0  ( T        4        $  T$OpenBSD: modes.c,v 1.4 1996/12/16 20:04:41 tholo Exp $$OpenBSD: print.c,v 1.5 1996/09/15 23:13:03 millert Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.4 1996/08/02 12:41:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.2 1996/06/23 14:21:55 deraadt Exp $$OpenBSD: test.c,v 1.3 1996/12/14 12:18:27 mickey Exp $$OpenBSD: map.c,v 1.3 1997/01/17 07:13:43 millert Exp $$OpenBSD: misc.c,v 1.2 1996/06/26 05:41:55 deraadt Exp $$OpenBSD: set.c,v 1.2 1996/06/26 05:41:56 deraadt Exp $$OpenBSD: term.c,v 1.3 1997/01/17 07:13:44 millert Exp $@(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: tset.c,v 1.3 1997/01/15 23:43:25 millert Exp $$OpenBSD: wrterm.c,v 1.3 1997/01/17 07:13:45 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.5 1997/01/15 23:41:45 millert Exp $ x x xP x w w w wX w v w v vX v ya yc yc yd yd yf yh yl yL yn yxN ypq yhq yXr yPS yHt y@T y8v y0V y(1 y 9 yZ yb } } }H } | | |p |( | { { {P {0 { z z z`; 8 ; 8  w w w w       6@iX?EXiEjD           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-$OpenBSD: history.c,v 1.4 1997/03/14 05:12:51 millert Exp $ 5 i`1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RYK"""Q"7I: UH""@""NG"PTW""D"""" ""6J9<>C"? "M"F"OSVX"E"""""8"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" R t R ǔ y _ R R H R ۄ? fwdbck: h ` P H 8 0   p h X P 8 0  h ` P H 8 0  x h ` P H 0 (    OAOBOCOD p x  ͸ Ͱ ͨʀ ͠ @ ͸ Ͱ ͨ  ͠a  ͸ Ͱ ͨ ͠ =,A"'B" """"      @  ϸ ϰ Ϩ Ϡ Ϙ ϐ ψ  π x p@ h ` X P H @ 8 0  (@            θ ΰ@ Ψ@ Π  Θ ΐ Έ  ΀ p ` X P H @ 8 0 (  @     @       F  pG 8  I  J  D x hE H 88 9 @ x hO P S T h P: 0 ?  6 7 < p `> ( U X ; Y X @=  B A x hR H 8Q M N x hC @ 0H V W hK ( L ' h P& ( 5 , - p `% 0 ) 0 4 ` P#  . 1 ( ` H3 / 2 $ ` H* ( +   x H 0  h    h @ 0  "  x h H 0    ! p P @ 0    p @ (    @ (    p Ih J P D J D HX B| B E< E Ex J8 F K O G K N G, H J M K K J FL J J J J J J0 J( I [( ]0 Y\ W$ V \ Y ] ] XX X \ ] Z, \ ] \ Z W  x @  | T x h h    8 4 d ( ( p x$OpenBSD: tokenizer.c,v 1.3 1997/03/14 05:13:07 millert Exp $ x p h ` X P H @ 8 0 ( 0 (   ` ` ` ` ` ` ` X P H ` ` @ ` 8 ` `   $NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$NetBSD: tputs.c,v 1.5 1995/06/06 08:14:37 pk Exp $5MS7) $NetBSD: tgoto.c,v 1.5 1995/06/05 19:45:54 pk Exp $$NetBSD: termcap.c,v 1.7 1995/06/05 19:45:52 pk Exp $AAA@$OpenBSD: tcsetpgrp.c,v 1.2 1996/08/19 08:34:44 tholo Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $ 7 9@ 9 :` : =X = ? A C D8 Dx GX G HP$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.2 1996/08/19 08:32:59 tholo Exp $$OpenBSD: fscanf.c,v 1.2 1996/08/19 08:32:45 tholo Exp $$OpenBSD: fputc.c,v 1.2 1996/08/19 08:32:42 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $ K M` Mh M N@ OH$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.4 1997/04/28 20:44:59 millert Exp $  p ` @ 0      ` P 8 (   x ` P (  $OpenBSD: regcomp.c,v 1.5 1997/04/30 05:51:09 tholo Exp $ X P H  P  P P P P P H ( P P P P x X P P 8 P P           x h ` P H 8 0 (                     p! `" P# @$ 0% & ' ( ) * + , - - . . / x/ p0 h1 `2 X3 P4 H5 @6 87 08 (9 : ; < = > ? @ [ \ \ h] X^ @^ 0_ _ ` { { | } } ~ $OpenBSD: ns_ntoa.c,v 1.4 1997/04/05 21:13:15 millert Exp $$OpenBSD: ns_addr.c,v 1.2 1996/08/19 08:29:30 tholo Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.2 1996/08/19 08:29:18 tholo Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getservbyname.c,v 1.2 1996/08/19 08:28:55 tholo Exp $$OpenBSD: getprotoname.c,v 1.2 1996/08/19 08:28:53 tholo Exp $$OpenBSD: getnetnamadr.c,v 1.7 1997/04/14 04:25:02 deraadt Exp $$OpenBSD: getnetbyname.c,v 1.4 1997/03/13 19:07:26 downsj Exp $$OpenBSD: getnetbyaddr.c,v 1.4 1997/04/05 21:13:06 millert Exp $$OpenBSD: setlocale.c,v 1.4 1996/09/15 09:31:14 tholo Exp $ ݸ ݰ ݠCCCCCCC$OpenBSD: morecrypt.c,v 1.8 1997/03/30 20:24:47 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: crypt.c,v 1.10 1997/03/30 20:24:46 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: ttyname.c,v 1.3 1996/09/15 09:31:07 tholo Exp $/dev/$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: setmode.c,v 1.5 1997/03/07 02:15:18 millert Exp $$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.2 1996/08/19 08:25:29 tholo Exp $$OpenBSD: popen.c,v 1.4 1997/04/16 21:59:04 millert Exp $$OpenBSD: nlist.c,v 1.19 1997/01/10 18:29:48 etheisen Exp $  !$OpenBSD: nice.c,v 1.2 1996/08/19 08:25:05 tholo Exp $$OpenBSD: glob.c,v 1.5 1997/04/12 19:05:48 millert Exp $$OpenBSD: getttyent.c,v 1.3 1996/09/15 09:31:03 tholo Exp $$OpenBSD: getpass.c,v 1.4 1996/12/04 23:02:13 chuck Exp $$OpenBSD: getmntinfo.c,v 1.2 1996/08/19 08:23:45 tholo Exp $$OpenBSD: getlogin.c,v 1.2 1996/08/19 08:23:41 tholo Exp $$OpenBSD: getgrent.c,v 1.6 1997/01/25 04:59:42 downsj Exp $$OpenBSD: getbsize.c,v 1.3 1996/08/19 08:23:04 tholo Exp $$OpenBSD: fts.c,v 1.7 1997/03/24 02:54:15 millert Exp $$OpenBSD: fstab.c,v 1.3 1996/08/19 08:22:51 tholo Exp $$OpenBSD: errx.c,v 1.2 1996/08/19 08:22:36 tholo Exp $$OpenBSD: disklabel.c,v 1.3 1996/09/15 09:30:58 tholo Exp $ d d d d d d d d d d d d d e e ex eh eX eP e@ e8 e0 e( d e e e e e d d e e e e e e e e e e e e e e e e e d$OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $ n p p q$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $ y { |$OpenBSD: sscanf.c,v 1.2 1996/08/19 08:33:07 tholo Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.2 1996/08/19 08:32:47 tholo Exp $$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $ ` H ($OpenBSD: getservent.c,v 1.3 1997/04/05 21:13:09 millert Exp $$OpenBSD: getprotoent.c,v 1.2 1996/08/19 08:28:52 tholo Exp $$OpenBSD: getnetent.c,v 1.7 1997/04/24 08:37:09 tholo Exp $$OpenBSD: gethostnamadr.c,v 1.25 1997/04/29 19:28:38 deraadt Exp $:$OpenBSD: md5crypt.c,v 1.7 1996/12/14 06:49:36 tholo Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz $OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.2 1996/08/19 08:27:46 tholo Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.10 1997/04/18 18:55:16 deraadt Exp $ $OpenBSD: getcwd.c,v 1.3 1996/11/27 22:00:45 millert Exp $$OpenBSD: getcap.c,v 1.4 1997/02/01 04:35:33 deraadt Exp $$OpenBSD: exec.c,v 1.5 1996/12/05 05:37:10 deraadt Exp $$OpenBSD: err.c,v 1.3 1996/08/19 08:22:30 tholo Exp $(p$OpenBSD: vfscanf.c,v 1.3 1996/09/15 09:31:46 tholo Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.2 1996/08/19 08:32:46 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $6$OpenBSD: res_query.c,v 1.9 1997/04/06 07:55:04 deraadt Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_debug.c,v 1.7 1997/04/30 05:54:43 tholo Exp $ d'B@;$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $ xph`XPH@8($OpenBSD: nsap_addr.c,v 1.3 1997/03/13 19:07:34 downsj Exp $$OpenBSD: inet_pton.c,v 1.2 1997/04/13 05:08:24 deraadt Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_network.c,v 1.6 1997/04/24 08:35:21 tholo Exp $$OpenBSD: md5c.c,v 1.9 1997/04/30 05:56:06 tholo Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.2 1996/08/19 08:27:48 tholo Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $$OpenBSD: syslog.c,v 1.2 1996/08/19 08:26:33 tholo Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getdomainname.c,v 1.2 1996/08/19 08:23:22 tholo Exp $(8X@ ʘ$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: wbuf.c,v 1.2 1996/08/19 08:33:15 tholo Exp $$OpenBSD: vsnprintf.c,v 1.2 1996/08/19 08:33:14 tholo Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: perror.c,v 1.2 1996/08/19 08:32:56 tholo Exp $$OpenBSD: fputs.c,v 1.2 1996/08/19 08:32:43 tholo Exp $Ҁ`ؔPp,؜P$OpenBSD: res_send.c,v 1.4 1997/03/13 19:07:41 downsj Exp $$OpenBSD: res_init.c,v 1.14 1997/04/13 21:30:43 provos Exp $$OpenBSD: res_comp.c,v 1.7 1997/04/30 05:54:44 tholo Exp $$OpenBSD: inet_addr.c,v 1.5 1997/04/05 21:13:10 millert Exp $$OpenBSD: _def_time.c,v 1.2 1996/08/19 08:28:18 tholo Exp $$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $ $OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: gethostname.c,v 1.2 1996/08/19 08:23:35 tholo Exp $`$OpenBSD: localtime.c,v 1.10 1997/04/02 03:57:30 deraadt Exp $WILDABBR$OpenBSD: asctime.c,v 1.3 1997/01/14 03:16:42 millert Exp $4 45(679 $OpenBSD: sprintf.c,v 1.2 1996/08/19 08:33:06 tholo Exp $$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: printf.c,v 1.2 1996/08/19 08:32:57 tholo Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $=@>?(?@$@A8ABFH$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $HhHJP$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.3 1996/08/19 08:30:05 tholo Exp $QP[[\] <^_Hb0ggghgijlklll m(mmno4o|oomn$nno4o|oomppq0tH~h$OpenBSD: opendir.c,v 1.3 1996/09/07 19:04:06 tholo Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.2 1996/08/19 08:21:55 tholo Exp $$OpenBSD: seekdir.c,v 1.2 1996/08/19 08:25:43 tholo Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.2 1996/08/19 08:25:35 tholo Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.3 1996/08/19 08:33:00 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.2 1996/08/19 08:20:25 tholo Exp $$OpenBSD: hash.c,v 1.4 1996/09/15 09:30:47 tholo Exp $$OpenBSD: bt_open.c,v 1.4 1996/08/26 00:17:14 deraadt Exp $$OpenBSD: bt_get.c,v 1.3 1996/08/19 08:20:06 tholo Exp $$OpenBSD: bt_conv.c,v 1.3 1996/08/19 08:20:03 tholo Exp $$OpenBSD: bt_close.c,v 1.3 1996/08/19 08:20:01 tholo Exp $ $OpenBSD: snprintf.c,v 1.2 1996/08/19 08:33:06 tholo Exp $$OpenBSD: mktemp.c,v 1.8 1997/04/07 22:48:50 millert Exp $$OpenBSD: hash_log2.c,v 1.3 1996/08/19 08:20:38 tholo Exp $$OpenBSD: hash_func.c,v 1.4 1996/09/15 09:30:49 tholo Exp $$OpenBSD: hash_buf.c,v 1.4 1996/10/14 22:17:27 downsj Exp $$OpenBSD: bt_put.c,v 1.3 1996/08/19 08:20:11 tholo Exp $$OpenBSD: bt_delete.c,v 1.3 1996/08/19 08:20:05 tholo Exp $$OpenBSD: bt_split.c,v 1.3 1996/08/19 08:20:16 tholo Exp $$OpenBSD: bt_seq.c,v 1.3 1996/08/19 08:20:14 tholo Exp $$OpenBSD: bt_search.c,v 1.3 1996/08/19 08:20:13 tholo Exp $$OpenBSD: bt_utils.c,v 1.3 1996/08/19 08:20:17 tholo Exp $$OpenBSD: bt_overflow.c,v 1.3 1996/08/19 08:20:09 tholo Exp $$OpenBSD: bt_page.c,v 1.3 1996/08/19 08:20:10 tholo Exp $$OpenBSD: mpool.c,v 1.4 1996/09/15 09:30:51 tholo Exp $p$OpenBSD: fprintf.c,v 1.2 1996/08/19 08:32:41 tholo Exp $ 0000000000000000$OpenBSD: fvwrite.c,v 1.3 1996/10/26 06:58:58 tholo Exp $$OpenBSD: isnan.c,v 1.3 1996/08/19 08:17:39 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:17:38 tholo Exp $ABXD}A@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?q $OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.2 1996/08/19 08:32:54 tholo Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $ dd `d$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $w$OpenBSD: _def_numeric.c,v 1.2 1996/08/19 08:28:16 tholo Exp $y $OpenBSD: _def_monetary.c,v 1.2 1996/08/19 08:28:14 tholo Exp $y@$OpenBSD: flt_rounds.c,v 1.2 1996/08/19 08:17:28 tholo Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: isatty.c,v 1.2 1996/08/19 08:24:32 tholo Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp ${|$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.24 1997/04/30 05:52:50 tholo Exp $$OpenBSD: stdio.c,v 1.2 1996/08/19 08:33:08 tholo Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.3 1996/09/15 09:31:06 tholo Exp $$OpenBSD: signal.c,v 1.2 1996/08/19 08:26:09 tholo Exp $P$OpenBSD: mmap.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: lseek.c,v 1.5 1997/04/26 08:50:12 tholo Exp $ h`$OpenBSD: sysctl.c,v 1.2 1996/08/19 08:26:28 tholo Exp $ $OpenBSD: scandir.c,v 1.2 1996/08/19 08:25:41 tholo Exp $$OpenBSD: rec_open.c,v 1.3 1996/08/19 08:21:05 tholo Exp $$OpenBSD: rec_seq.c,v 1.3 1996/08/19 08:21:10 tholo Exp $$OpenBSD: rec_get.c,v 1.3 1996/08/19 08:21:03 tholo Exp $$OpenBSD: rec_delete.c,v 1.3 1996/08/19 08:21:00 tholo Exp $$OpenBSD: rec_close.c,v 1.4 1996/09/15 09:30:53 tholo Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.3 1996/08/19 08:21:08 tholo Exp $$OpenBSD: hash_page.c,v 1.3 1996/08/19 08:20:39 tholo Exp $_hashXXXXXX$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.4 1996/09/15 09:30:48 tholo Exp $$OpenBSD: rec_put.c,v 1.3 1996/08/19 08:21:06 tholo Exp $/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat/bin/cat . ..MAKEDEVconsole ttykmemt@ mem!nullpH"zeropE@#eeprom$openprom%drumrf&klogq?'stdin(stdout)stderr@*ttyapJ@+ttybt@, fb-mouse. kbd/random@0srandom1urandom2prandom3arandom4fd0asV5fd0brk6fd0cs\7rfd0a@8rfd0bM9rfd0cc:sd0at@;rsd0a<@<sd0bq1=rsd0b>sd0csQ?rsd0c?@@sd0driArsd0dnBsd0epBCrsd0e:Dsd0fsS@Ersd0f=@Fsd0gtGrsd0gVHsd0htIrsd0h7Jsd0imKrsd0i@Lsd0jsPMrsd0j@Nsd0ktOrsd0k[@Psd0lpF@Qrsd0ldRsd0mrm@Srsd0mFTsd0ns^Ursd0n<Vsd0os[Wrsd0o=Xsd0ppDYrsd0pZsd1asT[rsd1aS\sd1brj]rsd1b ^sd1ct_rsd1c<@`sd1dmarsd1dbsd1etcrsd1eBdsd1fsWersd1ffsd1gfBgrsd1gKhsd1h irsd1hkjsd1isPkrsd1iMlsd1jt@mrsd1jnsd1ksX@orsd1kRpsd1ls\qrsd1l2rsd1msQsrsd1m^tsd1nf@@ursd1nvsd1ot@wrsd1oQxsd1ppG@y rsd1p# $OpenBSD: disktab.preinstall,v 1.2 1997/05/01 11:30:48 niklas Exp $ # Disk geometry and partition layout tables. # Key: # dt controller type # ty type of disk (fixed, removeable, simulated) # d[0-4] drive-type-dependent parameters # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # sc #sectors/cylinder, nc*nt default # su #sectors/unit, sc*nc default # se sector size, DEV_BSIZE default # rm rpm, 3600 default # sf supports bad144-style bad sector forwarding # sk sector skew per track, default 0 # cs sector skew per cylinder, default 0 # hs headswitch time, default 0 # ts one-cylinder seek time, default 0 # il sector interleave (n:1), 1 default # bs boot block size, default BBSIZE # sb superblock size, default SBSIZE # o[a-h] partition offsets in sectors # p[a-h] partition sizes in sectors # b[a-h] partition block sizes in bytes # f[a-h] partition fragment sizes in bytes # t[a-h] partition types (filesystem, swap, etc) # # All partition sizes reserve space for bad sector tables. # (5 cylinders needed for maintenance + replacement sectors) # #!/bin/sh - # # $OpenBSD: MAKEDEV,v 1.28 1997/05/14 15:41:21 niklas Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # st* ? tape # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # st* SCSI tape # ch* SCSI changer # uk* unknown SCSI # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppies # vnd* "file" pseudo-disks # ccd* concatenated disk devices # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # Call units: # Special purpose devices: # audio # openprom # bwtwo* # cgthree* # cgfour* # cgsix* # cgeight* # bpf* packet filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random random data source PATH=/sbin:/bin/:/usr/bin:/usr/sbin:/usr/etc this=$0 umask 77 case "$os" in # set os in the environment if not OpenBSD SunOS) add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo $1;; 10) echo a;; 11) echo b;; 12) echo c;; 13) echo d;; 14) echo e;; 15) echo f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt () { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } ;; *) add () { echo "$(( $1 + $2 ))" } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1 ;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" if [ "${arg1#xy}" != "$arg1" ] then unt=${arg1#xy} else unt=${arg1#*d} fi echo ${unt%*[a-p]} } ;; esac for i do unit=`expr $i : '[a-z][a-z]*\([0-9][0-9]*\)'` [ "$unit" ] || unit=0 case $i in all) sh ${this} std sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh ${this} cd0 st0 st1 rd0 sh ${this} fd0 fdB0 fdC0 fdD0 fdE0 fdF0 fdG0 fdH0 sh ${this} uk0 uk1 sh ${this} ss0 ss1 sh ${this} pty0 vnd0 vnd1 vnd2 vnd3 audio tun0 tun1 tun2 tun3 sh ${this} ccd0 ccd1 ccd2 ccd3 sh ${this} bpf0 bpf1 bpf2 bpf3 sh ${this} ipl sh ${this} bwtwo0 cgthree0 cgfour0 cgsix0 sh ${this} cgeight0 sh ${this} lkm random local ;; floppy) sh ${this} std random sh ${this} fd0 sd0 sd1 ;; ramdisk) sh ${this} std random sh ${this} fd0 sd0 sd1 rd0 cd0 ;; std) mknod console c 0 0 mknod tty c 2 0 ; chmod 666 tty mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr mknod ttya c 12 0 mknod ttyb c 12 1 mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgthree*) mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour*) mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; audio) mknod audio c 69 0; chmod 666 audio ;; openprom) mknod openprom c 70 0; chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; ipl) rm -f ipl mknod ipl c 59 0 chown root.wheel ipl ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; unit=`expr $i : 'fd.*\(.\)$'` typnam=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${typnam}$unit rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 640 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit sixt=`mult $unit 16` mknod $name$unit c $chr `add $sixt 0` chown root.operator $name$unit chmod 640 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; # Note that telnetd, rlogind, and xterm (at least) only look at p-s. 4) offset=64 name=t;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -rf {tty,pty}$n mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ss*) unit=`trunc $i ss` rm -f ss$unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # backwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done # # Internet (IP) protocols # # $OpenBSD: protocols,v 1.5 1997/02/22 04:32:53 angelos Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol sip 41 SIP # Simple Internet Protocol sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA sipp-esp 50 SIPP-ESP # SIPP Encap Security Payload sipp-ah 51 SIPP-AH # SIPP Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP reserved 255 Reserved # # $OpenBSD: services,v 1.9 1997/02/11 04:16:35 gene Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos 750/udp kdc # Kerberos (server) udp kerberos 750/tcp kdc # Kerberos (server) tcp kerberos_master 751/udp kerberos-master # Kerberos admin server udp kerberos_master 751/tcp kerberos-master # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting icb 7326/tcp # Internet Citizen's Band 44` 4@444 44  4 ( 4D7 4H>4E4L4U4d4v4X4X4X444 4444 444%464 =4 L4 ^4 4 4 404!4x*434:4E4M4V_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset_sprintf_netif_debug_freelist_printf_putchar__randseed_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_errno_nbpg_exit_main_free_debug_close_alloc_edata_end_dvma_alloc___main_prom_bootfile_files_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.32dvma.ogcc2_compiled.___gnu_compiled_c/usr/src/sys/arch/sparc/stand/lib/kern/__main.o/usr/src/sys/arch/sparc/stand/lib/kern/bzero.o/usr/src/sys/arch/sparc/stand/lib/kern/urem.o/usr/src/sys/arch/sparc/stand/lib/kern/udiv.oalloc.omemcpy.omemset.oexit.ocloseall.oclose.oprintf.o# $OpenBSD: dot.commonutils,v 1.5 1996/12/09 07:05:19 deraadt Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # Installation utilites (functions), to get OpenBSD installed on # the hard disk. These are meant to be invoked from the shell prompt, # by people installing OpenBSD. # we know that /etc/fstab is only generated on the hard drive dest_dir=/ if [ ! -f /etc/fstab ]; then dest_dir=/mnt/ fi # counter for possible shared library confusion TAR=/bin/tar GUNZIP="/usr/bin/gzip -d" Set_tmp_dir() { def_tmp_dir=`pwd` if [ "$def_tmp_dir" = "/" -o "$def_tmp_dir" = "/mnt" ]; then def_tmp_dir="$dest_dir"usr/distrib fi echo -n "What directory should be used to find and/or store " echo "installtion" echo -n "files? [$def_tmp_dir] " read tmp_dir if [ "$tmp_dir" = "" ]; then tmp_dir=$def_tmp_dir fi if [ ! -d "$tmp_dir" ]; then /bin/rm -rf $tmp_dir mkdir -p $tmp_dir fi } Tmp_dir() { if [ "$tmp_dir" = "" ]; then Set_tmp_dir fi cd $tmp_dir } Load_fd() { Tmp_dir which= echo "Don't forget that you can't load from the drive you booted from." echo "" while [ "$which" != "0" -a "$which" != "1" ]; do echo -n "Read from which floppy drive ('0' or '1')? [1] " read which if [ "X$which" = "X" ]; then which=1 fi done echo "" echo "WARNING: during the floppy loading process, you should only" echo "use Control-C at the prompt." echo "" while echo -n \ "Insert floppy (hit Control-C to terminate, enter to load): " do read foo mount -r -t msdos /dev/fd${which}a /mnt2 cp -rp /mnt2/* . umount /mnt2 done } Load_tape() { Tmp_dir echo -n "Which tape drive will you be using? [rst0] " read which if [ "X$which" = "X" ]; then which=rst0 fi echo -n "Insert the tape into the tape drive and hit return to " echo -n "continue..." read foo echo "Extracting files from the tape..." $TAR xvpf /dev/$which echo "Done." } Extract() { Tmp_dir echo -n "Would you like to list the files as they're extracted? [n] " read verbose case $verbose in y*|Y*) tarverbose=v ;; *) tarverbose= ;; esac cat "$1"* | $GUNZIP | (cd $dest_dir ; $TAR -xp"$tarverbose"f - ) } dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: k $ifflags" > ${ETC}/hostname.$intf echo "" echo -n "WARNING: if you have any more ethernet interfaces, " echo "you will have to configure" echo -n "them by hand. Read the comments in /etc/netstart to " echo "learn how to do this." ;; esac echo "" echo -n "Making device nodes (may take a while)..." cd ${DEV} sh MAKEDEV all echo " done." sync echo "" echo "If you haven't already installed a kernel on the hard drive" echo "using your kernel-copy floppy, do so now. Kernel" echo "installation instructions can be found in the" echo "installation notes." } # $OpenBSD: dot.profile,v 1.5 1997/05/05 16:31:37 grr Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH umask 022 # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt100 dumb" TERM=sun # editors believed to be in $EDITBIN, smart and dumb defaults EDITORS="ed" EDITOR=ed DUMB=ed EDITBIN=/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /kern/rootdev / # set up some sane defaults echo 'erase ^H, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^H 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # get the editor preference if [ "X$TERM" = "Xdumb" -o "X$TERM" = "Xunknown" ]; then echo -n "$TERM can't handle $EDITOR" EDITOR="$DUMB" echo ", using $EDITOR as text editor!" elif [ "X$EDITOR" = "X$EDITORS" ]; then echo "Only one editor available, you get to use $EDITOR!" else _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported editors are: $EDITORS" echo -n "text editor? [$EDITOR] " read _choice if [ "X$_choice" = "X" ]; then _choice="$EDITOR" _forceloop="$_choice" else for _editor in $EDITORS; do if [ "X$_choice" = "X$_editor" ]; then _forceloop="$_choice" break fi done fi if [ "X$_forceloop" != "X" -a ! -x $EDITBIN/$_choice ] then _forceloop="" fi if [ "X$_forceloop" = "X" ]; then echo "Sorry, $_choice isn't available." _forceloop="" fi done EDITOR="$_choice" fi export EDITOR # pull in the functions that people will use from the shell prompt. . /.commonutils . /.instutils # run the installation script. install fi # $OpenBSD$ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # Installation configuration utilites (functions), to get OpenBSD configured # reasonably once it is installed on the hard disk. These are meant to be # invoked from the shell prompt, by people installing OpenBSD. Configure() { DEV=/dev ETC=/etc if [ ! -f /etc/fstab ]; then DEV=/mnt/dev ETC=/mnt/etc fi echo "You will now be prompted for information about this" echo "machine. If you hit return, the default answer (in" echo "brackets) will be used." echo "" echo -n "What is this machine's hostname? [unknown.host.domain] " read hname if [ "$hname" = "" ]; then hname=unknown.host.domain fi echo $hname > ${ETC}/myname proto_domain=`echo $hname | sed -e 's/[^.]*\.//'` echo "" echo "What domain is this machine in (this is NOT its YP" echo -n "domain name)? [$proto_domain] " read dname if [ "$dname" = "" ]; then dname=$proto_domain fi echo "" if [ -e $ETC/sendmail.cf ]; then echo "WARNING: A default sendmail.cf exists, and probably" echo "needs to be tuned and/or replaced, to work properly at" echo "your site!" else echo "WARNING: No default sendmail.cf installed. Did you" echo "forget to install the 'etc' distribution?" fi echo "127.0.0.1 localhost localhost.$dname" > ${ETC}/hosts echo "" echo -n "Does this machine have an ethernet interface? [y] " read resp case "$resp" in n*) ;; *) intf= while [ "$intf" = "" ]; do echo -n "What is the primary interface name " echo -n "(e.g. ed0, ep0, etc)? " read intf done echo -n "What is the hostname for this interface? [$hname] " read ifname if [ "$ifname" = "" ]; then ifname=$hname fi ifaddr= while [ "$ifaddr" = "" ]; do echo -n "What is the IP address associated with " echo -n "interface ${intf}? " read ifaddr done echo "$ifaddr $ifname `echo $ifname | sed -e s/\.$dname//`" \ >> ${ETC}/hosts echo -n "Does this interface have a special netmask? [n] " read resp case "$resp" in y*) echo -n "What is the netmask? [0xffffff00] " read ifnetmask if [ "$ifnetmask" = "" ]; then ifnetmask=0xffffff00 fi ;; *) ifnetmask= ;; esac echo -n "Does this interface need additional flags? [n] " read resp case "$resp" in y*) echo -n "What flags? [link0] " read ifflags if [ "$ifflags" = "" ]; then ifflags=link0 fi ;; *) ifflags= ;; esac echo "inet $ifname $ifnetmas#!/bin/sh # $OpenBSD: install.sh,v 1.10 1997/05/11 22:47:30 grr Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. DT=/etc/disktab # /etc/disktab FSTABDIR=/mnt/etc # /mnt/etc MSGBUF=/kern/msgbuf # message buffer vs. dmesg #DONTDOIT=echo VERSION=2.0 FSTAB=${FSTABDIR}/fstab getresp() { read resp if [ "X$resp" = "X" ]; then resp=$1 fi } echo "Welcome to the OpenBSD ${VERSION} installation program." echo "" echo "This program is will put OpenBSD on your hard disk. It is not" echo "painless, but it could be worse. You'll be asked several questions," echo "and it would probably be useful to have your disk's hardware" echo "manual, the installation notes, and a calculator handy." echo "" echo "In particular, you will need to know some reasonably detailed" echo "information about your disk's geometry, because there is currently" echo "no way this this program can figure that information out." echo "" echo "As with anything which modifies your hard drive's contents, this" echo "program can cause SIGNIFICANT data loss, and you are advised" echo "to make sure your hard drive is backed up before beginning the" echo "installation process." echo "" echo "Default answers are displyed in brackets after the questions." echo "You can hit Control-C at any time to quit, but if you do so at a" echo "prompt, you may have to hit return. Also, quitting in the middle of" echo "installation may leave your system in an inconsistent state." echo "" echo -n "Proceed with installation? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) echo "OK, then. Enter 'halt' at the prompt to halt the" echo "machine. Once the machine has halted, remove the" echo "floppy and press any key to reboot." exit ;; esac echo "" echo "To do the installation, you'll need to provide some information about" echo "your disk." drivetype=sd sect_fwd="" type=SCSI # find out what units are possible for that disk, and query the user. driveunits=`ls /dev/${drivetype}?a | sed -e 's,/dev/\(...\)a,\1,g'` if [ "X${driveunits}" = "X" ]; then echo "FATAL ERROR:" echo "No devices for disks of type '${drivetype}'." echo "This is probably a bug in the install disks." echo "Exiting install program." exit fi prefdrive=${drivetype}0 echo "The following ${drivetype}-type disks are supported by this" echo "installation procedure:" echo "${driveunits}" echo "Note that they may not exist in _your_ machine; the list of" echo "disks in your machine was printed when the system was booting." while [ "X${drivename}" = "X" ]; do echo -n "Which disk would like to install on? [${prefdrive}] " getresp ${prefdrive} otherdrives=`echo "${driveunits}" | sed -e s,${resp},,` if [ "X${driveunits}" = "X${otherdrives}" ]; then echo "\"${resp}\" is an invalid drive name. Valid choices" echo "are: "${driveunits} else drivename=${resp} fi done echo "" echo "Using disk ${drivename}." echo -n "What kind of disk is it? (one word please) [my${drivetype}] " getresp "my${drivetype}" labelname=$resp echo "" echo "You will now need to provide some information about your disk's" echo "geometry. This should either be in the User's Manual for your disk," echo "or you should have written down what OpenBSD printed when booting." echo "(Note that he geometry that's printed at boot time is preferred.)" echo "" echo "You may choose to view the initial boot messages for your system" echo "again right now if you like." echo -n "View the boot messages again? [n] " getresp "n" case "$resp" in y*|Y*) less -rsS $MSGBUF ;; *) echo "" ;; esac echo "You will now enter the disk geometry information" echo "" # 1st arg is 1 more than arg needed args () { eval echo \$\{$1\} } bytes_per_sect=`cat $MSGBUF | sed -n -e /^${drivename}:/p -e /^${drivename}:/q` bytes_per_sect=`args 10 $bytes_per_sect` echo -n "Number of bytes per disk sector? [$bytes_per_sect] " getresp $bytes_per_sect bytes_per_sect="$resp" cyls_per_disk=`cat $MSGBUF | sed -n -e /^${drivename}:/p -e /^${drivename}:/q` cyls_per_disk=`args 4 $cyls_per_disk` echo -n "Number of disk cylinders? [$cyls_per_disk]" getresp $cyls_per_disk cyls_per_disk="$resp" tracks_per_cyl=`cat $MSGBUF | sed -n -e /^${drivename}:/p -e /^${drivename}:/q` tracks_per_cyl=`args 6 $tracks_per_cyl` echo -n "Number of disk tracks (heads) per disk cylinder? [$tracks_per_cyl]" getresp $tracks_per_cyl tracks_per_cyl="$resp" sects_per_track=`sed -n -e /^${drivename}:/p -e /^${drivename}:/q $MSGBUF` sects_per_track=`args 8 $sects_per_track` echo -n "Number of disk sectors per disk track? [$sects_per_track]" getresp $sects_per_track sects_per_track="$resp" cylindersize=`expr $sects_per_track \* $tracks_per_cyl` cylbytes=`expr $cylindersize \* $bytes_per_sect` disksize=`expr $cylindersize \* $cyls_per_disk` echo "" echo "Your disk has a total of $disksize $bytes_per_sect byte sectors," echo "arranged as $cyls_per_disk cylinders which contain $cylindersize " echo "sectors ($cylbytes bytes) each." echo "" echo "You can specify partition sizes in cylinders ('c') or sectors ('s')." while [ "X${sizemult}" = "X" ]; do echo -n "What units would you like to use? [cylinders] " getresp cylinders case "$resp" in c*|C*) sizemult=$cylindersize sizeunit="cylinders" maxdisk=$cyls_per_disk ;; s*|S*) sizemult=1 sizeunit="sectors" maxdisk=$disksize; ;; *) echo "Enter cylinders ('c') or sectors ('s')." ;; esac done echo -n "" echo -n "Size of OpenBSD portion of disk (in $sizeunit) ? [$maxdisk] " getresp "$maxdisk" partition=$resp partition_sects=`expr $resp \* $sizemult` part_offset=0 if [ $partition_sects -lt $disksize ]; then echo -n "Offset of OpenBSD portion of disk (in $sizeunit)? " getresp part_offset=$resp fi badspacesec=0 if [ "$sect_fwd" = "sf:" ]; then badspacecyl=`expr $sects_per_track + 126` badspacecyl=`expr $badspacecyl + $cylindersize - 1` badspacecyl=`expr $badspacecyl / $cylindersize` badspacesec=`expr $badspacecyl \* $cylindersize` echo "" echo -n "Using $badspacesec sectors ($badspacecyl cylinders) for the " echo "bad144 bad block table" fi sects_left=`expr $partition_sects - $badspacesec` units_left=`expr $sects_left / $sizemult` echo "" echo "There are $units_left $sizeunit left to allocate." echo "" root=0 while [ $root -eq 0 ]; do echo -n "Root partition size (in $sizeunit)? " getresp case $resp in [1-9]*) total=$resp if [ $total -gt $units_left ]; then echo -n "Root size is greater than remaining " echo "free space on disk." else root=$resp fi ;; esac done root_offset=$part_offset part_used=`expr $root + $badspacesec / $sizemult` units_left=`expr $partition - $part_used` echo "" swap=0 while [ $swap -eq 0 ]; do echo "$units_left $sizeunit remaining in OpenBSD portion of disk." echo -n "Swap partition size (in $sizeunit)? " getresp case $resp in [1-9]*) if [ $swap -gt $units_left ]; then echo -n "Swap size is greater than remaining " echo "free space on disk." else swap=$resp fi ;; esac done swap_offset=`expr $root_offset + $root` part_used=`expr $part_used + $swap` echo "" fragsize=1024 blocksize=8192 cat /etc/disktab.preinstall > $DT echo "" >> $DT echo "$labelname|OpenBSD installation generated:\\" >> $DT echo " :dt=${type}:ty=winchester:\\" >> $DT echo -n " :nc#${cyls_per_disk}:ns#${sects_per_track}" >> $DT echo ":nt#${tracks_per_cyl}:\\" >> $DT echo " :se#${bytes_per_sect}:${sect_fwd}\\" >> $DT _size=`expr $root \* $sizemult` _offset=`expr $root_offset \* $sizemult` echo -n " :pa#${_size}:oa#${_offset}" >> $DT echo ":ta=4.2BSD:ba#${blocksize}:fa#${fragsize}:\\" >> $DT _size=`expr $swap \* $sizemult` _offset=`expr $swap_offset \* $sizemult` echo " :pb#${_size}:ob#${_offset}:tb=swap:\\" >> $DT echo " :pc#${disksize}:oc#0:\\" >> $DT echo "You will now have to enter information about any other partitions" echo "to be created in the OpenBSD portion of the disk. This process will" echo "be complete when you've filled up all remaining space in the OpenBSD" echo "portion of the disk." while [ $part_used -lt $partition ]; do part_size=0 units_left=`expr $partition - $part_used` while [ $part_size -eq 0 ]; do echo "" echo -n "$units_left $sizeunit remaining in OpenBSD portion of " echo "the disk" echo -n "Next partition size (in $sizeunit) [$units_left] ? " getresp "$units_left" case $resp in [1-9]*) total=`expr $part_used + $resp` if [ $total -gt $partition ]; then echo "That would make the parition too large to fit!" else part_size=$resp part_used=$total part_name="" while [ "$part_name" = "" ]; do echo -n "Mount point? " getresp part_name=$resp done fi ;; esac done # XXX we skip partition d to avoid user confusion if [ "$ename" = "" ]; then ename=$part_name offset=`expr $part_offset + $root + $swap` _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pe#${_size}:oe#${_offset}" >> $DT echo ":te=4.2BSD:be#${blocksize}:fe#${fragsize}:\\" >> $DT offset=`expr $offset + $part_size` elif [ "$fname" = "" ]; then fname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pf#${_size}:of#${_offset}" >> $DT echo ":tf=4.2BSD:bf#${blocksize}:ff#${fragsize}:\\" >> $DT offset=`expr $offset + $part_size` elif [ "$gname" = "" ]; then gname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pg#${_size}:og#${_offset}" >> $DT echo ":tg=4.2BSD:bg#${blocksize}:fg#${fragsize}:\\" >> $DT offset=`expr $offset + $part_size` elif [ "$hname" = "" ]; then hname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :ph#${_size}:oh#${_offset}" >> $DT echo ":th=4.2BSD:bh#${blocksize}:fh#${fragsize}:\\" >> $DT part_used=$partition elif [ "$iname" = "" ]; then iname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pi#${_size}:oi#${_offset}" >> $DT echo ":ti=4.2BSD:bi#${blocksize}:fi#${fragsize}:\\" >> $DT part_used=$partition elif [ "$jname" = "" ]; then jname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pj#${_size}:oj#${_offset}" >> $DT echo ":tj=4.2BSD:bj#${blocksize}:fj#${fragsize}:\\" >> $DT part_used=$partition elif [ "$kname" = "" ]; then kname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pk#${_size}:ok#${_offset}" >> $DT echo ":tk=4.2BSD:bk#${blocksize}:fk#${fragsize}:\\" >> $DT part_used=$partition elif [ "$lname" = "" ]; then lname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pl#${_size}:ol#${_offset}" >> $DT echo ":tl=4.2BSD:bl#${blocksize}:fl#${fragsize}:\\" >> $DT part_used=$partition elif [ "$mname" = "" ]; then mname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pm#${_size}:om#${_offset}" >> $DT echo ":tm=4.2BSD:bm#${blocksize}:fm#${fragsize}:\\" >> $DT part_used=$partition elif [ "$nname" = "" ]; then nname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pn#${_size}:on#${_offset}" >> $DT echo ":tn=4.2BSD:bn#${blocksize}:fn#${fragsize}:\\" >> $DT part_used=$partition elif [ "$oname" = "" ]; then oname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :po#${_size}:oo#${_offset}" >> $DT echo ":to=4.2BSD:bo#${blocksize}:fo#${fragsize}:\\" >> $DT part_used=$partition elif [ "$pname" = "" ]; then pname=$part_name _size=`expr $part_size \* $sizemult` _offset=`expr $offset \* $sizemult` echo -n " :pp#${_size}:op#${_offset}" >> $DT echo ":tp=4.2BSD:bp#${blocksize}:fp#${fragsize}:\\" >> $DT part_used=$partition fi done echo "" >> $DT sync echo "" echo "THIS IS YOUR LAST CHANCE!!!" echo "" echo -n "Are you SURE you want OpenBSD installed on your hard drive? (yes/no) " answer="" while [ "$answer" = "" ]; do getresp case $resp in yes|YES) echo "" echo "Here we go..." answer=yes ;; no|NO) echo "" echo -n "OK, then. enter 'halt' to halt the machine. " echo "Once the machine has halted," echo -n "remove the floppy, and press any key to " echo "reboot." exit ;; *) echo -n "I want a yes or no answer... well? " ;; esac done echo "" echo -n "Labeling disk $drivename..." $DONTDOIT disklabel -w $drivename $labelname echo " done." if [ "$sect_fwd" = "sf:" ]; then echo -n "Initializing bad144 badblock table..." $DONTDOIT bad144 $drivename 0 echo " done." fi echo "Initializing root filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}a $name $DONTDOIT mount -v /dev/${drivename}a /mnt if [ "$ename" != "" ]; then echo "" echo "Initializing $ename filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}e $name $DONTDOIT mkdir -p /mnt/$ename $DONTDOIT mount -v /dev/${drivename}e /mnt/$ename fi echo "Installing boot block in root filesystem..." $DONTDOIT /usr/mdec/binstall -v ffs /mnt if [ "$fname" != "" ]; then echo "" echo "Initializing $fname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}f $name $DONTDOIT mkdir -p /mnt/$fname $DONTDOIT mount -v /dev/${drivename}f /mnt/$fname fi if [ "$gname" != "" ]; then echo "" echo "Initializing $gname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}g $name $DONTDOIT mkdir -p /mnt/$gname $DONTDOIT mount -v /dev/${drivename}g /mnt/$gname fi if [ "$hname" != "" ]; then echo "" echo "Initializing $hname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}h $name $DONTDOIT mkdir -p /mnt/$hname $DONTDOIT mount -v /dev/${drivename}h /mnt/$hname fi if [ "$iname" != "" ]; then echo "" echo "Initializing $iname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}i $name $DONTDOIT mkdir -p /mnt/$iname $DONTDOIT mount -v /dev/${drivename}i /mnt/$iname fi if [ "$jname" != "" ]; then echo "" echo "Initializing $jname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}j $name $DONTDOIT mkdir -p /mnt/$jname $DONTDOIT mount -v /dev/${drivename}j /mnt/$jname fi if [ "$kname" != "" ]; then echo "" echo "Initializing $kname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}k $name $DONTDOIT mkdir -p /mnt/$kname $DONTDOIT mount -v /dev/${drivename}k /mnt/$kname fi if [ "$lname" != "" ]; then echo "" echo "Initializing $lname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}l $name $DONTDOIT mkdir -p /mnt/$lname $DONTDOIT mount -v /dev/${drivename}l /mnt/$lname fi if [ "$mname" != "" ]; then echo "" echo "Initializing $mname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}m $name $DONTDOIT mkdir -p /mnt/$mname $DONTDOIT mount -v /dev/${drivename}m /mnt/$mname fi if [ "$nname" != "" ]; then echo "" echo "Initializing $nname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}n $name $DONTDOIT mkdir -p /mnt/$nname $DONTDOIT mount -v /dev/${drivename}n /mnt/$nname fi if [ "$oname" != "" ]; then echo "" echo "Initializing $oname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}o $name $DONTDOIT mkdir -p /mnt/$oname $DONTDOIT mount -v /dev/${drivename}o /mnt/$oname fi if [ "$pname" != "" ]; then echo "" echo "Initializing $pname filesystem, and mounting..." $DONTDOIT newfs /dev/r${drivename}p $name $DONTDOIT mkdir -p /mnt/$pname $DONTDOIT mount -v /dev/${drivename}p /mnt/$pname fi echo "" echo "Populating filesystems with bootstrapping binaries and config files" $DONTDOIT tar -cXf - . | (cd /mnt ; tar -xpf - ) $DONTDOIT cp /tmp/.hdprofile /mnt/.profile echo "" echo -n "Creating an fstab..." echo /dev/${drivename}a / ffs rw 1 1 | sed -e s,//,/, > $FSTAB if [ "$ename" != "" ]; then echo /dev/${drivename}e /$ename ffs rw 1 2 | sed -e s,//,/, >> $FSTAB fi if [ "$fname" != "" ]; then echo /dev/${drivename}f /$fname ffs rw 1 3 | sed -e s,//,/, >> $FSTAB fi if [ "$gname" != "" ]; then echo /dev/${drivename}g /$gname ffs rw 1 4 | sed -e s,//,/, >> $FSTAB fi if [ "$hname" != "" ]; then echo /dev/${drivename}h /$hname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$iname" != "" ]; then echo /dev/${drivename}i /$iname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$jname" != "" ]; then echo /dev/${drivename}j /$jname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$kname" != "" ]; then echo /dev/${drivename}k /$kname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$lname" != "" ]; then echo /dev/${drivename}l /$lname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$mname" != "" ]; then echo /dev/${drivename}m /$mname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$nname" != "" ]; then echo /dev/${drivename}n /$nname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$oname" != "" ]; then echo /dev/${drivename}o /$oname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi if [ "$pname" != "" ]; then echo /dev/${drivename}p /$pname ffs rw 1 5 | sed -e s,//,/, >> $FSTAB fi sync echo " done." echo "OK! The preliminary work of setting up your disk is now complete." echo "" echo "The remaining tasks are:" echo "" echo "To copy a OpenBSD kernel to the hard drive's root filesystem." echo "Once accomplished, you can boot off the hard drive." echo "" echo "To load and install the OpenBSD distribution sets." echo "Currently the hard drive's root filesystem is mounted on /mnt" echo "" echo "Consult the installation notes which will describe how to" echo "install the distribution sets and kernel. Post-installation" echo "configuration is also discussed therein." echo "" echo "GOOD LUCK!" echo "" # $OpenBSD: dot.hdprofile,v 1.5 1997/05/11 22:47:29 grr Exp $ # # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH umask 022 # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt100 dumb" TERM=sun # editors believed to be in $EDITBIN, smart and dumb defaults EDITORS="ed" EDITOR=ed DUMB=ed EDITBIN=/bin EDITUBIN=/usr/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES echo "Checking filesystems..." fsck -y echo "Mounting filesystems..." mount -a # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 echo '' # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # get the editor preference if [ "X$TERM" = "Xdumb" -o "X$TERM" = "Xunknown" ]; then echo -n "$TERM can't handle $EDITOR" EDITOR="$DUMB" echo ", using $EDITOR as text editor!" elif [ "X$EDITOR" = "X$EDITORS" ]; then echo "Only one editor available, you get to use $EDITOR!" else _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported editors are: $EDITORS" echo -n "text editor? [$EDITOR] " read _choice if [ "X$_choice" = "X" ]; then _choice="$EDITOR" _forceloop="$_choice" else for _editor in $EDITORS; do if [ "X$_choice" = "X$_editor" ]; then _forceloop="$_choice" break fi done fi if [ "X$_forceloop" != "X" -a ! \( -x $EDITBIN/$_choice -o -x $EDITUBIN/$_choice \) ] then _forceloop="" fi if [ "X$_forceloop" = "X" ]; then echo "Sorry, $_choice isn't available." _forceloop="" fi done EDITOR="$_choice" fi export EDITOR # pull in the functions that people will use from the shell prompt. . /.commonutils . /.instutils echo "Follow the installation directions to install the OpenBSD" echo "distribution sets." fi hX4 `@# ` & " $@` `T@ $!` &`@ג"@H*/+ # %"a  0  ""h #""t * #""l!` #""p@>> OpenBSD BOOT [%s] /bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@@h ## @"S  %#` L@ % % !% %+ %/ %- %Xt  b@";!@M㰀 2%b @"2! @MX 2@W   %@" a(@"t $t !8@"@@BBad format %d+%d+[%d+%d]=0x%x boot: short read x%@ < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  " @!"?@ ?# @! "` a ` @܀ 2 @?@?# @! a ?@ ?# @!" a  @" .@`@2.@ "@!p@\ 2k @@!d  .@  `耢 B .@.`.` ".`@!H`@4耢 2C @# %`@)  9 `.@ .` .` .``䀤   ?`@2$ @ "@! %` ?> "H "@!@ Đ #"h  %!   % #HĀb00"@   promprom0㿘 #"h  %@ %! (* % %"" $@!` %"cK` -  %* K   %# J  8*   $ap"K  *K ) K  * %!` ` %"#@ `&J@ -" @ % % *:  d` d s atJ@t J@  t#cL @"tJ@  @Can't open device `%s' Can't open network device `%s' 㿘@2  #bh ` @ !D$`  ! %!`  %"`"`$@2$@   |$`   $`  %" @ 4 04% %@ $`&` 2! % %  #c@  @s @ !0  #cx@   #c@  # "c # #bh`"| $$ 㿘# %a   ` ༟* `a   '@`20,6 * '@ 㿘  @& & $& (`   €@ " '@ 㿘 ` @@   %!` (`(`@0@ 㿘   @ @ & ? $ $"*@ 㿘 %!  4㿘 %!  8` @xmit: not a network device 㿘 `,  @V!(?@o`@w`?㿘  ,@Y €@b㿐 %`  !  !O`P/O O /O㿘㿐 %!     O ?X/O O /O㿐 %!  / 0T@㿘  㿘 %! t㿘@ #@b㿐 %!    %X %! p%x mac-address drop swap 6 cmoveX #"h # % $ a  a  Њ@*@` $ !.@! .` .` .` .` .`a` `€0  `@_a |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 %!` ! #`@ @XaX @ [ah '  @ Sap   @ Kax   "`"N@J2N`J@" 2 node %x property %s length %d > %d 㿘 %! `€  `  "x@ 㿘 $aޖ ??" *Invalid controller number prom_iopen: "%s" error=%d 㿘) $"쀢 ?D   @ %"x @4 8$ $  $ $`  @#H* @ *`@`@F $0` "`@$4` " @f$ @ & "  %"@#h 㿘# $b쀢    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘 #"l* @ !@ؒ ##d   #"      @Ð!     ##h #"l< #"t@;@ ?*@Ԣ &@ ` #"p ##h @ % $ ?( , H L\ T ` X` P d l  t$ p  $ *?  #hĈ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @\# 1?dvma_mapout㿘 #@(1 @J#h1㿘@ " ْ㿘 @㿘 $"  @  # "cp % "@0 $b "b㿘 $b ? "b #@{#pboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' #@ $p?7 &!  0 @'@]@ p ) %   $@Scp `# %a` $@ V  %! a` @'@=a`p@'  %  %"Ё 2  %"؁㿘 %"   % @  $"" $ v   "bа?  %  ? % 㿘 ;  < 㿘  #b @ 5(  " ?$Revision: 1.4 $ # x  %c㿘 '  "    "& %        @#%,@ @㨢ڰ? @㨰?0Ф     @#0Ő#@~,@`" " H";j" &."  v" 㿘 2  `?. &   &  @"  6 & @@6  ?@2@ @ ?   @@q&㿐`@? `2  ?7 x 8"  #’cؐ   @)  @\ XH   @ '@+'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ 8  /`7` @m !@ @8'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @;&  @*@0* @*  @ * `    ` @ `(*  `(#   `  @* * @ * ** 㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @o6` `B  & $ @*&@$@@W@S2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā  $ @  /-? 耦 Ā 2;  0ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`ˑ2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``'7@, @7@@͒,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p41a"'А ''ؐ 'ܐ' &`0ТX@' 2R??$ab  $`H ?#`H2 !#\#`@ ?#@   @. 6?# $c! %@ #Z c4#@ '\ ` !@?' % "ܐ $c@z ? %"P %``@pP ? $@c`  ǐ4'' $c %@E 2@?@< 27?ab $ `H $?2 #`H㌘"#\"#` @Κ#@ 4' % H"b? '@$ 2?@E 2 ?#'@` 㿘`&"@  &@ 㿘 &   ? @&@m.@& @"  #d d  e  f g #" ?+d +e+f+gd "@#rarp: bad socket. %d No response for RARP request  !h@>H? @ . 7Ɛ(7Ȑ /ʐ /ː 7` 7`#7`~7`7 `b7`7ܖ 4#\@ ؖ .  @!? &2`0`02 `0 @ 0 $ ? @  $??"aX & 0 $`㿘 $ @  5㿐@  %"bЀ  5@2?@ 2?`(2?`&2?`   ?`@$  ?p  @+ 8 'pt@  , #\ $#`ab   @`?  % H "b؀` %@ s  ""а?㽠P  @ x 'P 'T 'X '\ '` $'d ('h ,p'l 8 t@ L 'p ab  h `$#\#`@\ ?  %"x  |&&&&& 0&$&( D@ &, 㺈 ? ?a b?  (`? #\$#`@$ ?  %"`   d 'd@ hd .@ ?nfsread: short packet, %d < %ld 0 ' ' ' ' ' $' ($' ,''$''ab  ,#\$L#`@ܖ ? L `P %""В?@T@ 0  "@  % H"bа?㿘@2& % "b $`H"`H6  %` 2 ?& &` !&`$&`( ?nfs_open: must mount first. 㷈 %` ` @ ~  N n`/2N N /" N ` 0 \ @1 x   $<N   /   I  N  /.Ɣ>.0 .29 %>; $) `` &`;@ @ O /@ x@ x @ x N  ` %&`  耤@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # %! %% @    ݖ? b  #L @ Đ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   $0 4(2`82` <"` @ "`D :`0  @ ` J@(8(8    `J/`? `2> ` `!JJ@ 2+  `J2# &  J@;. .2J`;  `J@;"Є <` CD001㿐 (@( # @  - `(``(F b` @ Y   ꀢ   * @h… * *` *   *  *` * h @ʒ(g 8@@  - ```   ` `  `* *` * ` ` M`: @:7?L  *  / 2  !   @ ` *  **`    L  *  " M  ! M ̀?  g2 @ @  - `(``R(  gh 8  * *`  *   @ @@ ̀g@) @  @  &`  >   *@ * @ *@ &   * +   *  :@>  @ @㿘  @&  㷐 Y U@4 @N@I (O g  `2@  ,`(`)􀢨$ 2h g8' w" @ '@   B<& hB <2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 㿐` 0@0@ <ฐ ,@  Y x``* d `  0, 200@"x < *` @  ? " ? 6" ?% 0@㿘 ` `.` 8 U& `@&@`,D B @< h "8&` ` @0$`@  ` ``d@  0, 2`0@ր$` ``T,ʬ& 㿐  `Pe8P @  4`0*:  8  2`0 8 `0e8e@ `L  Ȁ)x 2; @T`0$  " @ [ `d   +   0 @$ $  $&@&   b 8   @  "@ & 㿐`Q  `<@@ 3 2:@ "  2  F  2  &*@ B`<@@@8Ӑ@2 ``@ː 㻀  @Ґ Ц @v &`@@ $  ```찒`@2 %\F!T@  0@@eg`0 @i   t`$ `  'b`L@  @7<`/2L@`L@ /"`L@"s   Ԓ  / ``4e `L@  /,@K谒X,@.S`(  2HL@ $D  A`;@b%(`8@= 0 S䰒)`@ A` 0`  d( @<O /' '`L@  @ `  0@7 @1@. Ё㿘 `&   " ` 0@    `` 0@ `@@  Ё 㿐 %`@@8 ``@B@ղ@@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   =<@`@@8@2.@``@.@.?,   " #" @ @ B <@  O @ B<@ 㿘  *  `&  %L?&  &%P%, %  0 :* * :>%0   t  Օ; %0 B >%0 H8  ;  L>%88  ; >%@ $@ @?@ * @:@ @?  $`D "`D" @  "@ $@"?? @callrpc: error = %d 㿐\`@?: 4 '?'??@_  '?ܐ '?'?Ȑ '?'?'?'?ز@ a? % # '?Ė&#\ " @ ?  %` @` &@" % H"bа?recvrpc: reject, astat=%d, errno=%d 㿘! %$"А@˖  %@ @2?``2 ?`` ` #@$"а??"@?2 % %h(  ? ?    ? %" #""#"( %h    getport: %s㾐a"@2 o'?' ''''p#\ #`  5   p'0 # %b! @!@ H$bа?㿐 .  & 8   % ."b"'@   (0  8   ` % "b  B<   % "b&?㿐  & 8 " `    % >"b$$ $ 'X22$`  ) "`J 2 #`#$@ $ c̀@  %   @€#̤``"   @$ %""а?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorUnknown error: code %d㿘`V "4*`@4w4w4x,4x,4x 4w4x,4x4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4w4x,4x,4x,4x,4x,4x,4x,4x,4x4x,4x,4w4w4w4w4w4w1 , 1 ) 1 & 1 # 1  !1 ! 1 !01 !H1 !`1 !1 !1  !1 !1 $# @a㿘i  ,  ". 0.".,.&   ""#..圐 0?喐 唐 咐 0叐 @͠L  0Ű傐 0 0sendudp: bad write (%d != %d)x @  . .<* @*@@ &6 & @&6 6 66''' ' @'@66&&&&&`  $!X  @ @ $ c@ 'ܖ@(@? !p@ereadudp: huge packet, udp len %ld x@ް?~ {ހ( (ꀢ u?@sp?2n?<  2g?퀢 2c?2 <]@u 2Y?怦&U?`` 2M? @|& 4  "` @2>? 6 % #@@~1?' ' '  '  @'@74  $$ $ $ ?$ $$ $ $ $  ??sendrecv: short write! (%d < %d)㿘   ) % <\q-  %"(?@@@, 4 2 "Ѐ   F$@$Ӧ`l     *  (Ї8*`J. 64 "2/?`"8" ?#   `(?`d((  `dh(* ( ?#㿘@㿘1 $#X.  .?   0.L ?  0.B  0?.?.`4  "@ ((*8"@ Є (@㿐 "< N -N $*` .! ؒ?*` @N  . ɒ?#*` @N  .   J @?    `&     ,` ` `  (  `߀` ܗ(2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s   $ P@ $ @ 'l@@C`@ ` 3 $`  &` @Ґ"ȠƐ @E . 7Ɛ(7Ȑ /ʐ /7 l7 n7 7 ! `7 777 ! l~$@ 4#\j .? lh! "'h@  `4```4` &`4`㿘 $@(㿐@ %"bЀ(2(?@ 2$?`(2 ?`&2?`  @?2?` $` *` * $`P@ ?㿘@ /`(+`&'` # `@   `6`` `6`6`` 6``6`6` 6` (6`  6`  2`  .2`@"`@@    @*0    @*`㿘 6 6 6......6? ??㿘?  @-    $`@&  "` ?` ?7 $`  $ : `0 `(   ((( $#`" @ `  ?  2 @ 2( 㿘'H'L'P'T $cx 'X @"cx@|H "@l exit㿘 "! 㿘  & 8 @ " @   ` 㿘  .  & 8   % $"b2  " @  `  ` @`$ %""Ѐ % ""а? $` *@㿘'L'P'T'X! $$# ""`@L#*㿘'H'L'P'T'X #T@ H㿘 #T@8 "#l `N@`%` N@ `* 4444|4|4|4|4|4|4|44|4|44H4|4|44|4(4|4|4\ L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ 0 x @ qN@ % i le0123456789abcdef㿈 #!J @, ?L?|/-\㿘 $`" ` #"(AJ@? 44 l44 4444 44 44P4H4@48404(4    4f4j4j4kH4kP4k4Zh4^4^4`t4`|4`4T4V4W84W4W4X|4x@` 40123456789abcdef/4= 4:44p'4sp-4,94:@4KU[4b 4j44ou424B4y444O4742P4044 (4  4,4J" 42 4:B4GH4EpNX41b 4lv4 414L84X44;x4p4 44,4 4;( 4t4~ (4:04:84G4{dP4TZ4e4xn4+x 44@44844V444 4 4204^'/ 4X7=4q0P41@[4Ri 4`u4Lt4k4T44:4p4P 44R)24x=4W8G4:pPX 4c4s4W}4 4 44S4`t44X|404M 44 4`"41: 4hI4U4H_4 |i4js 4|4kP44 4v44 444@ 444k4 l 4<4M,64f@4 PW4X`4=k4|q4n{4x 4p44 4t 4x4  444W44Zh4L/4`7 4?H4I4S]4he4`r4t{ 44/`4H44<4<4^44$440x4`|4,&404974,F4hM 4U4;\4,f4py4X449X444t4rx4,04P4p4kH 4  4  ' 4 0 4H 64 =4l C41 M4=8 S4 Z4( `4=P f4L l4n r4} | 4L 4 4=h 4P 4= 4m 4`  49 4| 4X 4 4< 4 4 4xP  4,` 40 4= 4 %4 . 4 =4 Q4 D ] 4 m 4 s4j ~4/ 4a 49 40 48 4|  4= 4 4 4 4 4 4 4 4` )4p 648 B4 L4 X4 h4 n4 |4 4@ 4 4d 4h 4 4 4 4 4 4 4 (4 44 @4 O4 a4 m4x t4x 4x 4x 4x 4x 4 4H 4Mh 4O 4X 4a( 4m !4n '4rx .4sp 54t @4xP G4yp M4 X4 ^4` g4 o4H x4 4 4 4@ 4 4` _max_htonl_getsecs_rpc_fromaddr_open_dvma_mapin_htons_MD5Updatelshldi3.omax.o_getsn_gateip.remmin.o___adddi3.urem_sendudp_getprop_netif_put_nfs_getrootfhmuldi3.o.mul.div___divdi3lshrdi3.onotdi2.osaveregs.o_socktodesc_devopen_obp_close___muldi3_bp_getfile_bp_server_addr_strtabgetsn.o.umul.udivucmpdi2.o___anddi3_hostnamestrncpy.o_getchar___ashldi3_xdr_string_encode_nfs_readdir_in_cksum_strcat_pgofset_MD5Final_hostnamelen___subdi3_arpwhohasmoddi3.ohtonl.o_strcmp_net_close_inet_addrscanc.o_strlen_strcpy_ether_sprintf_readudp_nfs_open_inet_ntoa_sprintf___xordi3_netif_debug_freelist_netif_close_strncasecmp_net_open_nfs_close_printfbcmp.o_MD5Initmul.o_sendether_file_systemulmax.o___builtin_saveregs_cd9660_closexordi3.oulmin.o_swapipmd5.o_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putcharhtons.oimax.o_arp_replyimin.ostrncmp.oashrdi3.o_strncpy_netdev_sock_nfs_lookupfhntohl.oadddi3.o_rpc_xid_nfs_readlinkumoddi3.oiordi3.o__randseed_nfs_read_strncmpntohs.o_strtablen_ip_convertaddr_nfs_seek_obp_strategystart_nfs_root_noderem.o_nfs_mountlmax.ocmpdi2.o_cd9660_writelmin.o_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot__main.o_rpc_pmap_list_prom_ioctl_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_srandom_obp_recv_strerrorsubdi3.o_file_system_nfs_prom0_close_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decodeqdivrem.o_ufs_open_nfs_stat_typesudiv.o_netmask___qdivrem__rtt_rpc_call_file_system_ufsumul.o_mountroot_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_writesdiv.o_rootpath_cd9660_open_xdr_inaddr_encode_memcpy_nameipstrcat.o_bp_whoamiudivdi3.o_cputyp_cd9660_stat_pgshift_rpc_pmap_num___moddi3_memcmpanddi3.o_prom0_iopen_ulmin_ulmaxskpc.o_cd9660_read_panicstrcmp.o_netif_open_prom_openashldi3.o___iordi3_cd9660_seek___umoddi3_peekchar_scanc___one_cmpldi2_etext_ifname_bzero___negdi2_getticksstrlen.ostrncasecmp.ostrcpy.o_readetherurem.o_prom_init_skpc_ndevs_loadfile_dvma_mapout_read___udivdi3_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errnosrandom.o_sockets_esym_intoa_nbpg___cmpdi2_lmin_nfsys_exit_lmax_main_free_sendrecv_debug_close_imin_domainnamelen_imax_alloc_edatabzero.o_ntohl_cngetc_fbuf_end_bcmp_dvma_alloc_bcea_getsnegdi2.o___ucmpdi2___lshldi3___main_netif_get_version_prom_bootfile_file_system_cd9660_prom0_xmit_bp_server_port_dbuf_ufs_close___lshrdi3_cd9660_readdir_ntohs_myip_files_devswdivdi3.o_minsrt0.oboot.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_sun4_idprom.44_dtab_stringbuf.51_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.60dvma.ogcc2_compiled.___gnu_compiled_cbootnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_promconf.ogcc2_compiled.___gnu_compiled_cversion.ogcc2_compiled.___gnu_compiled_c/usr/src/sys/arch/sparc/stand/lib/kern/libkern.obootparam.orarp.onfs.ocd9660.oufs.oalloc.orpc.oread.oopen.ostrerror.ogets.onet.oin_cksum.oarp.omemcpy.oether.omemcmp.oglobals.omemset.oexit.ocloseall.oclose.oprintf.o8\4 `@# ` #Ȥ" $@` `T@ ! c@"@H*/+  "b  0  "  " ̐ * " Ċ!` " @ bootxx%s: can't open device㿐@!@  "bآbؐ @    @p`@'   "@[%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐! @ Ц  ! @=` Ԣ @D  + ?# 2  !@*`   П  !@` @ Ѐ` !@`2@?@2 @a ~ 8@֒` `Ԁ@ Ʋ@  promprom0㿘   @ "   "#8 a"8 J*@J` )J  *@Can't open device `%s' 㿘@\  ` `@ "`  #8`#8`$@ 2$    c8@ 0  $    `ܒ`$`$` 㿘# b   ` ༟* `b   '@`20,6 * '@ 㿘  @S& & $& (`   €@V " '@ 㿘 " `@ 0(@ 㿘 @ $ ? $ "*@ 㿐 "  / 0T@㿘  㿘 " tInvalid controller number prom_iopen: "%s" error=%d 㿘) " ?D   @ # @Ԕ 8$ $  $ $`  @O# * @ *`@`@F $0` "`@$4` " @\$ @ & "  %"@&#@ 㿘# b    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘  đ* @  @x !   !      @c     !  <  ̚@;@ ?*@Ԣ &@ `   ! @   ?( , H L\ T ` X` P d l  t$ p   *?  Ĉ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @"1?dvma_mapout㿘 #@(1 @#@1㿘@ " ْ㿘 @ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"   ?@ * @:@ @?  a "a" @  "@ "?? ሀ@@    @*0    @*`2( 㿘'H'L'P'T b 'X @"b@|H @l#exit㿘 #x㿘  #H @ " @   ` 㿘  .  #H    $"c<2  " @  `  ` @`$ "#<  "#<? ̆` ́*@㿘'L'P'T'X! $"  @L"*㿘'H'L'P'T'X "ؒ@ H㿘 "ؒ@8 ! `N@`%` N@ `* 4(44(44444444 444`444444444 L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ΐ 0̐ x @ qN@ % i le0123456789abcdef㿈  $ @, ?L?|/-\㿘 Ȑ`"Ȓ `  J@ 4p44X4\4`4h44X44`   44 44 #40,4740=4F4O 4\4f4n4w4444 444` 44\44D4444 4  4, 45 48F4N4xV4^4g4\t4{44X44 4x444 L4 4<44#!/bin/sh # $OpenBSD: binstall.sh,v 1.5 1996/12/12 08:42:44 deraadt Exp $ # $NetBSD: binstall.sh,v 1.3 1996/04/07 20:00:12 thorpej Exp $ # vecho () { # echo if VERBOSE on if [ "$VERBOSE" = "1" ]; then echo "$@" 1>&2 fi return 0 } Usage () { echo "Usage: $0 [-hvt] [-m] net|ffs directory" exit 1 } Help () { echo "This script copies the boot programs to one of several" echo "commonly used places. It takes care of stripping the" echo "a.out(5) header off the installed boot program on sun4 machines." echo "When installing an \"ffs\" boot program, this script also runs" echo "installboot(8) which installs the default proto bootblocks into" echo "the appropriate filesystem partition." echo "Options:" echo " -h - display this message" echo " -m - Look for boot programs in (default: /usr/mdec)" echo " -v - verbose mode" echo " -t - test mode (implies -v)" exit 0 } PATH=/bin:/usr/bin:/sbin:/usr/sbin MDEC=${MDEC:-/usr/mdec} set -- `getopt "hm:tv" "$@"` if [ $? -gt 0 ]; then Usage fi for a in $* do case $1 in -h) Help; shift ;; -m) MDEC=$2; shift 2 ;; -t) TEST=1; VERBOSE=1; shift ;; -v) VERBOSE=1; shift ;; --) shift; break ;; esac done DOIT=${TEST:+echo "=>"} if [ $# != 2 ]; then Usage fi WHAT=$1 DEST=$2 if [ ! -d $DEST ]; then echo "$DEST: not a directory" Usage fi SKIP=0 case $WHAT in "ffs") DEV=`mount | while read line; do set -- $line vecho "Inspecting \"$line\"" if [ "$2" = "on" -a "$3" = "$DEST" ]; then if [ ! -b $1 ]; then continue fi RAW=\`echo -n "$1" | sed -e 's;/dev/;/dev/r;'\` if [ ! -c \$RAW ]; then continue fi echo -n $RAW break; fi done` if [ "$DEV" = "" ]; then echo "Cannot find \"$DEST\" in mount table" exit 1 fi TARGET=$DEST/boot vecho Boot device: $DEV vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET bs=32 skip=$SKIP sync; sync; sync vecho installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV $DOIT installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV ;; "net") TARGET=$DEST/boot.sparc.openbsd TMP=/tmp/boot.$$ vecho Target: $TARGET vecho Copying to temporary file. cp ${MDEC}/boot $TMP; chmod +w $TMP vecho Stripping $TMP strip $TMP vecho Creating header magic. printf '\01\03\01\07\060\200\0\07' | dd of=$TARGET bs=32 conv=sync vecho Concatenating boot code. dd if=$TMP of=$TARGET bs=32 skip=1 seek=1 rm $TMP ;; *) echo "$WHAT: not recognised" exit 1 ;; esac exit $?