@ fr4D$@"D$ #D$t4"D$<"D$8"D$ H"D$L"D$ P"jX PX1%Qu.UU1ҹu""X5 PX1% Quo"UU1ҹs"19ҜYX1ȩ""# "İ"#_1 " "$" (",""" "|"" ""\"?A?1A1/" 0) B )  `0F-F 5X"" /"hF D"T"p1퍆 P! 1ɎeSփ_^][ZYXϐT$ D$HPPg̀̀WD$|$ ffL$L$f_ÐVWt$ |$L$9s_^ON_^ÐVWĻA8ǀ8lt$|$L$)9r!L$ĻA8_^1ÐONL$ĻA8_^1ÐVWt$ |$L$9sf_^ÐONL$NOf_^ÐVWt$ |$L$)9rL$_^ONL$_^ÐL$L$L$몐VWĻAǀ8lt$ |$D$==AuAt=I t GIy|$PQ P~^ YXto1_^ĻA8ÐVWĻAǀ8lt$ |$D$r)w!1_^ĻA8Ð_^ĻAǂ8VW ĻAǁ8t$ |$T$==Auq%) uPRW] ZX)s1PIxu1X@u?)9s‰D$BJt uJ1dsW?UVW ĻAǁ8t$ |$T$)9s‰D$BJt uJ1s ? ĻAǁ8L$)ыT$t _^VWt$ |$T$BJt uJ1?L$)ыT$t _^ÐT$߿ ĻAǁ8ǁ8ÐT$߿ ĻAǁ8ǁ8ÐT$߿wl ĻAǁ8ǁ8ÐT$߿w@ ĻAǁ8ǁ8Ðǁ8ǁ8øÐT$߿w ĻAǁ8==Au$ uRRY[ Z ĻAuD$18ËT$߿w ĻAǁ8==Au( uRR[ Z ĻA3D$f18ÐT$߿0 ĻAǁ8==Au uD$f18ÐT$߿ ĻAǁ8==Au( uRRMZ Z ĻAD$18ËD$؎XjPːD$`hp x$P1ÐD$`hp xP$1@ËD$>AՠAJBHÐL$QA Q9u >AÐ >AuHÁ=AtݠA8B9u ى >A1|AG=H"9tWt$FXN\f8n<$f8n<0#VhN"فdڋFXN\Nt"5ĻAp@_^[Ð|$AH"$f8n<0#VhN"فd1ɎNt"5ĻAWNH"T$BXJ\b8j<ÐjjwP!D$$#XD$ tjTjj KjD$ tj7jj +jj jjjj PQRSUVW؎5H"CC_^][ZYXϐj jjjjjjjPQRSUVW؎D$( +D #0D$$zjdjj^jjPQRSUVW؎5p@T?AA_^][ZYXjjjjD$$PQRSUVW؎eO =l@tD$0tl@D$$?O _^][ZYXϜD$d$jjjPQRSUVW؎V =l@tl@N _^][ZYXϐPQR؎ >A@p` ?AZYXϐPQR؎$>A@pa ?AZYXϐPQR؎(>A@pb ?AZYXϐPQR؎,>A@pc ?AZYXϐPQR؎0>A@pd ?AZYXϐPQR؎4>A@pe ?AZYXϐPQR؎8>A@pf ?AZYXϐPQR؎<>A@pg ?AZYXϐPQR؎@>A@p`栰b ?AZYXϐPQR؎D>A@pa栰b ?AZYXϐPQR؎H>A@pb栰b ?AZYXϐPQR؎L>A@pc栰b ?AZYXϐPQR؎P>A@pd栰b ?AZYXϐPQR؎T>A@pe栰b ?AZYXϐPQR؎X>A@pf栰b ?AZYXϐPQR؎\>A@pg栰b ?AZYXϐVjjPQRSUVW؎\" \"PX!` ?Ap@ucp@P @p@ >At;CuP tC[ u\"$\"PX! juր AA_^][ZYXϜVjjPQRSUVW؎\" \"PX!a ?Ap@ucp@P  @p@$>At;CuP tC[ u\"$\"PX! jր AA_^][ZYXϜVjjPQRSUVW؎\" \"PX!b ?Ap@ucp@P @p@(>At;CuP tC[ u\"$\"PX!W jր AA_^][ZYXϜVjjPQRSUVW؎\" \"PX!c ?Ap@ucp@P @p@,>At;CuP tC[ u\"$\"PX! jMր AA_^][ZYXϜVjjPQRSUVW؎\" \"PX!d ?Ap@ucp@P @p@0>At;CuP tC[ u\"$\"PX! jր AA_^][ZYXϜVjjPQRSUVW؎\" \"PX!e ?Ap@ ucp@P @p@4>At;CuP tC[ u\"$߈\"PX!/ jր AA _^][ZYXϜVjjPQRSUVW؎\" @\"PX!f ?Ap@@ucp@P  @p@8>At;CuP tC[ u\"$\"PX!wj%ր AA@_^][ZYXϜVjjPQRSUVW؎\" \"PX!g ?Ap@ucp@P $@p@<>At;CuP tC[ u\"$\"PX!jmր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰`栰b ?Aq@ucp@P (@p@@>At;CuP tC[ u]"$]"PXjր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰a栰b ?Aq@ucp@P ,@p@D>At;CuP tC[ u]"$]"PXGj ր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰b栰b ?Aq@ucp@P 0@p@H>At;CuP tC[ u]"$]"PXj 9ր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰c栰b ?Aq@ucp@P 4@p@L>At;CuP tC[ u]"$]"PXj }ր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰d栰b ?Aq@ucp@P 8@p@P>At;CuP tC[ u]"$]"PXj ր AA_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰e栰b ?Aq@ ucp@P <@p@T>At;CuP tC[ u]"$߈]"PXWj ր AA _^][ZYXϜVjjPQRSUVW؎]" @]"PX桰f栰b ?Aq@@ucp@P @@p@X>At;CuP tC[ u]"$]"PXjIր AA@_^][ZYXϜVjjPQRSUVW؎]" ]"PX桰g栰b ?Aq@ucp@P D@p@\>At;CuP tC[ u]"$]"PXjր AA_^][ZYXϤ\<d T   @p4h8lQ y1aQ XpX8`P XpSVWp@# AAt AAs$@_^[Ð[p@# AAt AAs$=l@tD$0tl@> _^][ZYXϐp@p@捃p@1=Attp@搐p@np@W|$T$ 1r]ك)==Au?t8?GGG GGGGG G$G(G,G0G4G8G<@Iuˉ_socketcontrollerdriveslotdrq2drqiosiziomemsizeportirqfunctiondevbuschannelluntargetphyUEU txuP@x uP@ÐUSEU Mt(xt @&PPx t@ [ÐUWVS]} Mu519sC{ u Sf C9r!Sfm{ tSff[^_ÐUWVS]u Mu919sG{ u S1f Cf9r#Sfo{ tSff[^_ÐUWVS]u Mu919sG{ u S1 C9r"So{ tS[^_ÐUWVS]} Mu119s?{ uSC9r"Sm{ tS[^_drive at %s channel %d drive %dUS]E tPh!їCPCPh!赗]atapiscsi at %s channel %dUE tPh-"qE@Ph="YÐUEjj(PBÐUEjj(PBÐwdc_select_drive %s:%d:%d waiting for %dafter U WVS]} u PjSBЃjX VjjS}+"@tVWsCPh"a1e[^_ÐUVS]E  PjSBЃj E1 jjS@ЃjjSЃ| EE$Yu"V2F@ @t "= "ut@ "@Vh4P_1F,Dž^.t0\CF@0u u F.uN$ P"PP] u#Jd0."tWvFPhl*跍WVu d0.444G9"tFbPF.Ph*]F.u FbuFbt V F,DžD.t8j ]SEFEEEjh!Svf 44Oy1|9u fD.D64OyF@1uijVA^btF PjVBh'jjV }WvFPh*4OyF@ @t%"[^_Ðwdcstart: xfer %p channel %d drive %d UVS]0ty^C$upC@0 tjS@PЃtU"tFPsVh-}K$F@|.}d.F@D6VSF,Ѝe[^ÐU WVSu} p@ lAp@VWvYnƃ p@ӡ AAte[^_USp@ lAp@up@ӡ AAt]wdcintr: inactive controller wdcintr US]C$u"t h;/N1B"thY/2􍃘P\c$jPS@0Ћ]Ðata_reset_channel %s:%d for drive %d USEX0"tPsCPh/覉jSPCjIy]Ð%s channel %d: reset failed for drive 0 drive 1 U WVSu>u"j j(V@Ѓj jj(V@Ѓh  F.FbtSVǃ} te9tavFPh\0趈tuh|0虈tuh0|h0l9e[^_%s:%d: wdcwait_reset() end, st0=0x%x, st1=0x%x, reset time=%d msec U WVSu] 1hjV@Ѓj jVЈEhjV@Ѓj } jVЈE ut%}Mu }}=}|}},jd2 G^}}}}"t>gfff)REPEPvF%tPRh|1 ؍e[^_nonewdcwait %s:%d wdcwait: timeout, status %x error %x wdcwait: error %x U WVSu}E"t#vF2tPRh2aF)<LE9}~4"$t jVPPh2!jdjVЈÈ^(u,F$ t&hjV@ЃjVЈÈ^( j#E ;E[t,jVЈF)"$tPh"3zEe[^_wdctimeout timeoutatapiata type: %s c_bcount: %d c_skip: %d missing untimeoutU WVSu"thi4=p@ lAp@F$tjhu4V4t}4Rh4覄sh4薄sh4膄 f$jSVC0Ѓ h4VJ=p@ס AAt1e[^_ÐUWVSuF0xF,G0u9NS"PVS hSU R-] tfFtFU Bjf=DžU saG0t!"PC PVtU u1u DžG0t W4C9| CFFKyN@DžU B~s`G0 u "P PVT u5u DžG0ttG59|^^NKyE @jtgU sMG0u "P @PVeT u"G0ttG69|^^ N Ky~uF t F ~vFt$FN@G0tU} ppuf FNPt!%=u f FN`[^_ÐU WVSEx01ɋu@tSU RW@Љ)΃tF$PE PWB Ѝe[^_ÐU WVSEx01ɋu@tSU RW@Љ)΃tF$PE PWBЍe[^_%s: can use 32-bit16-bit, PIO mode %d, DMA mode %d, Ultra-DMA mode %dUS]C Ph8uCt h 9 h9SCPh9ACtCPh&9&C tC Ph49 h0]Ð%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d U WVS]s0~C,S@tkG0teu^ t$C<v<uSPC Ph9Y% f u#߃fSCCPC Ph<:*0u1B8\@p@ lAp@RWF  t oF t`"t2h; jh;jV7tPh;|F t"th;|두p@ӡ AAte[^___wdccommand_start %s:%d:%d U WVSuE xX "tWvFPh9=L|U  t V PjVBЃ;tz1}uC PCPCPV}}t u1tC fC ?C tEPEPEP,C tEPEPEPWV"t h>ze[^_Ð__wdccommand_done %s:%d:%d %02x __wdccommand_done before callback __wdccommand_done returned U WVSu} _ "t$F(PGPvFPh?@y F( t C fC F(tC @fC F)C C fC C tvC @ukjVЈCjVЉfSjVff CjVЈCjVЈCjVЈC C  t VJWVi"th@XxC t S6{tsCЃVO"t h?@ xe[^_Ðwdccommand %s:%d:%d: command=0x%x cylin=%d head=%d sector=%d count=%d precomp=%d UWVSu] EE}MMEEM ME$E"t9PPEPEPPEPPvFPhA9w0ˠ ]PjVBЃEPj!VBЃPjVBЃfPjVBЃEPjVBЃEPjVBЃEPj'VBЍe[^_Ðwdccommandshort %s:%d:%d command 0x%x U WVS]u }"tWVsCPht`7F@@F@sCPs3hwQ8VLeQ8WMi}u;y4tQ8y4uQ8‡ A8tۃy4tQ8LBVy4tQ8fMBW}ujY4uCQ8‘@Q8WMEQ8†6Q8‡"A8 utۋQ8[^_Ð%s: target %d synchronous at %sMHz, offset = 0x%x %s: target %d using asynchronous transfers UWVSu}uEEE H x BuE<I8CSMW;Eu ;UI Et1᠃}tU Ex4t{@8UPဋU Bf#f}t*UBtU f BfUBp E E@4Eu=EP8Bjh PS3(jh PSp3jhPS\3e[^_ÐUVSMY4uQ8 | A8@ } u:t1u Q86u A8@6tu Q8?A8@6ty4u Q8A8@y4u Q8A8@Ãy4u Q87A8@7ЃVAt tBPЃPRSu e[^UWVSu} ]ME‰>^ N ^F EFBu^NfF[^_Ð%s: brkadrint, %s at seqaddr = 0x%x U WVSuN4u V8‘ F8u/FPtVЅ1V8’ttF8ƀVt^4u V8’ F81tGt|u V8bF8@bȅu V8cF8@c P4"FPha4uW8W8†G8@PU RhhpFO4u!W8‘W8‡"G8 utۋW8e[^_%s: Spurious SCSI interrupt %s: Someone reset channel %c %s:%c:%d: parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) TagSCB %d - Abort %s Completed. Bus Device Reset%s: Unexpected busfree %s SEQADDR == 0x%x %s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) Unknown SCSIINT. Status = 0x%x ULWVSut%~4uV8uF8@tEBEAEEN4u V8 F8@ tkuV8V84 V8B4BN4u V8 F8@ uV8V84 V8B4BEA}AuEBuFPhsCV4UuV8¹ F8ȋ^HCD9s+CЉUB@t}u V86F8@6|E t']SFPhsCjSVWN4u V8=F8@=E܅uV8V8 F8@!DžtF8@ ^4u V8 F8@ u@uU1"9tA "9uM"}tMAp .8 2u V87 F8@7%PEPFPhsB~4u V8F8@P^4u V8bF8@bȅu V8cF8@c PE"htAtAXt(ƆU/V84!V8’"~4tދF8P4~4tڋF8ƀN4u V8‘ F8 W,N4uV8uF8@u V8=F8@=Eԅu V87 F8@7؉]mtt KJUEAt tEBEu V8$2 V8$2}Ԡ#pH0\ w t MxUBp 5 Atu@tPM@PhEt?jjWSEPEPVKE0}t?UB@ t3jh؃PEPMQR;W t UB@,jEPSMQEP]SjhctjSVqE }}tKU tPjjRM@$PEPEPVJUBp 4 FPhtt>1"9EtG "9Eu^4u V8bF8@bȅu+V8c(V8 uV8’ F8@c P4"ht4>V ~4uV8V8$ V8B$B~4tF8@ ~4tN4uV8>V8F8@>tF8~4uV8¹ F8ȋ^HCD9sCЉUB@u E}u[QWFPhtG=V8V8 V8 V8’M tPjjRU@$PA@tBRM@PV{H ~4bF8V~4RF8@ ~4NF8@ ~4JF8ƀV5V8 AV8’BUBp 1 Wh(u<~4tF8H ~4tF8ƀN4u5V8‘2V8‡9V8‡%F8 utېV8e[^_Ðahc_intr: AWAITING_MSG for negotiation, but no negotiation needed U VSuE X x Bu[CE8CЊK8Kuu}ЄtCPVMSWt@CEEPVHCECPEPRVuuVRhh~5e[^ÐBus Device Reset Message Sent Abort Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting messageSCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xU WVS]}ǃpǃlG{4u S84p@ lAp@VEP@p@ӡ AAt'ф NVUR?V MqTt Ve[^_UVSM1ېy4t>A8y4tA8q4u=Q8 :Q8 ސQ8뾐Q8"A89u>t܋A8ƀy4uQ8  A8u CN[^%s: cannot malloc scb_data! shared data%s: unable to allocate tmode_tstate. Failing attach Twin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, Wide Single Channel %c, SCSI Id=%d, %d/%d SCBs %d SCBs %s: Host Adapter Bios disabled. Using default SCSI device parameters %s: Downloading Sequencer Program...UV8?V84V8XF8@0E ] uEEU9UEAJ]~%tEBKم}])ˉ€}BuU[ǃj W4{t tG \"G G N4MuUV8 F8UD ظMfE؋E؃u.ڃpE#E ¸u%E&}uUV8p F8UDpE܋MPSVG }u6G 4t,EغEtRSVɳG tG } tG G GUEfMffǀfǀEE9E$UffdžFHH~4F8HA~4F8PB~4F8PC~4~F8HD~4xF8HE~4vF8PF~4rF8PG~4nF8PH~4dF8HI~4bF8PJ~4^F8PK~4ZF8HL~4ZF8@ ~4VF8@! ~4RF8@" ~4NF8@#~4JF8@$~4FF8@% ~4BF8@&~4>F8@'~4:F8@M~46F8@N~42F8@O~4.F8@V~4*F8@W@tS~4F8ƀ~4F8ƀ~4F8ƀ~4F8ƀ~4F8@>~4F8@?~4F8@4JtZ~4F8HXV;Vh1e[^_ÐUlWVS}EEEO q p@E lAp@]ċVTU9~\tp@ӡ AAIuwtPS JF`f@CuV8 | -F8@ }"FPh%V jjj@PEPUUREPV 2SVK ~4uV8 F8jjj@PUREPURV t^N4u3V8 0N8E7V8:F8EMtŋF8U䈐~4tƋF8PF~4tV8;V8&V8M~4tV8BM`"PShPN4u V8‘ F8 uwtOV8_SVCp s@Ph(V8‡V8‡Up@U AAEt-Ze[^_ÐU WVSuEE~4u V8N F8@NEU1EFW8ENG8X>E4tG84uW8¹W8ސG8OH:QDrADPPhhQ4ƒURhEPURE PV tEPPWÃM]4uW8º0G8 jjjUREPUURE PW GHExE4t"G8U􈐐4uW8¹W8EݐG8؋OHA4AD9s0UREPUREPU RV t WEGH@E9Eetkދ[EPUREPEPU RVx tҋF@uU P,F@ P @Fu fDB`NVWvE듐4G8UEe[^_ÐDisconnected List inconsistency. SCB index == %d, yet numscbs == %d.UWVSuEEEN4u V8? F8@?E}$t>uV8,F8V8/~4tF8~4uV8¹V8ސF8NHQD9rRPhQƒjURURURU RP tLE} tSEPVÃ&]~4uV8º F8؃}u2$]~4uV8º F8؁}$t~4F8Ee[^_ÐU WVS]} M{4t C8K4u=S8º:S8ސS8 .S8BC8tЋC8ƀSgtC{4tC8{4tC8򈐺-S8ºS8?{4tC8P?e[^_ÐUMy4uQ8¹ A8ƀy4uQ8@Q8º Q8B@y4uQ8Q8@Q8B@ÐU WVS]u }K4uS8S8"C8Et݋C8򈐐K4u)S8º&S8 *S8>=C8tԋC8ƀSu[{4tC8P>{4u S8$eS8$YS86S8º:S8E={4tʋC8{4tƋC8򈐺{4t‹C8Ue[^_ÐUMy4u Q8 pA8@ py4u Q8 A8@ y4uQ8’ A8ƀUVSu~4uV8V8$ V8B$߈BN4u"V8V8 "V81F8tߋF8ڀj~n~4t͋F8V~4uV8V8 V8B Be[^ÐU^8àE[V8»^V8¼AaF8Ee#EftMtF8U~4tV8~4tV8AEЋFH@E9Em~4+F8M̈e[^_U WVS]{4tZS8s4u S8‡ C8tEu/S8,S8‡릐S8 C8@ȅtS8 Bs4uS8S8$C8@EtS8$B{4u S8C8@SFs4ufS8cS8 gS8EhS8$kS8mS8pS8BwS8†vC8@ȅtS8 B{4tC8UP{4tS8$B{4tC8P{4tC8{4tC8@{4tC8ƀ {4u S8C8A^~e[^_ÐU,WVSu} G8,G @PU芖!8Pu K JEA8PuEBʀ}BuQjEPG @PEPQUURՈ#E fuOG @tFjWVBu3jEPV,FHxEw t G f@ G f@ e[^_U,WVSuE X Cu}uU B<tt<u1rS!EA8uEB8u K J{ʀ}BuQjEPU B @PWQEPч#Ee[^_UUM zTuJXBTt BTHJTTQaicaic: probing for aic-chip STACK futzed at %d. AIC ID: %s chip revision %d U%d UWVS}_ C ED"thD"tCPwGPhWUREPÃuG,{$GC,G tK(C C%wSw"GC G CG$CC5p@ lAp@CUC Cu R5p@֡ AAt;Uu1Gs,WEPt)S)s,WUR| t S)e[^_aic_minphys US]D"thi@{<~C<SL]aic_poll U WVSu]F@E~DD"thtC}u W u G t VTE @t1h[YKue[^_U WVS}E w@WDU@$@ Xu$у؉$؋UBu]ȉE@u]`ȉ E@`u]ȉ E@u XUEXƇ[^_Ð%s: reselect with invalid selid %02x; sending DEVICE RESET should call debugger here (aic6360.c)%s: reselect from target %d lun %d with no nexus; sending ABORT UWVSu$"ЍBt?RFPh,hS D"@hlu@ȈE] Et6@$P f}URUtB$P f9zuff9Bu݃}uCPEPFPhh D"@_hl^MQt A B UB MQ AƆE)۸f $Ex(}LF@VDut BR 搐 *UB(@t&F@VDutԊ B MAAA 1y "F@VDut݊ B: "F@VDut݊ B e[^_selecting %d:%d %d:%d busy idle U WVS}G@EwDu V F _|C$H Q)$QrZD"tRAPhxSt C B C S CSWD"tRAPhl[YD"thG}u V F }u V F }u e[^_requesting sense UWVS}] C$EP UR)ЍD"thjS5UBCC C E4CC K(FC(tJf!F;u SWHSWG|Ct G|SP C_|W|S u We[^_aic_done resid=%d sense=0x%02x error=%d UWVS}u ^$C EP)ЍED"thy{,uLF(@t C,<t C,-~uFC(FCXVWDFC(KD"tBC(tPhC,uC4Ph PhF(tUJUf!B;uLJƇW^ VW& sVW5ES蟽 e[^_ÐUS]M A(tQuA Qt A B A Q A[aic_msgin n=%d imess=0x%02x %s at line %d: assertion failed %s: %d extra bytes from %d:%d message rejected %02x %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; %s: unexpected MESSAGE IN; sending DEVICE RESET U WVS]C@EsDD"thmu )1 }uV F t t,C@SDut3 B~e}u'V$ ʐ .FC@SDutъ B  }uVFGu<t<u$< ~0u'9tj}uV V(F}tF(}uV V F}tF Fy}uVufD"tPWhyLu%hCPh;hly$G P)Ѝ $,ddl,AG(ƃg &C@SDut׊ B( RD"tPhKNC@SDut B BƃAAAAA m CPhlh D"@t:hlCPhcD"@thlC@SDuq B|7CPhhS D"@tihlPPSm VV(`CPh D"@thlC@SDut B}tF(}uV V F}tF F}uVuD"tPWhe[^_aic_msgout retransmitting %s: unexpected MESSAGE OUT; sending NOOP U WVS]{@sDD"thXt`FtPF(ui 9uCD"th t(F(V(묍V뜍)Vƃƃ ʈ H+$L0p<ppp$ppppppppppppppppppppppHu&hCPhhlW@$@ @ ƃ  ƃ vƃ  jƃ ^ƃ KV @V CPh,WD"@thl趿ƃ  uV F t tAxF @V @0PV@4uu tF @t̋P@FIFt uVuIF e[^_%02x%02x %d> extra data +%d UWVSE} P@U@DEEED"tDu ƒ uF P}u U UBPh}cuF }BE@}"UB}uF.f}uUE URUE(t݊E O}Em}t@Uff@Ufo吉UfoUUnU]D"tShE]~+}{Uffكσ~B}dE@Ȑ}bU߃}XE@}}}tfUB}uU u 퐋uF t}t,E@D"hUѐU뙐U.fUBUU }uUE URUE u-t؃}uU u ŐUB tE }u UUBȃ}uEU BU QUB"WU/qUB wUyuF ~9)M}tE@ }tUB"D"tQh=}tuF/}tE@ }tUBEe[^_>%d UWVSEP@UpDED"t7uV F P}uVFPh裾}u VF}u VF}u VF}uV.^F.R}u VEVUE0tEtAEm}t@V} ffm @V} fm㐐}u>V;V} fm|VV} lVFUU9vE]D"tSho)]]~'}tV} ffE$E ]~:}hF}fV} ] }[FE ui}}uY}u VF}u V u F t}u VFD"th莼}u V/F/}u V F }u VFEe[^_aicintr sstat1:0x%02x %s: SCSI bus reset %s: SCSI bus parity error sstat0:0x%02x %s: target mode selected; going to BUS FREE reselected backoff selector selected %s: selection out while idle; resetting selection timeout %s: selection timeout while idle; %s: BUS FREE while not idle; state=%d %s: unexpected disconnect; sending REQUEST SENSE cmd=0x%02x+%d dataout dleft=%d datain %d target_stat=0x%02x %s: unexpected bus phase; resetting UWVS]C@ESDUt4BD"th.}uU EUŐUR UD"tEPhE t5CPhȹ U A bUCPh臹}tE@ uCC@SDut B: "C@SDut݊ B!}uU E UR UD"tEPh谸}}*CPh蕸} E@ U D"thZD"th&1u&hCPh hlwǃC|FtC|p S|C|B }u U UBƃ$E@qD"th9{t;CPhL^hkQ D"@Ihl謲u&hCPhhlF$H Q)Ѝƃ~(} ƃ F(@tƃ0O(If BGGG G$@u/O, `"Mb)RWh VƃUUU }ND"thvt;CPhhkյ D"@hl0u&hCPh蘵hl}0E@}.U}*E@ h8G$@,EUB2UUU `U UU/CPh誴Ph蕴 D"@hl}>E@2}6UB}2E}.UB `}*E@ }&UB}"E@/ƃƃU U}tE@ t(x"au&h:CPh`hlˮuICPh4h' D"@thl膮VSRF$@,u&hlCPh̲hl7֋FFFtp B ǃu&hwCPhDhl语AU }tUB EZ}uUU!UB$}t܊UB=@gv==t[=t-L<<Sƃ<SƃD"tIu$hCPhhlUƃF HPPh İS)ƃhcD"thkS+)ƃD"th+S)ƃ@UB(Ou%hCPh裯hl}tE@(}uUUB UBA}tE@ D"tAPh65ƃCPhLD"@thlrS?QVh rVS'U)UƃSs}tՋUBe[^_ÐUVS]u F,N(@;uGC@SDut B [ 搐VSC|Ft C|VP Fs|S|V u Se[^timed out AGAIN U WVSuF$@ x P芣 h 蕭 p@ lAp@F(@th l'h WF$@,VW p@ӡ AAte[^_,%xRESET UVSuF$p F$@ uG1;^ }/th ׬3Ph ¬C;^ |уh 謬h 蛬e[^acb@%p xs=%p flags=%x dp=%p dleft=%d target_stat=%x US]s(s$ShD 1CPsshl S]ready list: nexus: nexus list: UVSH"0h Ы^|tSo[uh 褫t PBh ~tS[ue[^Ðaic6360: SCSISEQ=%x SXFRCTL0=%x SXFRCTL1=%x SCSISIG=%x SSTAT0=%x SSTAT1=%x SSTAT2=%x SSTAT3=%x SSTAT4=%x SIMODE0=%x SIMODE1=%x DMACNTRL0=%x DMACNTRL1=%x DMASTAT=%x FIFOSTAT=%d SCSIBUS=0x%x UVSEp@XDuSCPu SCPu SCPuPhu SCPu SCPu S C Pu S C Pu S C PhouSCPu SCPh ;uSCPu SCPu SCPh, uSCPu SCPhl迨e[^nexus=%p prevphase=%x state=%x msgin=%x msgpriq=%x msgoutq=%x lastmsg=%x currmsg=%x tinfo%d: %d cmds %d disconnects %d timeouts %d senses flags=%x UVS]Ph PPh7ŧPPPPhL蘧1 ss3VhvCPshaF~ɍe[^advUUM }uz|u'z|uB|tB|HJ||Q4tHAÐUS]K|tABQ{|u ǃ[Ð%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d UWVSuF8jURj}Wjhh?P@$ЉÃ tSFPhLF8jVDRh?uWP@,ЉÃ tSFPhnF8V&&V. uV:hU&SV* @,ǃ SV=p@ס AAte[^_ÐUSU@ H p@ lAp@Qp@ӡ AAt>]Ð%s: exiting ccb not allocated! should call debugger here (adv.c)U WVS} Ep8URhX&Qf{$tA~ t&C tPMVF ЃEVFЃUu#EPh'Sh'辌G  ttg uC,C( C,C8ulC fxubGK$)ȃvSs C @$PEP- 3 u&u {4uC, C,EPURKS e[^_100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %d to TX_AVAIL_THRESH, read back %d. Interface disabled warning: unknown chipset, possibly 3c515? UWVSuE MV4U,U0Ufl}tEfBuH1SV+ۍfC fGfv(Uf뵐jPQ*P$FPh)轎 i@t1h)/Uf50f:h)s}tƋEf@,tË0f@}u"Uf0fUz,t܋0f@=t =t'=tƆo[ƆoOPhh)赍o@U̐f90f}to@̐UfBjEPFPE0ǀ>ǀ|PǀRf@4"ǀ2P;1URD,[0f@h<hX7jS4LEdž ([dž$\dž(x]fluoth4*~lH$x-X. .- .-0f.i@twV ,t΋0f@i@tKjjjjSVeF ujjj"SKj"SnL Uj S]LDV60f>WfkVfV,t0f@jjURF\P!dž`(,0tf_WQJ/X,0rf^VQ/e[^_ÐUVS]s4i@tjjPG jPMVBV/1e[^/%s (default %s) UWVSE,0EEtfFu(VffE%VfV fVfUT"EE#tCjss EPI}thM/щshO/辉S UMyUE4P%uiefF EP%uEu V fF f4"hR/:)URIe[^_(unknown/impossible media)/autoselect default %s%sUWVSE,0EtfAuQfQfAu!QE0f'AEU,tӋ0f@pE"EE#t@}thM/vhO/F Ejvv URG MyUE4 "00t0RPh0螇4)EP+He[^_ÐUWVSuF4E,0Eu Sfu "Ctj E}'~΃V= nt9,\0f@<fCfCnufC?,0f@1ɐu1 1A~܊n<w1ɐu TDA~勎,0U:fB(EPQW*,0UfBXEPQ'*,0f@u flu fluIyƅtNo@̐fCfltfCXfRSfo@S̐f밋0f?UXfU(f0f3S?fSfS1f0ffS1fS1f0fSxfSpfShfS fSHf$υgfhfCdfCi@t'Vb,F0f@HfCxHfCpHfChV_p V *fC ,fCHV UB4 @fB4Re[^_ÐUSMY4,u0f0f@,u'S4f}t 0f"0S4f}t fA[ÐUEp RÐU WVSE,0u SffCuS@ffC@huS@ffC@XE,0Eu ƒfEfpEPQ%(E,0Euƒf EfpEPQ%h+uS@f fC@e[^_ÐU WVSE,0tfCuDS fASfS f?Sf VE0fU,t܋0f@} E $l::$;@;:::@;:u$UnuS fUnufC pSfTtfCHS f=t .S f%E0fOt؉ fC h[Ult E,t0f@ufuCf fCȃe  M tf3tHfKE0fU,t܋0f@u@Sf=Sf\E K f;E0fKC?tËE  fCh7U,t0f@1e[^_Ð%s: media_status on unknown chipset 0x%x UWVSUu ,E0i@t;P; FFY0fF@Fl,t0f@h# }u1Wf.0f40fNGE,tŋ0f@epmU)F,t0f@F}uW fG t:N4F)0f*PBPh<{,tы0f@e[^_epstart: no header mbufU,WVSEE,U0MUB4%@f@MCuhp>kvsE)ueE 0~AUBTCu ǂCMSO Y}u3U f9|2AUoU̐f0UB 9}b}tЍAUo̐MfAEH5Uf5UUfUUf}tƋUfBMCu ǁCE}u&}FUf`U̘f"}FMf`̘UfBMA(t SP p@E Ap@UflEe}MEf4}UMfEn߅K v}sUUs t}tlsUUp@ xAp@Cf EAp@ҡ AAt7C{$t;SC$ЃsUUn뗐sUUo\5p@ xAp@4AS )‰ @ MɈ }uC DAC DA|A5p@֡ AAt+ԻA `A5p@ xAp@ = ~G4"W0AAuAA8z5p@֡ AAt߅/K v }sUUffS t}tjCDUMp@ xAp@Cf EAp@ҡ AAt_C{$t;SC$ЃCMMD떐sUUfo`5p@ xAp@4AK ) @ MɈ }uC DAC DA|A5p@֡ AAt+ԻA `A5p@ xAp@ = ~G4"W@0AAuAA8z5p@֡ AAt߅/mr%}uUU EUms܋M p@U AAEtE@P}u!UfluUfMfluUf|1}u UfMAuAEP >UR(&MQ e[^_U WVSu,0tfGu0Wf+Wf␐0fO,tߋ0f@ uut t V 1e[^_U WVS],0u flu0 flu0 t <tOdc`=v`ǃdSf =VHfttfFHfchd@du flu0 flu0Ȅe[^_ÐUWVSu,E0F4EE}tfGh}u"WfWhfW؀hf _tE}tމ؀hfGt VftffhEPPtV# +cVEP FEe[^_ÐUWVSE,EU0փ4uflu8fUflu8fL@u%PEP>Ãu FLFHSUF(t SPZjS !SEPVZ%UR^}u!Uflu8fUflu8fA?~1ۃ}uWfu !Gtj i C'~͍e[^_ÐU,WVSE,EU0Uu4MX8M=p@ xAp@pAuj5"hà ËpA=p@ס AAttYfCp@ xAp@fAp@Ћ AAtC{ {fCCjjÃu~1U@frUX9\ujRhHW7B}XQЅ}A$)‹MX{ {fCj CPsE C``=p@ xAp@=DAujj DAS t!+4A @ |AC DA=p@ס AAtgC t#CKC(C$C,C0CtCEUU p@M Ap@}flEe} }UXM=p@ xAp@pAuj5"h à ËpA=p@ס AAtatQfCp@ xAp@fAp@Ћ AAt'C{{fCjjd ÃuQEp@U AAEtu1wUXQЅ}A$)‹MXl}} `=p@ xAp@=DAujj DAS t!+4A @ |AC DA=p@ס AAtC t#CKC(C$C,C0Ct;M vM ΋}ntE~$}ts{UU}tf{UU~#}tR{UUffZK}uCUUC{UUm0{UUl{UUfm U}s )u E]} }UfB@1ɐ}uUfuU}GtFA?~1ې}uUfu%UBtj N C'~ƋM p@U AAEtWEe[^_UWVS] E0p@U pAp@EPS~4WUROE2i w%1i ! i t9i P5i tTwi tj96i(t<+UJ4UxV!EPWu SPUREPg)EEPB=E9P<P<EP4ЃAf@uVIUb4t@uVoVp V O1i uWEPc WURs"E}4uV:E EEp@U AAEtgEe[^_USp@ pAp@up@ӡ AAt]%s: device timeout USECPhRjbSz]ÐU WVSE,0i@tP% UfluS,uЋ0fU0f@u S1ffCu S1ffCuSffCuS@ffC@1Ʌu Sfu CCt:A?~1u Sfu Ctj G'~хu SPffCPuSffC(E,0Uu f UfzEPQ XU,0Euƒf UfzEPQP u ShffChuSxffCxuSpffCpuSffCURe[^_ÐU WVS}] E1uh7 uf Iyƍe[^_Ð %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! UWVS},E0Uc}u U fUB f}jdG sυuGPhU n<t"<t@tGPhUHc1e[^_ÐU WVSu} fluV4t1b0 f,t㋆0 fX Vuƒ,u0 f0@ e[^_ÐUWVSEEp@U pAp@E\E]}8<;5p@ xAp@pAuj5"h; ;pA5p@֡ AAt;t]f@p@ xAp@fAp@Ћ AAt;;@;PP;f@jj;<;t$UByE$)‰UE;XEU\;XtjRhHW5Up@U AAEte[^_ÐU WVS5p@ pAp@E]}8;tPm;E}~΋EǀXǀ\PhHW55p@֡ AAtXe[^_UVSMu ,u0f0 f0Bt⋑0 fB[^UVS]M ,u#0f ы0!f0Btދ0!fB[^UEM ,u 0f 0@!ÐUVSujV^jVIjV Kye[^ÐU WVSu} ]jVKtVjVjVB tjV jVjVjjV ue[^_U WVS]E,u0f0f@,u01f 0f@SjjSjjSju SjuSjSjSjSjSjS&jSlejSujSftMjS-NyÃjSpjS,u0f0f@1uEe[^_ÐUS],u0f0f@SwjjSjjSju SjuSjjSxjuSjjSjS0,u0f 0f@]ÐUVS],0tfAuQfQfAt Qf!0f&$߅tfA,t׋0f@[^U WVS}u 1ېu Vfu Ftj Y C'~эe[^_leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhookU WVSuVOjFDP~Wv0dž@mdžqdžlfFd"^0SS jjSFXP@v dž@@=tvw= t9=@tN=w=td=džDdžHdžDdžHrdžDdžHZdžD džHBdžD@džH*džDdžH Pht^TPPh^Y HDWh^YVhts>0 u h^TTdž\dž` D dHщh@ le[^_ÐUSp@ xAp@ukp@ӡ AAt>]ÐU2LzHf@LtH@ ~H pHf*hf1LtӋHf@LuH싖H$HB$߈Be } LtHf@HfzHffHmHfrH EfwHfLtHf@LtH8LtHf@LtHUfP h C LrHf@e[^_UVS]LthHf@} u Lu 1tHfH1tfBHf뒐HfbH(fHXfHfLtHf@Sk1j  LuHfuH@t F~h迱 L3Hf@(SL#Hf@XStVL Hf@LuH f틓H @fHB @fB h e[^Ðxl%d: bogus xcvr value in EEPROM (%x) xl%d: choosing new default based on card type xl%d: WARNING: no media options bits set in the media options register!! xl%d: this could be a manufacturing defect in your adapter or system xl%d: attempting to guess media type; you should probably consult your vendor US]dtA`P]Ph`,]PhK, V^u euM]Ph0,]Ph,]Ph+jS]Ðxl%d: guessing 10BaseT transceiver xl%d: guessing COMBO (AUI/BNC/TP) xl%d: guessing TPC (BNC/TP) xl%d: guessing 10baseFL xl%d: guessing MII xl%d: guessing 100BaseT4/MII xl%d: guessing 10/100 internal xl%d: guessing 10/100 plus BNC/AUI xl%d: unknown device ID: %x -- defaulting to 10baseT UVS]u jjjEPSk E==V`P=U`=WP=Em=UP=WQ=WR=de=`e=be=Fv =y=QG===C= =P>%=X=U=VM=u=h=Ufǃdǃ`]Ph(fǃd8ǃ`]PhPh(~fǃdǃ``]Phs0(Ffǃdǃ`(]Ph'fǃd@ǃ`]Ph'fǃdǃ`]Ph'fǃdǃ`]PhP'ifǃd2ǃ`tP]Ph '9fǃd@ǃ`"P]PhP&fǃde[^ÐUWVSEx1 t1ۍ;uǂ F~̉ ǂǂ1[^_ÐUWVSExtUEUE ME 8 %E% EU}u  E}uUEEEE}qh@EP_Eǀ ǃǃǃ1e[^_ÐUWVS]xEtEwS U]}EUEEPUR7u7t}u| ߁ UET ߁% ‰VE E EE E}l1e[^_U WVS} 5p@ xAp@pAuj5"h蛒à ËpA5p@֡ AAttYfCp@ xAp@fAp@Ћ AAt跇CC CfCCjjÃ5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAt C t#CKC(C$C,C0CtTCC jSG_S % ЉA@ @1SC7e[^_ÐUS]x1 RAxt tx#1[Ðxl%d: bad receive status -- packet droppedUWVS}G4ExFx@uNf|']Ph!E@L@}^@%EVW&7uUBL@LE@HsCx(tUS SSp(EC CCSVEPxPf,Lu*H8u)H0f빐H@8tqu[H0 u^H0fZt %H8 ЉkH@0 LtHf@0WWLtHt % ЉA8xxLHf@0e[^_U WVS]{4fG2|tn|Lu H$ H@$u9F|v+FGPF|u|ufg4ǃLuH H@ u`uOH$L %H$ ЉSH0fVH@$uGLtH % ЉA$LtHf@0e[^_U WVSu1F4EAGtPGE@PSЅ}C $)ËEf@2;t@ut Ef`4e[^_xl%d: transmission error: %x xl%d: tx underrun, increasing tx start threshold to %d US]HXfNH$@}E2nEP]PhLtHf@XS^LtH@B$LtH@-@H-@ %H$ ЉH/Hj̘fH`fHHf|t2L]H % ЉA$LWH@/Et3jf=w&tċHf@HLtÐHf@0LtH@LuH H@E}]ÐUWVSuEF4EHh؉fEt዆HhfXt VЃt9EXHVU;ZHu VV;ut ^u V> VtE@TVtjVVF }ƆhVaƆhLuHf HxUt RЋEe[^_ÐU,WVS]EjuV}{4\t Eu샻LHf@1ɐuFE샻LuH HA~EGLEUUGXLt$Hf@LuOH LHf֐Hf[Hf6H@ }tEP}LtŋHf@hu5`"Shoe[^_ÐU WVSEu}P~ tAF EU V % ЉE  F G6~ t?u5p@ xAp@pAuj5"h5à ËpA5p@֡ AAtztYfCp@ xAp@fAp@Ћ AAtOzCS SfCCjjpÃu JEx`5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAtyC t#CKC(C$C,C0CuSsUrjRUBC CR]E S % ЉAUR UQ UE PU  LUPU 1e[^_ÐU WVSE1EuDS/S u&UJ5@H0fnFFRVS}t(MqE % ЉuUB(tvP襧t9Mt,Bu ǁBEPfHLHf@0S|t?x % Љ` |LubH$_ %H$ ЉcH0ffHfjH@$u+tH % ЉA$LtHf@0LtHf@MfA2SBe[^_ÐUWVS1E 0F]tA{ t*LS % ЉC AGt { t?uƋEU B L@1[^_ÐUWVS}EE7W4/MM< +fW4Bu LJBERPV}t EMAEEG(tUrPtSЅ}C $)ËJM<u)ЃDO5}t"UHMA AfG2e[^_Ðxl%d: initialization failed: no memory for rx buffers UWVS]C4EE=p@ xAp@SW\t U}u(L7Hf@(SLHf@XSh'& LHf@1ɐLuHHA~1ɃLuHTH1fHfDHA~уS7ul]PhS.HfOHXfH(f^u_S]H/fH QP1xl%d: unknown XCVR type: %d U WVSE] 18\tLt!Hf@Lu'H$HEȋUfҐH%C $Hl࠴  C#Lu H H@ uDK ^u7fdu,C-Lu H H@KWC%MC$At:VF0CF,C#C'P]Phe[^_ÐUWVS} EEp@U xAp@EPWS4UREP聴ƃ~Up@2i w(1i  i t4i w5i  6i(WEH4Uxu"SEPUR &SHfLt㋃Hf@Lu"HfH̀fHHHEP4%@f=@uBmu9tHf̀fBLtoQfH̀f0@f@u@mt7tЋHf̀fBLt3Hf@GS7Hf'Hf@t SUB4l11i uEPUR輺EPURȼƃ4us^u S S1M\t E}uWPUREPWUREPURƃEp@U AAEtiee[^_xl%d: watchdog timeout xl%d: no carrier - transceiver cable problem? U WVS}GTLt&Hf@Lu#H fHf֐Hp ]Phi t]PhS SSkjSSCt WЍe[^_ÐU WVS1u|7tP軥7 Ky׃hEtd1u7tPo7Ky׃h@UtPwde[^_ÐUVS]s4fF2LuHf Hf@LuHf Hf@LuHpf Hf@pLuH@f Hf@@S߹LuHPf Hf@PLuHf Hf@h ' LuHhf Hf@hLuHxf Hf@xLuHpf Hf@pt SЃSh_Sff4e[^Ð %s: failed to read station address address %s %s: no memory for list buffers UWVSuF4EE&F]jVjjj }WVD0t-FPh0HfJjSWGSPhU0`trLtHf@Lu&H f!H ؉f/HX  t@t@tʋHfX jjhDBjpuFPhptƒ1ɨtB@Au󐐉thjFPPFEP>vS8 fΐS8f0C8@tNUM f Q{4tϋC8f@jp Nf{4u S81f C8f@jp EE9Ee[^_ÐUWVSE8DxEUt*BMu ǁBEHEuE.~ t:M]V % ЉUF E6~ t}u5p@ xAp@pAuj5"h[à ËpA5p@֡ AAtuPtYfCp@ xAp@fAp@Ћ AAt;PCS SfCCjj\ÃuMQ軑Ex`5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAttOC t#CKC(C$C,C0CuSURsMqjQ{UBC CRƐ] MEHUPf@@wt f@ @MfA `Ef@2"UBHB fB MH@u<@UB(tMQP,~Et @~}t@'G8@tIt_4uW8uu W8 G8@ e[^_ÐUWVSuFKe[^_ÐU WVSEldE1}u' ߁% ‰" ߁% ‰ UDŽDŽE}rdždždž1[^_ÐUWVSElEMd1sEjWEP7u 7h?u# ߁% ‰" ߁% ‹MT EG?~Eǀ1e[^_Ðdc%d: no memory for rx list -- packet dropped! U WVSE} Ud5p@ xAp@pAuj5"h,à ËpA5p@֡ AAttYfCp@ xAp@fAp@Ћ AAtGCC CfCCjjhAÃu#U@Ph7W5p@ xAp@=DAujj ?DAS t!+4A @ |AC DA5p@֡ AAt}C t#CKC(C$C,C0Cu-U@PhESE7CC CC C CjSsPE\@ts sElU S % ЉGG1e[^_ÐUWVSu ELuedUPjSN#EPWURGWЅ}G@$)ǃUdElEhSp]9tEtu?;u K;ttK)UP9sÃEPWURVEpSEUe[^_ÐUWVSut1ۉd<8}%QЅ}A@$)C? <8|݃@tt#1[^_ÐUWVSE4EUtd~‰UElEUځ?E\@tA%=t3t ULtVVEPUځ?Ef}TUBL@tBXEPVURUtVЅ}F@$)EP jEPjBPUBPXÃEPVURVЅ}F@$)ƃu E@LIjSAMUBH{B(t SPd0jSMSWEPdQ Ed<uUte[^_UWVSE}4fG2ElEMA%H=@tFEpAA uf} PHElUMA uBu"{tEBu stf},GTtGXtGXuUR< xWXGP]ul3tPA3MpUBy0)‰UEU;htdEMEl}tfg4e[^_ÐUWVSup@E xAp@F4E\ty0u,` ,X`G0utƆCWXG0utƆCWXC^0u,( ,X(upuAt WXG,uƆC WXCu;WXG,t)G0tCEt P]t+Cu" `"gfff)R 5`"PjEp@U AAEte[^_dc%d: TX underrun -- using store and forward mode resetting increasing TX threshold UWVSuEF4E@4uq0u,(u,@(t V1,81@Ec,8l0tË,@8,(6,Etȋ,x(x@t8UZHVqE;XHu V[Vut VtdVptO0u,0틖,0 ,B0 B00,@ @Ph ӖA<t<u Vu0u,0 ,X0?`=uKh v0u,0틖,0 ,B0 ]t'h!",02@`h!0t̋,X00u'`,0E,0 ]E,B0 `B00u,0틖,0%,B0%B0ǀt;EXHVU;ZHu!VVu tVV 0u,( ,x(0,@8Ut REe[^_UWVS]EEE} w \thU9t }Up)ЃEd A}u!qG ߁% ‰QMQЅ}0)‰UE?97UplU dL@\ tEdL]tdL\tp@~dLEdEU1[^_dc%d: no memory for tx listU WVSE 85p@ xAp@pAuj5"hà ËpA5p@֡ AAtMtYfCp@ xAp@fAp@Ћ AAtCS SfCCjj42Ã`5p@ xAp@=DAujj/DAS t!+4A @ |AC DA5p@֡ AAt^C t#CKC(C$C,C0Cu*S6U@Ph&7)swjWZ@GC CW6E 1e[^_ÐUVS]E3C&C5hE\tEPVuEPuVt4UBu EEK5eC(tuP#E0lu>Et1@u ǃE@}4Eh\u'0u, ,@fC2e[^Ðdc%d: initialization failed: no memory for rx buffers UWVS]{45p@ xAp@ESL SA <t<u60t,7,1),0t狃,A<t<u"0u ,4,%0u,,\t)0u, , Dtat. uy0u,~,o0u,̀X,̀G0u,@0,@0u , ,]t=0u ,0틓,0 ,B0 `u80u,0틓,0 ,B0 w0u,0틓,0%,B0%B00u*,0E,0` UE,B0 `B00u,0틓,0 ,B0 B00u,0틓,0%,B0%B0AB<v 0u,틓,,%Au`0u,틓, 7w, 7^,x s,x0u,틓, < , < A uM0t,@x j 0v,@xj r 0u,0틓,0?,B0?B00u,0틓,0,B0B0S77@Ph\*&SY 5p@֡ AA d %, Љd %, Љ,8,(,x8,x1C,S70,d % ЉA0,d % ЉA 0,@80,@(0u,0틓,0 ,B0 B0]@t80,@x0,@xSC0u,0틓,0 ,B0 B00u,@EP(FXSG4 @fG4 5p@֡ AAtWShVXUBu ƃC?]t' `"gfff)RVX5`"VXe[^_ÐUVSEV`EAuVЃuRS ƃC1e[^U WVSE} VEAuVЃuWGF0GF,Ge[^_UWVSu E8p@U xAp@EPVW4UREP46Ã~Up@2i w$1i  i t0i tpc5i 86i(,CEH4Uxu"WEEPUR葒 W#EP4td%@f=@uUuW}Q%@f@uUtWY-@u(LJ`W@t WUB4T1k1i uEPURH=EPURT?Ã4u3W1ۃ#VPEPUR[EÃEp@U AAEt5؍e[^_dc%d: watchdog timeout UVSuFT@Ph5S.SS t Ve[^UWVS}G4Ef@2􍇀P V0u,0틗,0%,B0%B00u,81 ,@80u, 1 ,@ 0u,1 ,@ƇCE]l3tP(3E}?~уhdEE]l3t4dMDt 3R (3EE}~hdP Ef`4e[^_ÐUu;dcne%s: where did the card go? %s: setup failed Ugd2fd&4QEP.ƅethSjW,WXgdSWhlFUE}$ Rt{u. t)ƒubGG1I)ƒu:u1Gt t"EPWQEPWQ[^_RAM diskfictitiousULWVS}] hh?h@Vp?$? ?(?,? u ,?djhIh?JGf?jh Ih ?-G ?0?f?L??? Љ??f~???WEVx?WEVSUf|?jVShlF}$ R\u1[^_ÐUVS]E pjV5 #tǃ1 e[^US]M A=߿w9s BAǃS.ǃǃǃ]rd_idleU WVS}"jh9K5p"W)ƒt׋C$C$1ҋs =p@ Ap@ tADžtAtApA؋ uA tAuApApAuApA~tAuApAFAFAFAFA=p@ס AAte[^_ÐUA`")PhhAÐU=AuA~FAFApAtAtApA uAuApAtApAuApApAUVS=AuApAtAtApA uAuApAtApAuApAŠpAEpAtAtApA uAuApAtApAuApApApAtAtApA uAuApAtApAuApApAࡐFAFAFAFApAtAtApA uAuApAtApAuApAŠU  pA ‰[^ÐU=@XA\A >A >AhhxFA赯hh0JA裯@0JA0JA QAsBQAr1pA@=~EPjhrhP@jhplhhAj@UE1҃~ÐU1Ð n;AvXaM ְdx UWVSu>AE]]e E E]S[3]]1>A+>A+>A+>A}؅}م}9~9~Љttt ttGtG=hA@v wFAFAE]SK tp@ Ap@@u.FAFAp@ӡ AA肬@EBBEB EBCACAhAFAFAFAFAEGAGA8HA ϋGD9u G4 t]QjVPjW à tfft\RjV;CQjW辟Ãtu fuPjVpuW;JDO􋅠P9t';tf}RjVQjVÃRIDžPt9=t Ru F(t;FX~ DžF,DžOF,!t%PjF,RPWà DžDAFXuEt PMXPjF,RPWà DžBH u#F,BF,0 1;HA fٍC!9PP49u :.t t9fCQ! 9y!@\S!PRQ uP@tRP @T N,@tRP BT N0PF0PPSRM ;AuPSPGxDžV,F,;*F0V,9%H9tDt PCUPjщSQW à !@HN,uDžF,V(t PTA@tQ0W_t RQ F0u@A%fftuF,F( SQjW`j9F0PPv0wH!&à tRhWfQjWkÃ믐F09Fu 6SG49P9V0PPv0wH\%ÃR>t fuQjW4A@tQ0W]1x[^_U WVSu^xFV O tMQjwPSMNà tu%RFNtUF#GBHVE1e[^_Uhx@jj95x"ػA @1ÐU WVS}5H"E #x@ػAt5U ;Pu$;xuXVhS u u1e[^_U WVS]H"E{ s#x@ػA Ѕt!9pu9xu *utZKEPjjC4Po1e[^_ÐUEHttJ@Ðcd9660_inactive: pushing activeU WVSEXx="t{4tShFWjSf~xu WjS[1e[^_Ðcd9660_reclaim: pushing activeU WVSEX="t{4tShjVS\ F tP袖F +ԻA `A5p@ xAp@ = ~j:@<AAuAA8B5p@֡ AAt ǃ1e[^_ÐUVSU] EE1BtfCx@fCxfǃu7Kt+Rt#EPjIډЙRPsXE tppHubF uKyF @uKx@FuKx FuKxFuKxF@uKxF ‰S|VF ‰1ufKxmC|ǃEt PMe[^U WVSu EE1u>Nt.]St#EPjIډЙRPv` E xHur^`SG=PuSG PFpPG Pu F`VdFpVtFhPGPuFpVtFhVl1u(FpPEP/FpVtF`VdFhVlEt PLe[^_ÐU,WVSE} lXHMHMHMHM@EG1Bč @))C E身*E)2)y)эpQ)DR})))؍98) U@M)‹E)ЋU E0A3EUzUh/(M A(xU B(9QWVMQWrUBDEM9E p U B$fMJ,Ext/17U B,BM Q$)A f1E `e[^_ÐRRIP with incorrect NM flags? U WVSUu EB $SL,`4```````````````````````````<D<@>A.EBXzhXk&F(XF$fff;V(vfV$))F f1%Sv W{p^ }t1 fe[^_ÐUS]M A fPC!t2<t:A\CPjq$q C PC!P A$f A$f]ÐUWVSu] ~VG G G ‹{CHcϸ >Cu[^_ÐUU B$fBxU WVS}u _G|{t_ thPSjhPGt`PSAhQlA`QdGpPSt_thPSjhPDGt`PSAhQlA`QdGtpPSAhQlApQtfe[^_ÐUE j0uÐUVSMu QYB B B ÍQ I B B B u  ˉf[^ÐUMU A #BB@u  RQUVS]u KSA A A ‰VK S A A A ‰V VKSA A A ‰V[^ÐUIEEE_1282IEEE_P1282RRIP_1991AUVS]u {uaC t uS uj hJCP~u4{ u5j hTS^tj h_SGt1 fe[^UWVSEUB \!uCEPM A\SE!PC}u6MEPA A A ‹M A;HtU BTXދMEE @Z~u=]{t!8uC8FuU RVC EM yEFv ƍF9sU ztrBtkrz;~}`J ZF9Ku9wEEPjvNWv \< u!EM q pHy#e뇐Et P@]{t$EC uU RMQCЃ{u܋Ee[^_ÐU8E UEЉUEԃh"EPuÐU@VSuE MU]EMfEU]ExfEP\F D!PF!P#"}wEPV`e"PEPVne[^ÐU8U EMUEffEEMEhx"EPuSPUuUREPWVU;r tVtVuVjYPu {eUZ)PR} VjYPuIeE)SP}jpLPEPbEPGDPW1h[^_CD001%/@%/C%/EUA]SjnÃtERp@ xAp@ࡐAujj:h{E EAp@ӡ AAtphURqjjh9jE4P5sEM쉈EAq] Y$Q9Ãt usEH] ;X|urShPu U#r~!;z~urWhEPjMqȋHSp 'à t-u>ru+Sh ExHU;B~JuqEt Py+PVPhЫ FsE]MYC A @4}tWKU EP\Et P+EPjjjuà tu[qExHWOB B B ]KT_ W C C C ‹]SXGȉC\E@tEPtot.Wt&EPj]KډЙRPu. EuEPWQuURWU EtP*MQ]SWEt P)UMAxf p"Bt$ࢰࢰ00ࢰࢰ ࢰULABLuUABL]SEu]mÃtFEEǀUCABLu&puct]UZMH]9CTuEH0EU1e[^_UEU f ABA\B1UUu  PR~tA0UE41 UEP@x@ubxu\x uVx$uPx,uJfxuBxuxtBBtHw9$࠱ఱఱ਱ఱఱ 1ÐU1ÐU1ÐUUBr BPq|AxP~ULWVSEEċPUpMAFAFAxfFfFA|FF A`QdF$V(AhQlF,V0ApQtF4V8FDAXFFyXbMytUp@ xAp@Aujjhyuǃ NjAp@ӡ AAtj}ȍEȻXEEEEEEUċBE]MЉMBEB EEP u+EFF+ ԻA `Ap@ xAp@ = ~jWv0AAuAA8zp@ӡ AAtiF@F<UB@F BXFHFLUBt1e[^_ÐU à EuF@Uu+r@;uvuWVEBHPzËU܍2M;AtUBX9Gu9W u UB0 B0u#؍e[^_ÐUUzzft B jPj0r/ÐUÐUÐU1ÐU WVS]M u}ADfA$fA09Br@t,Dǃ<80@D0APQMu481e[^_ÐU WVS]1~ =tJAsCuH~v9uPQVt`t- $RPPSƃ{t$RPSSCf$ft;(, $PPPL3(,PSPK1e[^_..ULWVSEEPUHMEEEE_]CE܋p@ xAp@AujjhHzoƃ ƋAp@ӡ AAtdƆFƆƆFU0Myudž@R]CEԉwsw7 w0AApA@PAwAAzAwmAfw0 w0AwIABpA@w5PA.wAwAAwAp@ xAp@ujjRmEЃEЋp@ӡ AAtOcUЉ@MԉDdž<]CS (,E܉E䋖(!UEPj(,SQ]SE؃ tW+ ԻA `Ap@ xAp@ = AAX}}}ȋ,9M"U;(wEE1#(#, uHEt PEPj(,SQ]SE؃ eEE]XH;u5E1#(#,]Kډ(, GEE̋U;B3C !9CtRSE@T E䉆}}ȋEċU(,EU(,U胺PuERWEPPS-E (,SQWVfXu1C!uƆEU<uƆUMQRuM\CPPPEPPPC!PE ]胻PuVM(,RPPVE؃}uZỦUMMMȋ,9M|uE;(k}u"U胺PuƆVE؃}}EMAt2}tj]SDlU+DMA]ЉEt P48MAQ ]S<+ ԻA `Ap@ xAp@ = ~jVk-AAuAA0rp@ӡ AAt^E؍e[^_ÐUWVSUB{RUPt `EPjwOCPw  >MC#GEQHU];Gv QExuT5p@ xAp@Aujj h3hà ËA5p@֡ AAt]WEPSURFEx+ ԻA `A5p@ xAp@ = ~j Sj-AAuAAZ5p@֡ AAt\uuUzREPSE+ ԻA `A5p@ xAp@ = ~j S3i/AAuAAZ5p@֡ AAt \EE])CEE)B1e[^_ÐUS]s s s ^]ÐUS]s ss]]ÐUUJr Pr4P_ÐUUJr PB P4P_cd9660_strategy: specU WVS}_K\EAtwhaCP9CTuVjCTPjsPQ\ƃ ts4C0C0SU{TusF  PvSvFPEp ru tCS@и1e[^ÐUVSu] Ctfch jj%PCPv u ubVjF0j jC1RPsss j|0u5Cu1)jPSC%PRv 萅e[^ÐUU Jt6bB  Pjj%PBPEp Ztu1ÐUSE] C8C<ߋ@@0%C@C9CrCPfC@SCS@K<)щ+S8PS8P@ @@C9Cr CPC@SCS@PS@[<)ӉX@ @@1] swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reaperupdateU VSA5H"Xh"]hP 8T{.t3]@AFt@ A5@AF @Adž`A`AA`AtHAdAF@5hAFDhAlAPFAPFA5TFAF,F1Ɔ džh"jhúAh0Vhvh(AVhh`A\AFHAi‹FFf@ FX@f~@L"f|@X@@\@@h@l@@p@@FA1Ƀ1ېDHAAAAAv8A@At??At >AX>AC>AGUC GCf} tE }tEU1e[^_ÐUVSutFBVvI A+ԻA `Ap@ xAp@ = ~j&VL60AAuAA0rp@ӡ AAt!)e[^ÐU WVSEx5p@ xAp@ࡰAujj'h`3à ËA5p@֡ AAt(hS)GC@4G C t@4fC&L"fC$C(CxCCCCC C؍e[^_UUBf@&BÐUWVSE@Ep@ xAp@ࡰAujj'hu2ƃ ƋAp@ӡ AAt'j(VEPF@4F t@4fF&VF(FxF@~ c~9jj'P1؉FGEXFF,jj'S1Fjj'S}1F ~Q6E0; WvEp) }]SvEp SvEp ~|'tP u BP Oyډe[^_U WVSEXC&JfS&f+;s|%tURP#NyދE@{~j'32C~j's2j's2 s(C t P(+ԻA `A5p@ xAp@ = ~j'S420AAuAAZ5p@֡ AAt %e[^_closef: count < 0U VSu] t_tLC,tFf~ u?fEEEEEfEj@EPjSv$ F PV Ѕ~1}hF%@=@u?fEEEEEfEj EPjVv$艟 FtSV@ЉÃ1ۃV ؍e[^U$SUE XB;Hs u fz t -J$fEEEEEtfEfbj EPj@t fEu*fEJ @u j0j EPjRQ芞]ÐUUEB\UWVSu }UEM MM;ys t9Mu xdA 9t My u 7 EPA MQ UBuU@؉Ft 1EXTOK,5t9S4t9PGC1<C4UVt$0EjREP|LF tjHP4Y)CXtPƃC`UB`$9v‹EP`fǃ04UBHP24S<uLuGuFt<K,C4UVt#0 EjREPz1s[Lu ]FuJjhYh EPe`n3CXVS+jV?V7d U1e[^_ÐUSM] 9YHt5QLtAPBPAPQLCTALt CTQLPPKTCTAPYH[ÐU WVS}4+ԻA `Ap@ xAp@ = ~jV9AAuAA044Bp@ӡ AAtuWtWtG B W GWLt GPBPWPGLjGpGPJHG0'w+ԻA `Ap@ xAp@ = ~j*V6AAuAA0GGBp@ӡ AAtot PH +ԻA `Ap@ xAp@ = ~j)W0AAuAA8zp@ӡ AAt $"e[^_UujjjuUujjj uUE t$t t u-$@t@ tujjQuprocppwait U WVS}Gp t"A$"9|u9|h.#jV]t*_Kt9u;CpvjV9#lh 5 #}Eu B5p@ xAp@ࡰAujj)h8à ËA5p@֡ AAt ĸA=$@t ĸA=ĸA~3;TƉ% ))։5ĸA("("9ĸA1(" @AkĸAĸAPĸA;("z9Q4t዁9Pt֋A4;ĸA~ 9("~("@;ĸA~ 9("~("Iuu  HA$"C1ĸAC4@ACt@ASP @AC @ACK4# A@C8t S8P<A#C4 @#S4SAhԻA5 #N8"physbufphysioU,WVS] H"EEUUMyuQEu;q}B}PUMt4HEEuE;p|EtoË5p@ lAp@C0 C0jh+jSGC0u܋C0 C05p@֡ AAtECDC4US,CxEMu;NjUM<ȃAE  C0uFV  CTGC<CHSEЋSAhAjj)t"}P0@hHAjj)t"}P0A hAjj)t"}P~0lFAchgproccnt: procs < 0chgproccnt: lost userU WVSE#AlFA<E9CuE C C I}hA0膄tCBS+ ԻA `A5p@ xAp@ = ~j)S0AAuAAZ5p@֡ AAt] } u1hW0Ã5p@ xAp@Aujj)jà ËA5p@֡ AAttX{ECE C E e[^_UEH"9tx4u1@H9uÐUM#A@t 9H4t @8u1UM#HAAt 9Htu1ÐU WVSE PƃzUr4xt;Et p@ xAp@0AujjjJƃ Ƌ0Ap@ӡ AAt}=p@ xAp@0Aujjjà Ë0A=p@ס AAtAMKCC j CP@ PlE`,^ U@ F M NFU #HA AtpE #HAA4FFE;jVUR6jMQ" EP@t @DBDMQDA@xu PEFUB@tFU@PDMNqD1e[^_ÐUS]S@tCDBDSDC@xu Pǃ1]ÐU WVS}G @ t 9xxu@xtGBWG w +ԻA `Ap@ xAp@ = ~jV 4AAuAA0G G Bp@ӡ AAt+ԻA `Ap@ xAp@ = ~jWz.AAuAA8zp@ӡ AAtQe[^_ÐU WVS]u ~ CH9t+9z u&}tFFPVu V][TtH9t49z u/C1<v&}tBBHJu R[Lue[^_ÐUSEX؅t8{1u*Åt+jSujSj [@u [@uɋ]UEU@41ÐUEU@H@41ÐUEU@1US]E ًt7;A4t2P]u,R 9P tPE1]ÐUS]E ًt/;A4t*Pt7R 9P t!@ @t P4E1]ÐUEU@@1ÐUEU@@1ÐUEU@.t 1ÐUEU@@ 1ÐUEU@@1ÐU WVSEu }Pu @ 4X 9s "PvP!u1e[^_ÐUS]S49PtRtjs4SS4E1]ÐU WVS}u ~} tR;G4tMPDÃtSu~R 9P uUC-@t ]@ 9Xt5Fu C4F-;C4t'Pƒt@ 9B tjvSe[^_ÐU WVS}E _0;st$;st;pt72P3BuZ;pt2P3#u&;stjsfjV[ ss3XpO-1e[^_ÐU WVS}E _0;st;st2P3u3pO-1e[^_ÐU WVS}E _0;s t$;st;pt72P3Nu:;pt2P3/us s3pO-1e[^_ÐU WVS}E _0;s t;st2P3u30pO-1e[^_ÐU WVS}E E_2P3uIE0v 83PPEpVu fp O-1e[^_ÐUME P T9s9u 9r1ÐUEU xu t 1ÐUVS5p@ xAp@pAujjjPà ËpA5p@֡ AAt5jPS"f؍e[^U WVSu=p@ xAp@f+ԻA `Ap@ xAp@ = ~jV/AAuAA0rp@ӡ AAti=p@ס AAtSe[^_ÐU WVSEf8t*ËuEPfEe[^_ÐUWVu`f^_ÐUE x v@ p0E@ PaÐUVS]u 2PC0u"jj @ P6?ue[^UVSE] )tB ttkSt R| Su RwtgHt` 9}ƋI@uJ{u @@C @At-AC9Bu  9}ƋIu )tE01e[^UWVS}u EEt\ tFuPkÃvSWEEFu PStxXtqvSWEE[@uQ~u G@F@At5CF9BuvSW6EE[u}tEe[^_ÐU WVS} ]EpHtVtG@9t 9tU~} 9}"E2P6t  W:1e[^_ÐU VSu j]SvuS6ue[^U WVSu} wF|N } ] ߋUzW 9uG9w9 u,G9Fv$E2PMA0#VF 9 uF9v FV VUB~*u!JMqUB<} tQw } t!>} } % #1ҋN9u 9vV #1 #1ҋN9u 9vV #1ҋN 9u 9FvFV 9u G9FVG9u9vE)Ⱥ)E)غ)ʁ%jMQPREp R|"N9u 9vV|"t"N9u 9vVt"N 9u 9FvFV FGFGF G 1e[^_ÐUE jpEPR葿ÐU uE@ 9B A-$I\J\J\JJJJJJJ\JJJJJJ\JJ\J\JJJ\J\JJJJJJJJ\J\JA^P9tCO9t<@9t39t/5ANp9tX9tW9t9t @9t9u1[^_ÐUWVSE EUR$U8wwxt tu ]MyMUCCU셂tCM셁uKU셂tKM셁 tK@uUB,tKMA.tK CuK!Cj EpSӸu-UBt!j SPVuSWMQ 1e[^_ÐU WVS]}S$M Ip@ Ap@M Gu wG%} u*GtK,c,G t{4tK.c.Gt  !G@t  ! Gu  !Gt  !t <"tu!} t !?u ! p@p@ AAt[^_US]1Ґ<"ttJ B~[U WVS]s$tZuQU!ЉE<"t}t !0udž dždždžc.[^_ÐUVS]M U1p@ Ap@t"t =t#5A% )A!Ip@p@ AAt[^UEU1pauseUSEM X$ jhNh(Sj%t]ÐU VSEu X$u Ftj PPuxu1nj EPR蝵uZEt t D%}~'EEE 1 e[^U WVS}u GEVv ~NPÃuavSEPWFuDFt PSg1/tt jjRjjR jPvWe[^_UWVS}u EWUE}tO@A{4~1C-u+9t'VSEPWtEt VS[uotPKuaXtF{4~6C-u0VSURW4tEtC1<v VSS[@u1}ue[^_U WVSE}u}h؃PXt&CH9tP9t@9t 9t9t9uE PS[@uJPÃt7t&CH9tP9t@9t 9t9t9u U RSge[^_ÐUEtPtju PÐU WVSE} ut(Xt!tC,t WS[@ue[^_ÐU WVSuUF$EM IF-t~uvF@<uuRU RU4@ ЋE UtA!} t<"t EE(U RVe[^_psignal signal numberUWVS]M IvhSjaE 4<"C-t Eft EIEu7Et ~ƃ tx t̉t }uP{1Fp@E Ap@C1<t <t~{,C,t }}!E f0CH@,ujPSC-} tdt$}u !։}tJ{ltTC1Zt !։H{ltB{,}AXhhEAURSVW#…t6u2EA(XAEEPURSVW‹EXA=VW:}.jh AE PVW VWHPAPkVWha jjjjjVW躿h"URJh":ht"UR.hhxFASVW^PCh"EPSVW?j'j#jj(At8a0tp SVW=-e[^_ÐUVS]MU} t EHw}$0iLiTidihipi|iih#h@RQS+Fj1h*@ PP?A5@)Ɖ PhRQS-e[^UVSUM ]u1t9w Ct}t 0tjRV~ut jVSe[^UUM 1t9w +}t tjREPÐUjuuuuu u&Ujuuuuu uU WVSu] 1҉у}t} 9stu }tE;Er y}tJt.U 9s%\D2MQVI‹} \E QURV)ƒu }tMQV}W詙‹E0Ѝe[^_ÐU WVSU] 1}хt 9 s )}t  tQREP蠘Ɖe[^_U WVSUM u}]1t9s :t 9]v'tSRWGut SWVјe[^_ÐUSME U1ۅt9s *}t tRQuÉ؋]U WVS]]E 8u A  U yw E hjSh>A舗tQ+]U  ?5>At$'vۃj(SVKu؃(6u+]E 1e[^_ÐUWVS}E UxDžtDžpt Uptu tt @ADžl+{1$mxn nn~n0n\ndnG9C4dG9BNC,@ P G9Bl"CSG9B C-u{pve|VSh8xPSѕ hx8PV謕u|xpDt[luHADžlݐ}tx+EU9tv t¬ E1X[^_ÐU WVS] EU@ C{rB{ 0B1<t<w-ǃǃ ǃ$ǃ(HEP @ $(2UBHt @48 ǃ8M@<@f@A,t5CP t+BlDBxtHHB|L ǃDCxЉdM@ 9Hu dUtjPPPfǃ\ǃXfǃ`fǃ^j CPhPƃsjMtPƃ{EH11҅tAPQT|e[^_Uh?hqh?h?hlrh?h?h?US] H"tBp@ Ap@t  p@ҡ AAt蚫|Al@ `"gfff)RS]ÐUWVSEE>A҉U=CAu=CA@A!C1<wCh"Em USh5p@ Ap@du USdShCd1EChCdUS`M1K`S 1vU;H"tA{1u;C,t5 8t%SH S  5p@֡ AAt[h4A5`"URe[^_ÐU WVSu^`>A ׋9v F`KBt:Jt,Í1ÅtBuՉ^`Ve[^_ÐU WVSMU H"Ue=p@ Ap@=0"u =At<@p@Ћ AAt=p@ס AAϨKlEǃ%سAسAu سA ܳAZ}tEPCpP}tdC, C,t"u ЅtS1t{lt SWC1#{lu E1C1C@@ A=p@ס AAtC,€S,t%C,u#x}tCpP }tYu/tC-u Ѕt S1t&S$Nt  1e[^_ÐUVS]5p@ Ap@{lt${1uS S#K-5p@֡ AAt辦e[^ÐUVSUH"5p@ Ap@=0"u =At:@p@Ћ AAtc5p@֡ AAISlǃǃE %سAسAu سA ܳAZC1C@@ A5p@֡ AAt辥[^ÐUVSup@ Ap@Flt4%سA9سAt 92u9quQFlp@ӡ AAtI[^ÐU WVS5p@ Ap@E%سAE9Clu|Cl9_uW{1uev S ǃC1C,t"S荐|Al@덃hASxڋp5p@֡ AAtje[^_ÐUVSH" 5p@ Ap@SC@@5p@֡ AAte[^Ðpreempt: cpu_preempt not yet implementedUVS5H"}thy; p@ Ap@V8F@D!p@ӡ AAtDe[^ÐUWVS=H"]Su8]S耾EEMS)ЍAjvQ誅e[^U VSEu 2R@0>t ~j]SvucEEuKMb)‰V=A~-M`A9u`A@9|`A9} V1e[^ÐUVSU 1:t 3Jt)Eʚ;ؙ=`"ÍEXjQP萄e[^nanosleepU,WVSE E܃j]S0ƃEE}KMb)‰WWUt Op@ Ap@Ӻ`A`AEBGG=?B~ EGWWaƃp@ӡ AAtVhh h?ƃu#u1U܃zp@ Ap@ӡ`AdAEUp@ӡ AAtEU)‰UUB)ljB} MB@B}}BEEEMR)ЍAjEpQ˂ue[^_ÐUVSu 1>t ]SJj6S葂 uVtjRhl"se[^Ðdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds U$SE] 2R@0ctjEPROStjEPR.;tnU~~ Rh ==A~C`A9u`A@9E|+`A9}`A)Ph`~6(EP{tEUl"p"1]ÐUWVSEU U2R@0^j}WE0LM)ʉ)Ѝ O; "~h" h"ștȅ}ۡp@ Ap@5SA SA0@p@Ћ AAtcUZtAC)щM)ʉ)Ѝ)ƉwjSWu1e[^_ÐUWVSM} ~ p@ Ap@EE􋑠UMu`A`A9u F9| `A9}EE]`AU)‰UFM)ȉE}t^tjEPS[FFtuVW9/]EEPWuSGt p@ Ap@􍷨VMu}tQ`A`AMBEE=?B~ AMEEP[PVrEE􉇜EE1OE E E E p@ӡ AAtR1e[^_UVS]jS.u"uǃǃ5p@ Ap@=?B~B`A`A9uA9S`A9~G􍃠PYPP 5p@֡ AAt(C!5p@֡ AA'&e[^ÐUE8w@|=?B~1USM] A 9}Qu)(@BA JQA )؉A 1ۃyut:9uyt%QAQ A )؉A y@BA I A 1[UWVS]u 1 p@ Ap@ȻA̻AEU p@ѡ AAt%U)‰UMCU)‰ЉA} MA@BU9u F9A}9} ;u{uEUS[^_ÐUWVS]u } p@ Ap@ȻA̻AEU p@ѡ AAttU)‰UUCM)ȉB} MB@B;u{t}~EUS} 9>ȋP9~[^_UWVS@@@AAฮA?A1"9}C ,A1ېAt APA ADAF9|[^_ÐUEU MPH @ÐU WVSMu p@ Ap@At#t AB A@Q AxAA@t-xAz)lj9~BABJ&u@A@ @p@ӡ AAt芑[^_ÐUSMp@ Ap@At$t AB A@Qap@ӡ AAt#[ÐU@txAR)‰Ѕ1U WVSt AB A@AAƒQyq t+At AH A AAAp@ӡ AAtoV׃p@ Ap@Ӌ @txAQ)‰ЅIp@ӡ AAte[^_timeout table fullUVSu p@ Ap@AuhB't CB CAC p@ѡ AAt胏u uSKVSe[^UVSuU p@ Ap@ @t_9quS9Q uNtABA@AaAt AH A AAA up@ӡ AAt輎[^USE] 2R@0u 3]U FA$FA FA8A>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d U WVS}] tSwE]="t=Cph])f{ u hȏCPhˏ6)tw URw.xuCphy$w URw@Љƃ="tVCph(;w~$tGt jP|EGwtjUR\e[^_>>> %s probe won >>> no winning probe U,WVSEUEE EEU1} tU B @x EE=Atg{tUC ftBffv8sf>|/U 9B uSEPf>}ԃ${uu="t,Et@phT'hfo'Ee[^_U WVSE} tU B @x E=At}{tlC ftYffvOsf>|FU 9B u'}tSRu؃PE PU҃f>}${uue[^_ÐU,WVSE} UEEEUEE"f="|B"W"pWuVEPf;}Ee[^_ unsupported not configured U WVS}u ]VWu}tSVPWtGPV4"%1e[^_Ðroot device %s not configured UVSu] SVjuVhL=%1 jSPjee[^ÐUSM ]K ~(Kgfff))0 у K0 [%s (root)%s at %sUWVS}U tG @x t ֋^ ӃSW(ƃCEUV4f{ uC9FufCfC F}|]ShU҃Wt 8@F%8@;D@B@H@B@L@D@ 1[^kernel %sassertion "%s" failed: file "%s", line %dUuu uuhĴ9%s: table is full Uuhj|panic: U WVSu] =AtSVh?A?hF;SVhN$WeU WVS} p@ Ap@uZuVjjjW0p@ӡ AAtg=AuVjjjW 9e[^_%dU$S]jjj<Sh?]S }tjjPC;ujjj>}]U WVS}p@ Ap@u VjjjW p@ӡ AAtf=AuVjjjW `1e[^_ÐU WVS}u ]=At  #tu #tÃt/t+SW}t; #u  #tite t`t[=AtR(ABLBZCB 9vىJJ|9|BB;BuHJ;B |Bt= #ut W"Ѝe[^_ÐUH"B,t.@ xtE Pj@ p juXÐUUB,t@ xt @ 1UVS] +ԻA `A5p@ xAp@ = ~jSq0AAuAAZ5p@֡ AAtde[^ÐU WVS]1jt"{tjs ts EPjVWu  e[^_ÐUEPjuju ÐUVS5""E Pjjjuà =AuX5"؍e[^ÐUS""u jjjuq =Au "]ÐUS]EPSjju 6]ÐU WVS}5""uWjju à =Au5";1e[^_ÐUUE t,DEEPREPju‹EÐUUE t(DEuREPjud‹E%qo%qd%qx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad baseU\WVSE} u}tEEEEUUEEM<%te Eԃ} u'}t E9Eu UMEE EPU RMPEU<%tuM9b EEEEEEEEEEXh$̼|,,,,,,,,,,@LLLLLLLLL0,,,,,,,,,,,,,,,,,,,,,,,,h,,,,,,,,,,,p,,,x,,,$,,l,,} EURU܃EMqjEPU RMQ] EUBÉEMIM<u VShs"< u VShw<VSh{EPE}}tFEԃ} u}t E9EUGEMQE PPG?u EU:O‰!! Eԃ} u(}t M9M:UE<}t,iEPU R<}t,PoAEԃ} u}t E9EMEEPU RW/EM9 EE8 ~ EU: M9E}Eԃ} u!}t E9E_U>EMQE Pj>}#E MEURUЅ]ЀME+M ME*u#EEx}̃E1EU|BЋM MEȃЃ v}̃EuM؀`1U|BЋM MEȃЃ v}=M@(E8lu EM MUU܃EMAEMEب tEUZr3MuM@tEEXEUBÉ} ۃE-M tEUBMԉHMuEب@tEUBMfEUBMԉMEب tEUZr.MuU@tEMY EEX11OEUZ1EMEx&EMIM܅uEܐ}|:EPjURdt+E܉EM9 ẺE}ܰIMMU tEMYq)EبuM@t EEX EUZ1kE EM tEEXp*UuEب@t EUZ EMY1Eبt tMEM̉Mą|eEE܉ u }t{rM܈$P0M܈ uEب0M܋U0Mjj VS"0M܈jj VS9Éօwu wM܀0E܈BM܉؃UM܈ uEܨ}ܰIM-EE!}UU܊MMEE];]}]Ā}tC Eبt;]}EEE؄uG})9} u}t U9UM EEPU Rj ^O}t>} u$}t M9MEˋUEMQE PEPyUtw} u}t M9ME0EURM Qj0} u!}t E9EKUMEEPU RMQE%=uJ})<} u}t E9EU0EMQE Pj0BO}+}9} u}t U9UM0EEPU Rj0OmrM} u"}tM9MthU܊MEEEPU RMPEmsEب})߉Or} u"}tU9UuEGM EEPU Rj FO'} u}tEMEԍe[^_U WVS}u F =vju W3YOp@ Ap@FBF B FBWqp@ӡ AAt8U1e[^_ÐU WVS}tnEHS9U rZE )c $;CsDƃVu>tPV?uE C{EH-l@e[^_ÐUWVS}u G, tu}to_A9r_)Ɖa EUE$;AsAƃj]SV;uUfUjVS:t We[^_US]U MECE؉SK C;s@;r[ÐU WVS}u ~,1ɍW9t"~ t9~у9szuu)12Z)PRBP9@ YA)1؍e[^_Ðrmfree: map '%s' loses space (%ld) UWVS}uE_]S 9uTE ;(C u 9S)PCPCP9@E 9usM 9}(zu C)RPS8sU }tE9~];s {;;]tCC9uU Sh;t sE ZU;E :PwhxE)RURPH8@ E Pwhxe[^_?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaaddU WVS1ۃ="toEȦ"""\"f<0t""09~Af<0u"E$$C"M<u؃<u ڃ$Z"t" "[^_--- more --- UVS1"tH; "u+h.a0"h;C"qtQue[^ÐUU"";"} (A@" %dUWSuhhAsA߰ы"D ;"s=߰эAP(APS5߰ "I "e[_ÐU";"}ƀ(A P"У"%d0%o0x%xUUBv#" t'u"Rh RhRh%s*FOUND***UNKNOWN*UVS]""ph"wO$Th|hFPh^-hOh?h/e[^Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x UWVSu"9~Ph""EVhVhyE Ħ"f;u:hY(EPhBPkE| f;uҋUB f|f~ f hhEx pf\"t=\"\"4"hF7z f<uăUrhe[^_ÐUWVSM11 9-uGA90uPAh2h,h[!hh h hߋ8e[^_ÐUVS1""P$F;t t"e[^%s US1"4"Ch;" st"]Unknown routine /%c/ UWVSEfEUU1E";"EȦ"Ex0Uf9\"} uEPiU 9u`E}et }dt3}st(S/S#P0EPh}u-Ff\"K}uE$C;"$"e[^_Unknown attribute UWVSfEfEfE]CfE< t< t< t uC< t< t< t1;"O4"эQE9uRVEP*uEfEfEE;"~f}uh.G;u jsjuVS7ujsVEPh3e[^_ÐUWVSEfEu]Ect "="6E"EMzэA;E M QrEP)ftLfuU"ft6ft0f"UMf9TD ftfu|dt6ctMetft2@MQCEP3UR#EPsPh7E$E$EM"ct "e[^_Value missing for attribute USEEUB< t< t< t uB< t< t< t:uh:]SRuEPSE Ph3[]%s ? Not same device type UWVS}E E1UEPhj(hhAhA hAC< t< t< t;EPS?uXE"9~ RhpW"pUR覫t}au h?EUK=""tRh2 h#1e[^_User Kernel Config UKC> Continuing... Uhhj(hCA贏 ~݃hCAtɃhUÐUÐUÐUNÐU-ÐU1UVSu] F;HstBu uBPssRQVe[^ÐU0VSUME]E؍E؉XEE]EEU} :ދAqURuQЉ…t9utt t#u1ҋE +]Ѝe[^ÐUVSu] F;HstBu uBPssRQVe[^ÐUlWVS}v"wjjVe6EÃu ]E]}EEEEVSuƃutE19}%CEE{|} LB9|܋]UBrURuURЉƃt9]tt t#u1E +]}tjEP7e[^_UVSu] F;HstBu uBPssRQVe[^ÐUuK~@|EKt<{@|6S )‰=w&CPQK@@,~@| t{@}FPQN@@1e[^ÐU WVS}u j`V.fFG F@1҉F0V4N@1ڃSQRP\F8VAGD AG$@U􋇐E%tJuFUjW;Etjjwx:aUu'htEutTU5tAwVhP4E utVh04V1ہu E(tUu t Wfp| E tU+Gp@t 俉GpEUB9uEzt?Et-tWj^Wj WS'Oq@5UB9uYztSEt 4jWWS&G(؃ 9Gt W%}UB9uzuUB 9uJz tD}|jWKWS^&jUB9uExtR6UB 9u=z t7}|jWWS &jjwx7 EtiUB 9uIz tCGpu#GpGmjWŜ #1UB 9uz ␋UB 9u z  u}Et  u U@t EtoUtzGptOGp(t4!t'tY)t'^tK`D|<~4{,}$\uGpEt Cw UB9u2zt,WGP4P5!UB9zEt@W9u2E u+thWGP\4P uAWS$EtWj #GtPGP{/fLJgqUB9zE%EWSF wV3à t݃ t؃WS V3à i tc t^%$@E쐐WSVE3à & t t}t%$@;EtVS(/UB9u!ztEtW!UB9uEzt?Et7}jjwxL4UW$tG(G=~?E t#9GHNWj;jW(wVSK.UuW["WS! t*U9tB9tB9u5Et-t%fLJG(PVS2W! %BffufGp t߉GpWj/WS!U9u9:t4Et-)vƅ~WjMNGqtUuUB 8B  gqWe[^_ U WVSu} u3CAGdGHPV,y )t EOp@ tAp@GHPVh '.E)5CAwdp@ӡ AAtf}4 *u uBt>CAGdu GHPj +t fLJ ut FwF$!P"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"u"h"X"p"`"'!^()\t Fv9t CAGdGHPj\w*uA@t ufCAGduGHPV3*tm$?wG$ #@#J#(#0#D#J#9#~Jt1 Bfe[^_/dev/consoleU|WVSu ]tw;{t wzt ^t rtgttqwttgett_t,t,rxCzj jjR.jh "hh4AEPX"ǃ0MA|9B u"C,t;Qxtu u tt,@ot wL^t w t t Zat nt st@Lwf@"t@awt@ht@CbtHwJ~f6wrtl}ftt tt0gtwetvvtt,t,{p@ tAp@}?t EHpMapp@ҡ AAlb}W<UJp@ tAp@ËMIq}uPEP( U: #t;Et@p((u EE@EE^#]EP-ǃShugSC0huiǃSju qut LM #:};= #) #EP<Džj,UREPMAhM}WMA|9B uC,u2PC0)}GxtPEip@ tAp@ËUbq$MAH}4p@E tAp@]wPUR7ǃt"p@ӡ AA4t,ujMQ}GUt5WRЉǃt%M p@U AAE.$}Gpu(f}Ufz|$߀GpW MA}A$A(y(uG|txtjpM*EP.t,MQ }%9tjt WrL](SEEP'Eu}߉}߃UMBt J  }g U% M A jPȃP}=p@U AAE%E0URlU;5"r MAh9p@ tAp@ӃAh}WQ$"ЃURMQ "Љǃ t>>>0>>>j@LjSP<;C}Sw&p@E tAp@KqfEEPCEPSu EPVEPkƃuڀcqEp@U AAEt)f~OxiSjOyVPVhP=zD t+Cp u CpSj\SViSPSfe[^_UVSu] $VjVj VjKՍe[^ÐUWVSutVPVj 8=p@ tAp@EEPF(EPVu EPSEPÃuڃEEPFEP@VuP EPSEPÃuڀfq߉=p@ס AAt(Fffdže[^_UVS]u Fquu tT uOuJ@t% t uu!Vj^ۃu?@VSe[^US]􍃀PCptjjsx'CP7]ÐUUE 8t9u@8uÐUVS]gfff) = } f= whsh P3ONRf[^load: %d.%02d not a controlling terminal no foreground process group empty foreground process group iowaitrunning cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk UWVSjEP>A  Q))QRh@BUR_vEx|u hOB3UBxuhkBR0vtXuhBEPvT1SWZtߋ[@u1tu BBPw4 PhBURu juV]SWڋBB=?B~ EBKh )RuhBURVuFF=?B~ EFN )RuhBURuWh)Ѝ G1<t<v G @1PQ)RhBURtEfǀe[^_ÐUS]M C1E<ҊA1E<w~uQ`C`9w^9wnrtQE<ҊE<wt1 t>t;9w%9w C,}y,|y,} |1C49A4[ÐU WVS}u p@ tAp@Fp((tp@ӡ AAtC uVj VWVN p@ӡ AAtM1e[^_ÐUVSuuuuu -u1f9te[^ÐUpAtApAȮAÐUEtAPtAtAȮAPhh1P1DÐUM ȮAt AB AtAQÐUVS5p@ xAp@ࡐAujj>hà ËA5p@֡ AAt hSjhCPjhC(PjhCHP؍e[^ÐUVSuFPF(PFHPu+ԻA `Ap@ xAp@ = ~j>V)-AAuAA0rp@ӡ AAte[^UUÐU WVSujj>E PLFu U RP}tRjj>] KyE xWFuj>vFF8WPFFF FE FFU V1e[^_US]CtsPj>s Kt(SB}B@PQj>sCC]ÐU WVS]E=p@ tAp@;tTsESt!+KyA)sMFC;CuCC uC C=p@ס AAtE[^_ÐUWVSu}E Ep@E tAp@FF V)9r^)9~SEPR)])F؉F;FuFF~>>uF FEp@U AAEtbE )EEe[^_ÐUWVS}Ep@E tAp@7} uGW )‰U{)lj}qGE_)ËU tAN~UUCE uH؅}CG )r'E;_uN~UCE uE;_uEp@U AAEtvE[^_ÐU WVSMu =p@ tAp@9uD~;~7A Y)9rQ)9~))A;AuAA~9Ƀ9uA A=p@ס AAt[^_putc: required clalloc U WVS] =p@ tAp@;Ct.uS{uDhLljhS t =p@ס AAtJCC CC UCK )stEEt ȅ}A)Ѻ0ȅ}A)Ѻ 0C PS ;CuCC =p@ס AAt1e[^_ÐU WVSM ]u$ȅ}A)ҋM ȅ}A)ƍ Ѕ}BE);}u)HЋUM ;‰ʋM ؋UM G9}U@;E|[^_b_to_q: required clalloc UWVS} uEE1 p@M tAp@;F~u$hNpjjhVl u{FF FeF ^)ËV9v)9~SPEPuVtSFN )PRV])F ؉F ;FuFF ~F9|Ep@U AAEte[^_ÐUWVSu] 9^u??t tH?u1EC;^u^;E8Vt(+NyA)s E8[^_ÐUWVS]} ?u18C07St%+KyA)s7C[^_U WVS]5p@ tAp@;tTC ;CuCHC C 8St#+KyA)s;uC C5p@֡ AAtA[^_ÐU,WVS]p@ tAp@;t8E 8uH@9Cu@}ߋu } up@ҡ AAt@9p@ҡ AAtU RPSuߍe[^_U WVS}G,t@ X1ۅt.WhS+<Wju S=ƃWjSEe[^_ÐU WVS} wF,t@ X1ۅt.VhS;juWS>ǃVjS%Ee[^_ÐU WVS} wF,t@ X1ۅt.VhS[;juWS>ǃVjSDe[^_ÐUSM UZ,t@ @1u Fat u4qt u@ 9PtZ,1RjuuQP>]UUB,t@ @1tRjju P>UVSh+ԻA `Ap@ xAp@ = ~F4"Vq-AAuAA0rp@ӡ AAtIe[^_ÐU WVS]Up@ xAp@Cf EAp@ҡ AAtCt|{$tSC$Ѓh5p@ xAp@4AS )‰ @ Ɉ <uC DAC DA|A5p@֡ AAtq;+ԻA `A5p@ xAp@ = ~C4"S-AAuAAZ5p@֡ AAtݼe[^_ÐU WVS}5p@ xAp@pAu$EPG4"hà ËpA5p@֡ AAt]tYGfCp@ xAp@GfEAp@ҡ AAtCCCfCGPEPSÃuW1MGt)GCGCGCG%NOfCC Cg;} _w `+E $CE C ؍e[^_m_copym: off %d < 0m_copym: len %d < 0m_copym: null mbufm_copym: %d not M_COPYALLUWVS} E}WhDbR}}EPhXbuRuUBtE )NjM M~ }uhlb;RUB 9sҍMME5p@ xAp@pAu(EPUB4"hà ËpA5p@֡ AAt1t]MAfCp@ xAp@AfEAp@ҡ AAtCCCfCUBPMQ ÃE&}tIUBCMQSACA%NOfCK K}ʚ;u+U SECEUB );EvEC MAtOy{y,u4AQ )‰ @MQA,Ѓ{ u KPsExW=}ʚ;tS )U1M M]}~$}}ʚ;tEPhbPEuRAu=RA1e[^_m_copym2: len %d < 0m_copym2: off %d < 0m_copym2: null mbufm_copym2: %d != M_COPYALLUWVS}E EE}}EPh_ehO}}EPhteQO}uGtE)E?}~u heOG 9Es܍EEE&5p@ xAp@pAu$EPG4"hà ËpA5p@֡ AAttYGfCp@ xAp@GfEAp@ҡ AAtضCCCfCGPEPÃE}}tDGCWSGCG%NOfCC C}ʚ;u +U SECEG +E;EvEC G`5p@ xAp@=DAuEPjIDAS t!+4A @ |AC DA5p@֡ AAt躵C t#CKC(C$C,C0Ctns sGEEPқ}ʚ;tC )EE?]}~"}ʚ;tEPheLEuRAuRA1e[^_m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufU WVSuE }}PhhL}WhhK)Ћ6~^uhhKV 9sAuhiKV )‰9vӃSURFPj)]16e[^_ÐUVS]u ;tT;uJCuC CN ȍ9r3,QC CPvF C Vƃ ue[^ÐUVSuM ˉ|9~#P 9w)@ )ʉP H1Ʌuى@to))XhًP 8t P 8uX 9r)ˉX Ft=)N8)y1҉@t P+P t9P rP @ u[^ÐU WVS}Gu6E G9s&t U 9W rNjF )E } `p@ xAp@pAu"jG4"h踼ƃ ƋpAp@ӡ AAt tYGfFp@ xAp@GfEAp@ҡ AAṯFVVfFGPjƃF Gt)GFGFGFG%NOfFV VgF Fu)EtdA;E sE U9v‹_ 9vӃSF FPwv)] ^ G )؉G )]t_WOǃ} } >V/Wp>A1e[^_ÐU WVS}} `wE PWqGt6GM 9s$t9O r GNjC )E } 5p@ xAp@pAu#jG4"h葺à ËpA5p@֡ AAttYGfCp@ xAp@GfEAp@ҡ AAt褯CSSfCGPjÃ@5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAtC t#CKC(C$C,C0CC Gt,GCGCGCG%NO fCgtLw ;u vu VC CPwҔ)u s G )G twWǃ} } ;SWp>A1e[^_ÐUVS]U u|,K 9v )ʋu u Å}1[^UWVSEU }_})‹?t}G 9wtrG )ЉEuOtiBut BB);E} E}>EB UBU)PJEPEPRWEu1'5p@ xAp@pAu UR5"heà ËpA5p@֡ AAt蹬tQfCp@ xAp@fAp@Ћ AAtCCCfCjURÃu}(EPUS EPU)W }tڃ;t:uE:u؍e[^_ÐUWVS}E E}G 9Ev)EUUiB 9Ew}WMA +EEGU5p@ xAp@pAu%URG4"h͵à ËpA5p@֡ AAt!taGfCp@ xAp@GfEAp@ҡ AAtCK KfCCGPEPÃtbGCWSGC+U SwU WMA[}`v6C`EPURQuSw1`}uM5p@ xAp@pAu(EPUB4"h]à ËpA5p@֡ AAt豩t]MAfCp@ xAp@AfEAp@ҡ AAtmCCCfCUBPMQÃl+E$CE@taK{ u Ex,u4AUJ ) @EP‹B,ЋMA(EACURsEMAPEC MUJ ؍e[^_UWVSEEUUUUU UtUDEE 5p@ xAp@pAuj5"h蘲à ËpA5p@֡ AAttYfCp@ xAp@fAp@Ћ AAt賧CC CfCCjjÃu1Xu-1FECU SC `&}5p@ xAp@pAuj5"h荱à ËpA5p@֡ AAttQfCp@ xAp@fAp@Ћ AAt触CCCfCjjÃC lM+M;M vM σ`5p@ xAp@=DAujjsDAS t!+4A @ |AC DA5p@֡ AAtC t#CKC(C$C,C0Ct9vlj{ 0{ )S 9s}u5A>9wsK ׃}tWsUREWsUR訋}E])} U9UuEE} Ee[^_US]taCt j`C jlCPޥCt2{$u,4AS )‰ @<us(s 覥u]m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufU WVS]E u}Vh(y;}PhF%f=t/Ft(F`"Ph%"hF"Pǃt҃~tF jjjjV@Ѓ uFthʁj2 fFVEp@U AAEt贚e[^_ÐUEP jjjj PBsoaccept: !NOFDREFUVSUp@ p@1Bu h?1fJuB ju jjR@Љƃ p@ӡ AAte[^ÐU WVS}Gt -q5p@ p@Gt$G @ uWÃt 8G ju jjW@ЉÃ 5p@֡ AAtp؍e[^_ÐUVSUp@ p@B ju jjR@Љƃ p@ӡ AAte[^ÐUVSUp@ p@Bu9%t%B jjjjR@Љƃ p@ӡ AAt襘e[^Ut~ tt tm@t` }|tAt9o`{ C@fG{ C8t f wf!G{ CtL~tVPG8uG\PE7W`9vЉGlW<9vЉGHyt{ wEC `"@E=d"E=~ E!]Efȁt t fG~fGZ E*}u&W tztEPVE PWjB1ۃ t SEe[^_ÐU WVS}U ]t.G xMQSRWj@j j蘾F n+fV@ ;td&t`tBF VG% VGBVG!؉VVG$fG$VG`rVG<fVGlZVGHNuW~WZF ^Й=`" Fd"PV蓿*M11e[^_ÐUS]s0s,js(ʲPSv_]UUB$ fBUVSu^F% fFt_jVDtMjVSC8PSh tjSЃC"PGF"P F8PV tjVЃF\PVe[^ÐUS]C$ 8fCC"PC\PSC8PStjSЋ]US]C$ 0fCC"PKC\PSZC8PSMtjSЋ]ÐU WVS}} EWGG @9 5p@ xAp@ࡐAujjhyà ËA5p@֡ AAt|hS}fG$fCGfCG fCG C G"fC"G(C(wG8PWtjWЃG"PE f C؍e[^_ÐUEM A}u&f@APxt-Pxuf@APxu ÐUVSEu Xt$хtQQ9uuBAfK1$BAfKBBB[^UEHP\RPUS]K C8PStjSЋ]ÐUMQ fQ A"Ph"@tPQ0ÐUS], fC jh"@tRC PuC ùK 1]ÐUVSu] CPZC €fS t$fC SFtv0v,jv(蚭e[^ÐUVS]u s\VbtHuC8PLt){HuCH{luClC`9ClvCl1Vg7e[^ÐUVSuM t," %x 9v1"N9v‰V 9NvN[^ÐUS]SC C]ÐUS]M tFCt4xt@xu@tQS t␐PQS]US]M tgStzt RzuA C耉CAtA(CtJKtAt $fAJQRSh]ÐU WVSuM tw^_DžtPft fu 㐐uA F耉FAtA(FA tQt fQHQPVe[^_sbappendaddrU WVSE }tMAuhf]Su6tV >u}O)G_ )É9~9} ?l=p@ xAp@pAuj5$"h3à ËpA=p@ס AAtvtQfCp@ xAp@fAp@Ћ AAtOvCCCfCjj茱Ãu1U C PsR_\tM}}Eޅt&F UB耉BFtF(B6u݋Mqt~t v~u^}_e[^_sbappendcontrolU WVSu}u h? _ ?t Z :uыU t Z uV)‰UFV )‰;E~E9~1WE t!B F耉FBtB(FuNtyt Iyuy~e[^_semi-panic: sbcompress U WVS}u ]EF EN u1}tu څtFf9BuV虴ƃ뷐t\CuNC Cȍ9s<Ff9Cu2QC CPvWZF C F VCƃ ^t3wF G耉GFtF(Gc3%}tt Ef Che[^_sbflushsbflush 2US]C thQ 3S-{u;u{t hY ]sbdropUWVS} EXEu)NjM)AACt+C(Ap@ xAp@Cf EAp@ҡ AAtrCt}{$tSC$Ѓi5p@ xAp@4AS )‰ @ MɈ }uC DAC DA|A5p@֡ AAtrE+ԻA `A5p@ xAp@ = ~C4"S~-AAuAAZ5p@֡ AAtyq]u"}uh]SUӐC 9Y)C {M)9qU)BBCt+C(Bp@ xAp@Cf EAp@ҡ AAtpCt~{$tSC$Ѓj5p@ xAp@4AK ) @ Ɉ <uC DAC DA|A5p@֡ AAtUpU+ԻA `A5p@ xAp@ = ~C4"S|.AAuAAZ5p@֡ AAto]tC tMYEC MUJe[^_ÐUWVS}_CGC )GGCt+C(Gp@ xAp@Cf EAp@ҡ AAtoCt{$tSC$Ѓk5p@ xAp@4AS )‰ @ MɈ }uC DAC DA|A5p@֡ AAtnE+ԻA `A5p@ xAp@ = ~C4"S!{-AAuAAZ5p@֡ AAtm]e[^_Ðsbcreatecontrol: message too large %d U WVS} $X vE Ph 1 jjƃu1lp@ xAp@=DAujjkDAV t!+4A @ |AF DAp@ӡ AAtlF t#FNF(F$F,F0FuV18^E PC PuR ~ E ECECe[^_UWVSEu xURURP@ÃucEf@Ef@ E@"vvEP6ÃtuW9uBUEB$UE؍e[^_ÐUVSUu EP6rÃu:jvvEP{ÃuuEp$Ãu(؍e[^ÐUSU] EP3rfusEp$]acceptUWVSE xt!jEPM qFRƃEEPM 1Epƃ=p@ p@EX$Cu =p@ס AAtjCt'f{up=p@ס AAtVj#ef{uIf{$uI u8jh"hC"Pƃf{uf{$uC tfC$5f{$ts$fC$EPMQEPd>ƃUE[jSAuh!Ef@ Ef@E@"EX$jj"EPS M QtBMA 9EvEuREpOƃujM qEPOƃEPƪ=p@ס AAthe[^_ÐUWVSU} EP7rÃEp$F%f=u %jwwEPo ÃuVnÃF%f=uu$~=p@ p@Ft%f~$ujh"hF"P躾ÃtՅu ^$fF$=p@ס AAtgfu芩u؍e[^_ÐU,WVSu E@EvvEP6ZÃZvvEP6<Ã/}WEPEP;ÃEEEf@Ef@ E@"UEB$WEPEP;ÃEf@Ef@ E@"UEB$E}GuuUÃu8~uuu8Ãujv W=MÃu1UuAF>AF$V(MA(Q,MA Q$MAQFA1FtI@ UB PrF$F t-@t&@ UB PrF @p:MA hH}tEP&}t UREe[^_unp_attachUVS]{`t{<uUftft05D"5@"5L"5H"ShWuUjjj,>^ƃt9j,VTs]SrEF$S)ЍF(17e[^US]Ct@xs5VC{ tSj6sk{u3X@s輔 =QAt 3>jS_  jS_]UWVSE PMyupjv HVBPS Dž|EDž\XEEXPv= htI|Plll9u ST P?TST0}hAEUB@$ЀfEjB0RlSEP|PhPl u:hMCxYjhʚ;jE P,UBMQjS1[^_ÐU\WVSE uPEEDEJMuX 9u|t(EP<Ã}ȃtt &VF0hWÃ_xt9Uf9t)hMA @ tICtjS ƃu =:C^xtjhʚ;jpCSEP&ÃW\R؍e[^_unp_connect2UVS]u Kf9t)VVQ ftfu/BAJS+J SVh 1e[^unp_disconnectUSUZ tqB ftEfuYC9uBC!ÅuhQC9uBCB`QCC 32]ÐUUf8uB tt PÐUVSuE fC$V/{t&CS蚱v7jVH[e[^unp_externalizeUWVSEH"U@p SRG"u(tEPKu(}tuEEPjUR/thgKjEPV4UBMEEH QAjWEP3 Ku1e[^_ÐUWVSE @EUBxuxu M;Q t rX E19}HUE;Ps u x t xu E9u|ωtPujEPS3UMEjWEP2E@ E@QA Mu1t*PEP jURX1e[^_ÐU WVS=@\@4@>At fcϋu>AtlS t]C tfC 4@u?;St:fCf{ u,S$t%B x"u@ thrLu=4@ujj& APUE>At%C t;CuC u EC Ӆuۉ]Kx%fx u@$t PcKyމ]Kxj6%Kyj&WW@e[^_ÐUEthPÐU WVS}tmt`fxuQx vKPzu?zu9r t0ÃjEPV0uE Ѓ Ku uue[^_ÐUUBu 4@0fBÐUEH QAjP$bremfree: lost tailUSMYuCpCACAsA9BtCAs9BuCAuht QABABQA]ÐUWVSpCACAsRCArhAjj5 #SA # #șEU191E]|@j|SICDChClC!Ce hAKHCx;u}E@E C8C0 CA{8tCACt KHCBSAt AXACAE|F;5 #8e[^_UVSujjuu uËC0 u3C0 C0t {hufshSH"@@,ESL e[^ÐU WVS} jjuu EPNËC0 u3C0 C0t {huf{hSH"@@,E$1;uE4EPukjjE4E4EP‹B0 u4B0 B0t zhufzhRH"@@, RF;urS9 e[^_ÐUu ujEPEPuu uÐU WVSu~0u$F\t@Ht@<@tVF\t$xtu @x@@Ht t@t@pF0V0V0p@ lAp@਀tv\Vb H"@@0F\@hp@ӡ AAtEF0 F0VuV! ÃVF1e[^_ÐUVSuF0|KF0 F0p@ lAp@v\Vap@ӡ AAtEH"@@0VE; #})ЃlVF0 F0p@ӡ AAt>UB8)PvHBHP蠊EP8)V8x8F<F0 F0V9U EP,DASt-C B S CClAC lAlA@D9Ct4DAL(DASt/C B S CClAC lAClASE lSt C B C lAS CtCBCChACthASP ClAhAC hA1e[^_ÐU WVSu }=P" x"9(RA}'jjj@iCÃj@S9(RA OhASt C B C lAS CSttPSCstFD G%CUSBDCGC PC!PwClAC lAClAGU3BD#tAhAtXSe[^_ÐUhAlAhAhtAjj5x"zhAÐUS]DAPDAЉCDuLtAhA 9r$t@@u9sݡDAPDAЉCD[ÐUVS] hAAt9XHtQ}AAQt A B A lAQ AQttPQAhAQt hAqp AlA hAA hAхe[^cluster_read: DONE bpU,WVS] EEjjEPURMQlj;G0 t`MԋQB4GGEPPEЃw+ԻA `Ap@ xAp@ = ~j V13AAuAA0GGBp@ӡ AA[QGw+ԻA `Ap@ xAp@ = ~j V}3AAuAA0GGBp@ӡ AAtOG1%=uURjMqxUB B 7zvY5p@ xAp@Aujj hXà ËA5p@֡ AAt _]؍EؾpEEEEEEEuw EPMqfEЃEx+ ԻA `A5p@ xAp@ = ~j S.AAuAAZ5p@֡ AAJ@űU)ŰMQE=v E?9RU̍PMqGEĉ+ԻA `A5p@ xAp@ = ~j UR=AAu MĉA AMĉGGB5p@֡ AAt_ GUM̋EHpMQG8/R`EP w+ԻA `Ap@ xAp@ = ~j V6AAuAA0GGBp@ӡ AAt UrMqE@EЍe[^_ÐU,WVS]$CECEeEe u MQ$t }t tE%EE@cx@URhW~Sу:/uZB:/t)ȋM)ASttE:u+Exu}t EUzK C CSCBt1: "t+C tЅtPCPh艠[$u׸]ÐUMSASAt9Bdu A9Bhu SAu1ÐUVSuF H #VdNhf=?u f?? ‰U]K=SASAt Ef?S]uEFde[^ÐUU1ɀ:t1B:uÐUE@@@H@L@<@@@8@4@0@,@(@$@D@ @@@ @f@f@@Xvnodefree vnodefree vnode isn'tU WVS}5H"5 ? x"@9~  ?9|%@=@uGA=At = ?t0jjh ÃhS;@ uh腙{4tSh hwSPt CTBTCTASTCPc1C|{tt VS3 C0C@ǃǃǃǃǃǃCxCtSEECLu S$C4ǃ1e[^_ÐUSM] yHtQXt A\B\Q\AXYHtCAXt CQXP\KY\[Uju uUju uU WVS}u uQEP5CAjjt 1]ECtjWS#Et Sx]1e[^_ÐU WVS}5H"Gtv1cVSjE E ?HAEEtSSxM ;J u)Ct9Gtu!{4tVhSu ZuŅtu {t5p@ xAp@0Aujjj Gx Gx0A5p@֡ AAt GxU P GxMWxBGx@Gx@9O1K1S(VjS yVjShGLCLGtuS؍e[^_vgetUVS]M uC0t C0jh?jSU tC{4u={<~SPuCTASPt CTBTCT@STCPc1C4t4uQSnƃtC4PS4u S1e[^ÐUVSUH"B4HJ4ȅ~SjRwdJ1 @z<~Aztu&BPt rPpT BPAJTBPABTArPqSRve[^ÐUVS]5H"C4PS4ЅxK1 @{<~A{tu&CPt KPHT CPBSTCPBCTBKPJVhSmmu VSve[^ÐUWVS}5H"EEXE9CHuCXE;] tttC0uft {8tX{tuR{4ttACtvVSt*VjSCACLjS E]n}u1e[^_vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drainedU WVS]{4tGC4C0th%"誒C0SURhSuu  tjjMQjjSQ t&tEPjjSmURSPtMQjStEPSltt h6"ttC4PS4uf{<~hM"K1 @{tu)@CPt @KPHTCPBSTCPBCTBKPJSKfx|Sh_"e+ԻA `A5p@ xAp@ = ~jWo;AAuAA8B5p@֡ AAt9ǃAACLǃC0€S0tC0SSe[^_ÐUEx4t1uPTÐU5H"u5vgonemissing bdevmissing aliasvgonel: not cleanU WVS]C0tC0jh%jSOu jS{HtjSCtPsxE9u F2AxHtQx9ZuFBuh%[C1tb1sxt8QxF 9B u Ct9AtuϋAxHtQxF 9B uCt9Atut݅u h(%ug1c1{x+ԻA `A5p@ xAp@ = ~jW6AAuAA8CxCxB5p@֡ AAtCxCtC1 tt{4un{<~h6%.9@tQSPt CTBT CT@CTSP@CPt@SPPT CP@@CT@e[^_ÐUWVSMu }1ۉȃ?HABxPtBx;H u;rtu[^_ÐU WVSu}] 94EPWE PtjubkC9~΍e[^_ÐUWVS]C1uC4SQ搐1CxEt0Qxz}}G 9B uCt9Atu A4u9uƋMuЉe[^_VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, holdcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) UTSE] tPh(esJw= "t.C9BtR$t9Butj(RVWUR@-e[^_kinfo: vp changed UWVSuu4@ BU +uE 0 UUE ESASAURhAjSWt;uCsE9XHt ="thy+袍uՐ@XE;}gjVEPuQhFPuu6EEu;URS3SA>+uE 01e[^_UWVSu1^x{t7F1t.BxPtJxC 9A uFt9Btuytݿ[^_ÐUWVSEEP\uFUB=t ] MC0{4΃fC4EH=1^MAd4jj1VÃVSEp\WpXeƃU;B\~ B\MAdt<}Q\UPMQEp`ƃUM;Ad~AdwE EuGhj(h4AG5USp@ Ap@,RAtxl4Au Pc<p@ӡ AAt6 " ""9|1B""]ÐUS]EP5?ASj t CE@8E@t 0?4?4?t;"~M,?,?,?0?u",?0?,?4?54?uEC1]U WVS}GpH u[5 "PwhAjV u5F<Ã@$FtyWC<t$C t S.c>߉SA,SAu C SACBSSAtϋCt@xPC H{t hHkWhAhURC> t S.jS$1e[^_ÐU WVS}5 SASAtnWhAjVt^HF<u/Ã@$F0Bu ,AH@<t r,xtu],R4ÃuD}hAEEEP0rEP,Q<Ãt`EPj,RCCMQ0pBP,Q40P؞<4R?%MQj,PBSEPjXP`?Ã0tHURXqAP`/XPh\RMQh`4XH @URj`>hE1=XQ襙h\P `t P؍8[^_ÐUWVS}E |2PG0lÃjuV|0UÃuzV臾u FaQEPEPQB ЉÃuAWuVu1Ãu uj`|pV;؍h[^_ÐUWVSu} 2PF0jA$fy u.xtt(FVEUuEPvvQSWHle[^_ÐUWVS}u G;Xs tAu >A$fy u.xtt(FVEUuEPvvQSWle[^_ÐUWVS}u G;Xs tAu >A$fy u.xtt(FVEUuEPvvQSWme[^_ÐUWVS}u G;Xs tAu >A$fy u.xtt(FVEUuEPvvQSWne[^_U|WVSE@,E@EU tE %=u M uF$F( uF(LEPÃUzum}hAEEfEjuVEPr EPE$PEPUrà 5e MIME$PuvF;Fu P胙 PۘE@PUM t e JuF$E u F(D UB(MQfÃuvuUBtu -Su AM t#uVEPhURà M tPu~tu EPÃURMQhuVÃE txURjMQjuVEPUR MQhuV}hAEEEPUREPMQà u4uVEPU RMQkÃuu tE@81UR؍x[^_ÐUUBH@<t>Btw6$\B0tRQu 1UVSuE tN8uuPVÃVߖ؍e[^ÐUi1]Ð, fifo with %ld readers and %ld writersUE@xp phÐUUBt"t 9t#1B 1(B 1B 1ÐU ÐU-fifo_badop calledUhFU1Ðkernfs_get_rrootdev: no raw root device UVS=|"ug|"=?tT1;#}31? x"PQJ;?t&C;#|x"he[^kernfsUWVS}G>t -EP5DAWj sp@ xAp@Aujj@j詀ƃ ƋAp@ӡ AAtuE@tEH0EO=WqEPjYPu C^UZ)PRvjZSvjSh7[n1e[^_U1ÐUVSuE{4~@PSVxu.SxSP|j@dž1e[^ÐUVSEu H"C4RhS1e[^ÐUVSu] 0?AC0?AC@+P?ASC Cx"C+@CFD9tBjC PFdPZjZCTPPZjZPPZjF PCDP7 1e[^versionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u UWVSUuMB /tf tCtgYtg5 [C_y]Ssuhs0B0h|B(At;a0t "C 9C}C9E  U )'9E U S9|)‰)+E 9vȉD>AA9}S6h@%AA9| S6hEA4X DT>Ah5>A5 >A5>Ah6<!P?A@)‰Ph6װI;M ~U +M 1e[^_ÐUSEU ]@ /t/_uR| uKShEARkWƃEAA1/| uKSh@RAWƃ@>A1]ÐUWVSEp PUXNMFEw ~u*U:.u"MC4EPhS<E"1;=\"}8UBV9uRMQEp{ t8EG;=\"|˃URhS>D:My GuWY;tEPUB P3yyu EMEPju quEP5DAsHj lƃtURhS1p@ xAp@Aujjjy‹EEEAp@ӡ AAtnEMUA BtEPhuEU1e[^_ÐU1ÐUUB@0uHmr BPjjP觀ÐUWVSExpj`V,oVjFF GH@dFFFF STF$S)ЍF(F$V(F,V0F<F@FDFHFLG0t,fFmfFFFFdC CfFfF-"F1ǍhPWSu؉~~1[^_ÐUE@x@u1-ÐUSEPXztu-GShPRQftSPu1ÐU WVSEPxztu -{G G t \G9vƃWVSyu3u(߰эAPSP[^_UWVSEx@xtt v } Džwj P`lfDž "{ Gu%S:tmPC P2ttPFC@PPsXQWj PF uFv ;5\"oww [^_ÐUSEXpjSCt1]ÐU WVSEx+ԻA `A5p@ xAp@ = ~jv9AAuAAB5p@֡ AAtiLJ1e[^_ÐUEPJwm$8\l|@ 18@ 1(@ 1@ 1tag VT_KERNFS, kernfs vnode Uh1ÐU1ÐUS]s s,sk]ÐUS]s ssj]kernfs: bad opUh=U|WVS] Sul}UB8U)ƋUB9vƋPuC,u S)n} MWS^u9EPVUR6u!Uzu{1t WSҡUBB x[^_UE@, 4U WVSu }u1~VuÃuiV, u F NHuu V+mF Wv pv 4؍e[^_ÐUEÐUVSu] SNA9BuC-t2P1Յu{4u=A| 1e[^ULWVS] Su@}UB8U)ƋUB9vƋPuC,u S!l} MWSڝu9EPVUR.u!Uzu{1t WSRUBB e[^_ÐUE@, 4UE@ÐUWVS}GEWUBxP Up UBHt @<?UBt$ȸ```````;5# GA~<Ŭ #~bEP8ƒt5EPjR7ntEx4~PZsÃURi7 #uEH0URjEPnwh wUR #ЉÃEPhURz;5 #rk=A~' t!Gt)U҉)ЋX #`hGvRvURЍe[^_tag VT_NON, dev %d, %d UEPBx@ PBx@ Ph!s1ÐUEPJwm$@ 18@ 1(@ 1@ 1ÐUEPppp pjjBxP6ÐU spec_badop calledUh*UWVSl"+l"U2)ƃ95A5A=P))Ӊ))ى%Tv) f CA;AAྲ)Fntm9sp"tX"19rK)A wK9sA@fJAvD fJA}t CAUf}t7Eȍ4UZk_k)ىȋU JAE f[^_Ðdos2unixtime(): month value out of range (%ld) UWVSu] uE@Pكځ) Hځ )QE< TA9f5TA1ۉ% 19st m nB9rEp"tEX"%ujh1ҍH9sEPB9r\)A=Al"+l"UQEM))ʉ)ЍUBe[^_UWVSUM :u }" "A}t "B: t*"BA}t "GC: uփ)ڀ: t6.AG1ۀ: t*"BA}t "GC: u[^_UWVS}E E HKyE @ <.u8}u U ..u"}uM .A.}]K AK< t<.tw11O]x&A t.u u t1Ky݅tqt) )U)‰U1ۺ;]}J3"M  83t }tEE <u E JCB;]} ~ENqAN< t<.tF19sI"M  8t }tEE <u E JBG9s ~EuU _M 9u}t}wIEuM9v/}t6\IE)EE0U9vu݃}t1VU z u KE < tA)ƍV)9~)U ~ U AC9r[^_UWVSuM }T1IJ< t<.tEH@)щBKyEG G EG fGWIxIFBBKyWIx1FBBKyWIxFBBKyu@ B@1[^_ÐUWVS}u E@t H MMA 9EtE}Ѓ?H@)ޅ ߋMANyAu݀9Ґ"GA8"uAuKyȋMNyAu9ty뒐"GA8"uAjKyċMNyAM9t-C"GA8")AKyE[^_U WVS}uE Eʀ?B<@tw @E PG 9t$?H@TM эWBAuU B(؈B/tkBuhKyэWBAuU B(؈BT/t7;Mw2Bu/KyЍWBAt /tCU (BA BuKyʉ[^_ÐUU BIyÐUE UH~ J t.t=H ON)‰1UhAjj;x"x"P3@1ÐU WVS} 5H"EU#A@t:;{uE;CuE;Cu{(t߃VhsNPu1e[^_ÐUWVSMAEy}q#A@Ѕt2};xu;pu};xux(t uօtJY 1[^_ÐUEHttJ@denodedeget(): pcbmap returned %d UWVS} H"EUztuuzuxPUREPV;wtVtVUEG EGEfGE t t tu qEPEP ÃtURhEPE ڃtڃu#|VjYEPu :|Z)PER VjYEPu|)SUPXj|ELPEP1X[^_RRaArrAaUUFH EPU@(E=v t hEEPjhjURà UB0 B0EXHs jj;h"ǃhWlE VUfS fFf_fVfF fWFGfVfF fW fVfF  fW"V F  ‰W4fV fF fO(fVfFfW*F G$ E@xu(fZ}PfEf?;f"uFVFFF‰W,VFFF‰W0FV ЉG,G"G0GfȺ1A9G0f urf"4u~VF uoGtLJLJVFFF‰W4~}F UBxtu }]CW;UBG0E؅Й}U؋E;EfGW0G,G,GfGG"fG"G4G4و]__8tuDV!F"F#F$‰W<GG4É_DV%F& ‰Wx/OO4ىO<W _T1É_@ىODGDO0)]1ƉwHNOLGG4GpE@xt#wG} t#}u;G*fHfv-tuAwGtLJLJGtLJLJtu G@GhGhOWh1OlGuW\WӉW`BGXuOT9t Ou5ExURjhwxEPà VEXHjhS` jhP? uljhP" uOjhP u2‰W| Gxu>EjjSUG\OT)eGDEUUU{u MOF,@U9BtG2PR*$uf{} f`N`N {@t>F,@U9BtG2PR#u"CBt f`N` N jVe[^_ÐUUB@BP9BTu;jjBTPM؋A\ˋKT)BPPuV:E t E@TExTuLPĺ}vEjEPjEp`WUR裶E ]MIMϋ]#{XuFs`)9vƉuEEUMAQ EU]܋Cp19Uu)9Ev$UE܉PpM܋Ap1RP]SjEP߻URVUBHPm?E Et u薷#7M;A`u u. uu]܀K}uXu~tIUBR ẺUЋM؋yT tu9^9VE}tmEt6jjeURMQ]SzEu+F)BZ MJIjje]SuvpVEUE9Pt#EMtj]S膲EEe[^_UÐUÐUÐUVS]s{ PV~{ Pe[^ÐU1ÐUWVS}WBH@<`A`AEuR)ЍFCtf CtjChPCjPw 艢K` C,u4CtjjCfPw`CtCaPCbPCdPVEcC ]$߉CC`N{(DEPEPS)9j uCTPUC`B E@ UCaB UCbBUfCcBUCdBUfCeBUCfBUfCgBUChBUfCiBUCjBUfCkBUClBUClBUC`uCpBUC`u CpBUC`uCrBUC`uCsBC,xtuUCnBUCoBuu1 uݳe[^_ÐU WVS]SCztu EWVE9usssEe[^_ÐUS]s srs-]Ðmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?UlWVSEE؋X]PUԋPUHMЋ@E̋M؋y H"EEEMЋAHEJHE;HHu ؅tw;HHtrURMQq];]uSEPpEt P]WURYqMQ 9u1닃]ShuhƃjEЋEEE@`t\uG8.tU9UtG uMA uB@t!]Sjuq @UĉBEMԋMEEt E][ ]E@$EUrr hu2jƃMQjuCq]ЋMԋRl 9PltE]S}}{}tuEPURƃmMAuhP$ٍ]SEPEPƃ5UԋUEEt E}MA`tAQu B}u ]S }t EPURlƃnuEMMQ]SE6ƃ0G$ Guh$蹌}uURjMQtoWEP]S`EuV}th$oEp}tURjMQo]S1UЋO M]9tN}th$EpR}tURjMQnEgPEj ]]S]ăTStj SEPeMUJ EB$EPjRURIƃ t4j SMQ-}]SjEP niUB(MO RWfƃt!}B]SjEPm(}ucjEăPjUJTEPMQoƃ t"}]SjEPvmUăzt ]M#YXZEP}tURjMQ4m}}]ċCluh$2MQ\ˋKT)CDURjs`Psrƃ t uJ(E܋PH MAlBAlBuƃ]SjulEP }tu\URMMĀaue[^_ÐUWVSEhP d@`p,xlu@p`9A r jxPjjjV,ǃ h|\PEuE`A`AppR)ЍCEtb EtjEPEPS臗M Eu2EtjjEPS`EtEPEPEPSEe㋕xF\NT)VDjjv`RvaÃv`sHmj@sHh"SHxBxBEBfEBEވBfE߈BE݈B EBfEBEBfEBEBfEB`Al ~tu;FUVS]CN,S tF {u1.CtjjsA\IT)CPVee[^ÐUmsdosfs_strategy: specU WVSEEXC\1@twh;[yCP9CTuPjjCTPV,B\JT)CPPV֝ǃ tCT{Tus>==>=>R t15B 1(B 1B 1UWVSE $8>>>>>>>>>t>>>>>>>E@:E@E.UBEE@EUBEE@E=v 5p@ xAp@pAuj5"hCà ËpA5p@֡ AAttYfCp@ xAp@fAp@Ћ AAt_CS SfCCjjÃu 7 C}+}{}`5p@ xAp@=DAujj"DAS t!+4A @ |AC DA5p@֡ AAtC t#CKC(C$C,C0Cu7TEC E}t&U)S SEPREPƃuURWs}ƃu1 Se[^_ÐUME APHPbpf: ifpromisc failedbpf_detachd: descriptor not in listUVSu^~4t,F4js;tth@sS9stuhAs9u{u F@Fe[^ÐU=ȸAȸAtȸA11ɉȸAXXIyÐUSU~ CBȸA;ȸAu%jXPT"AǃA1]ÐUVSEPȸAp@ xAp@At Vp@ӡ AAtVV 1e[^bpfU WVSEPȸAAu AM 9At t=p@ xAp@AtAuxAAC$S u C$;xAsRhBhS1ƃ#tu=p@ס AA#u+{u]Su9=p@ס AAt1{u2{6dSYCCSC CCC =p@ס AAtE Pssƃp@ xAp@CC CCp@ҡ AAtFe[^_U,WVSM EPAu zyu1wEEPEPr Q@ƃuWUG<9BvR(<p@ p@jEPRWG|Љƃp@ӡ AAte[^_UEPt P @@@@,@0ÐU WVSM ]E4PȸAEoB@;qB@Uw?iB whB fB@8jB@f@wsB@swt@TnB@xU~fwBpBwkB @%rB }fmBwvtgBlB fBt`p@ xAp@ӋظAиAtܸAp@ӡ AAtE8A{AUU=v w U G@EPW?E*p@ xAp@ÃWIAp@ xAp@Aujr EuƆAp@ӡ AAAp@ AXURpaEPWcEJU`"z=d"ǍAExdžAA=`"1ËEA1d"EPAUABUAEff@U:t džAsdžAgUAZUAC@ AC@A0A"Uv EA AUEe[^_ÐU WVSE@(EE xu-8p@ xAp@ËE@(kE 8jjS!ƃSVE p uhWV2tWp@ xAp@ËEp(Pp@ӡ AAt6}tjEP1jVe[^_U WVS} 1GW?t A< wBuu 1ɐ9B<v B<v90A~5A^WCPF C4u 2ExuP:uvp@ xAp@UB9t t RVEP%URp@ӡ AAt16Be[^_ÐUju EPUS} E%PȸAp@ xAp@ܸAuAt'ظAtp@ӡ AAtL?y ty$uxAA$APPu]p@ӡ AAt1]ÐU WVSE} uXt2C,VVWs(th(PVWS uэe[^_bpf_mcopyU WVSu}E Et@uhMgG 9vÃSEPw赶?])ރuÍe[^_ÐU WVS} tH1p uEXt1C,jVWs(th(MPVWS uЍe[^_UWVSuUF@EE9vEEV9~UNy];9~pV u F0`FFNVFF V!*~8tFA  CA A  ‰ 1[^_ÐUVSU] u)Ët8B 9}J)؃~ffQ &u 1@ ‰[^ÐU\WVS]11u =$SXXYYZ(YVdZtZtZtZtZYtZtZtZtZtZtZtZZPYVtZtZtZtZtZYYtZtZVtZtZtZZ8YtZtZVtZtZtZY|YtZtZ,WtZtZtZ$ZDYtZtZtZtZtZtZYYtZtZxWtZtZtZUBu>p@ xAp@V{p@ӡ AAtڶMAt;F4u5p@ xAp@Vp@ӡ AAt薶V4RMA%q fV4QWV2PC0EUBF@2PC0`Et[MQWVf2PC0 EuLtEPWV*UB u -VMQWj UR@ЉEEe[^_ÐU`AdAFtVxV(tAF4t;MAff|}E|EEPRwtt jjjtÃjtSFC,PW5x?EC\EBRrB F f~}|?MA C C(C4C d~C(1e[^_Ðrn_init: radix functions require max_keylen be set rn_initrn_init 2UhejW賋 UBxtP8~JP8E@xUB4tjEPUBx1e[^_ÐU WVSMU u<ABAB9v "FAB9r9s )SR'e[^_Ðrtinit: wrong ifa (%p) was (%p) UWVSuEEEEet~>} }u>~t8jjdEu 7}EXvSW߃jWÃtHK89sDt@}t EP貽3}(APkEPF EEPv6WE Pǃ }tEPM} u0u,]t%SjVj C8@C8S;} ]t~K8CD9tfPVhCDxtjSj@ЃCDP  JP sDF C@F @EtUP蜴ǃtCW U̅t9Eu}t,MQuEP耵ǃOPvEtPLǃuEtPv v45ǃtHG E̅t>FD9t7txtuVj@ЃFDP tJP ~DG ỦV@FPPC$Ps %FDtxtuVj@ЃEtFHC #FPFPS #S$ ЉFP E-t}t MЉKK@}tEP1UB@u2=PA#tjS}MQݱiEȋptSPjURjS| tfFEt f@f"h"h"h"MQtfFEЍe[^_ÐUSUM ]tACtAC tAC@tAC}A C tACtACtA C [ÐU WVS]}j wVp1;] s*t;t H \A;] r֍e[^_ÐU WVS}uE^ 9] ~x)] ]>u/FPjM 9lvlP 6^ 9] 0>u'FPjtTlvlP 6~=F +E 9v‰ӃSE FPEPzT])] E ]uUBt M9J}Je[^_rt_msg1UWVS} |)} ~ }tEET EL}~hjjÃH}`5p@ xAp@=DAujj聧DAS t!+4A @ |AC DA5p@֡ AAtlC t#CKC(C$C,C0CuS1ۃEC CC{PWmEE Mt3M :t H pRVEPSguE}~M9KufGEGS׭1e[^_ÐUWVSuEE } |} ~}t TLutEE Mt7M :t H XtSVRQރE}~u~}tt}unUB B _ztY9z}2BtjPxjjWuMAtyUBtEMAtE@UPf8e[^_UVS] s=PAt[SutFAU@PUPP t fFf" f"h"h"h"Qe[^ÐU,WVSu=PAtgj$]SkSj>à tECV0fP V4Px8@f"h"h"h"Se[^_UPh:E9G@tDPURqPG@Pu>PhDj EPEP*PuW>PhjG\ FjFDPUR?\t`A$"G\g4C{ tWw s }WG|C }tEPE;Eu$jEP]S`?jSURCjjPoÃt{jEP]S#?w0jSFDP ?j}WEP>jUR}W> Ef@f@u]jSEP>jEPEP> fC EEjVUR}WG|Ѝe[^_arptfreeUMQuhz8~B0txu@Ab4jjrjr jÐarplookup: unable to enter address for %s USE] ???}ƒf?Sh?cƒu1AJ8B4%=u B0xt!tۃ5?;Ph$j뾋BL]U-ÐUSU] PCHPPRCK]ÐUVSu^ vINffu9AQЍE9r$Af=t=u V Ve[^UVSu^Cf~ tV=P"trF;T"ug=L"uNjPCP uCjh?CP Vt3؋M9K u9SHt@$5p@֡ AAt>}tESURCDU€u C, E%=u C,C,C4uC,C4Ch!C,E#C,C(U#S4S0CdPCUB@C$B4tC4 C0CXC, C(C8 ut{Ut 1GCMEPjS@ǃuKUfz4}EREPe[^_ÐUWVS]u t}t F4uA1~9toQ t`u(xuLz4tA4t;ZXt1;Z0t,;Z8t' xu$A4t;ZXt;Z8t ;Z0t;Z(u RuI9u1[^_ÐU,WVS} 5p@ p@ࡠA@/AAuAAZ5p@֡ AAt-1e[^ÐUVSuE @ XjS1CF6fCF0Ce[^ÐUVSuE @ XjS1CF4fCF Ce[^ÐU WVS}E UfUUfUxu]ptV9tP9s u#{8tEf9C4uUf9S6u E9C0t [ϐ؋[} tURPE Ѓ믐e[^_U WVSuE xuCxt<9t69{ u {8u [鐐؋[}tۃURPEЃɐe[^_U,WVS}w@tbG@j$]S0D}F0EFEjv4Sj F4tjv4vv0v j@ V˨e[^_ÐUS]C@tP覨C@]ÐUWVSE UEMfMMfM0U9tlMf9H6uY1ҋH tt9uHMf9H4u> tH0t t 9u"tBtMt 9} Eׅt@;EuE[^_ÐUVSu^@~@u9jSA/F8@ @8u~ tCCF CSe[^ÐU WVS}u 1ۋt'G9FuEt B8HB8Uu4tx@u(FFGFV蟥jF P. t B@@4uZDuPwfGWoÃu WSpfwu!AuMR迦[G%=u9}t3Ut*A[6 . #vS9|w lAS%=tGC ffC `"C Vfe[^_ÐU,WVSExE$Ew u tUR9f wG GA[[]%=&]SuDEMUEBBQaEUp@P#cA@====>=thu;y~|E 5"5"VgEhAV菧E^Sm|FV]cuh;xSsCw u<=AtKF<wB~tV"t,FC0W tE=AuE1B<vE/BC VyaV?eFtt E8}C u E9gG@PVEP0EEA1QE-3WS誮!WSڮh;3w}t URZ!Ee[^_UWVS}E EuCACAH@UCA=CAdu CARH@fL@MfN@P@t}t%hEtP}t} u j(E PEUfBpe[^_UWVSUB @8E}  p@ xAp@AujjEjǃ NjAp@ӡ AAtEuAMQ1EE0t!FM Q u6t F@)Ѕ~}UBXXM +YE;A‹AAMQh+ ԻA `Ap@ xAp@ = ~jEW@0AAuAA8zp@ӡ AASEP)U)M YAUAAMv tFBV+ԻA `Ap@ xAp@ = ~jEVL0AAuAA0rp@ӡ AAt!ut;NEE PY)څ~$A9#ӉYf)QRv f(UW MU fBW}uMtxE8GUtxM9OEfxOU2BVMAD9B0F@UBDF@ $MtFAVE@ tv v E8P2b+ԻA `Ap@ xAp@ = ~jEV.AAuAA0rp@ӡ AAtuutVMAD9BE8PEP!`U􃺄tjRЉe[^_U WVS} p@ pAp@RAƅt4=RAt-'PfG tN EHEUBDMA $EtAExA|A]SuVV]ԃ8SKS}W?Jt^jWEEPUREPMQ]SuVkE؀N }WeEبUBff MQH]KCDuFft) ft`f t"f tHO}fGBEf@6UfB RMfA x]SE ufF x}Gt1E<u ujhAUREPj }u MAb]SQu}WEHP 5"h"hA.UMAuuF%=tl}tjEpjURrMQ*]tEjjEuFP}WwEP }tkURS']}t5MA @8@t&uujhAQEPj8 ]Su}t uV&e[^_U WVS}] fEtW ttwE@ jEPCP萧EffEUB O@S9vЈG uzEjURCP(UffjE PCPU ffE@ tOUlA)u}~.t'u }~s~ ;uE@ t!EPWaf}t W~e[^_tcp_pulloutofbandUVS]EE p|C 9w)Ƌuh]@WKE@@<PyHxC )HPQAQK e[^ÐUVS]u ANSlftEf)fClffClf}Snf)fSnffCnfClfCnfCffCSpƃN9~KpClfSnfCf9}fK f=~fCfCz[^ÐU WVSEx "UӃW-tjp@Uu[@TtX/tH="uF4utw btt^<؃} tv<؉u"9sЉE} ~ U EfPbEfxbt @b9v؉ø@9s؉ËUfZ`B%f=u} u*Ep9}%PX1ˉ9sʋEPXUZXEfX؃} tEe[^_U WVSuF P8U^Pǃof~lOlGP@t5C)fVpfw fFpf=vfFpC)fVlWpt C VlfVnFlfVn fNFp9} FpfF f~fFGduUB`9sÃSV'D1Ë,"9vЃPE\PCG`uUB<9v?D1Ë,"9vЃPE8PB`tEphƃ}]fCowFP%=@jvb(jvbf{6ujSgƃWSkƃEP|UBuSl+MIq<]S"EPV AfC"fC AC8 {ACMb ) )ˉAMA8A,ATA(A$QU-&]SE@P#URE  PƃMA]SEPE\Pm%UR]ƃ j5MQNEc]C`UB@M p@U AAEt1{]{4uC@tE@u UBxt u #MA ]KUByrxMA\Q`)‹AdYh)É9~=}EP7URE\PM$MA\]C$C,CS-C NWSk=WSk-WEP7E } h{34}t&UBtjM Qj]SEPj Up@U AAEtae[^_ÐU WVSU M}E5p@ p@Bu:5p@֡ AAt }uUt PT6>t7B @8u EPWQRURuE E/X<}}Ett"Pt@y v:A8tK?c9t y vA~C9 fSE E*tdQVj jU A t t#QC QCE*5p@֡ AAt诚Ee[^_U WVSu~`t~<u54"50"V u]hRAV`uH~Wtf@ǀ1!FÃ$fFWgf ^7e[^_ÐUVS]C p8f{SO~}f~ujS0VF8PK&SÃt S؍e[^ÐUS]CwG$\tttfCSÃfCfCt'f{~ C p8af{ u AfC ؋]tcp_ident: cannot happenUWVS}tN}uH}uBE 8w hWEPt 5p@ p@CPsGPwhRA{lƒ u6AjCPPGPPhRAhƒ t B8@tEB8EEE5p@֡ AAt輗E hEPWY~[^_ÐUVSu]MU} t EH $p༆ȆԆ<ఆ(h"h"vh"jh"^h"RjQSV6Uj@hIARQSV@h4""h0"RQSVh"RQSVw*e[^U5<"hA\Ðudp_input: received unknown IP version %dU\WVSEu @EPtPhh 2UEtvjUR^NME9H s)QPEu @URUȉuċMIMċEfxu @HUBf؋MQ)9t*9w @)PEP}t}uE@fEftTj URMAUfB CPMQP{UfB ft@MQ@}uVjEP蒕EEUfEދMȋA EjEPiEEUBfE΋MȋAEЃ UȋB%=tMqr+WE5AAUBf9F6F0t M;AF tU;B Mf9F4}jhʚ;jEPyǃtxURWjWEP]8S( uW0@6SMQ+EtjP‹ЃEN8MfAtvA}EEPURjjMQEP]8S| SEPUjRZMAPEpPUr hAfƃ @jMAPEȃPPEȃ PhAcƃ u^@E@t @}ȍuUBffBE‹MfAjjjjURfE}t$F`7ttjjEȃPEMQEPURMQEPF88P t؍e[^_udp_usrrequdp control data unexpectedly retained U WVSE MUr1 uEPQUREP~Duul$ܐ4ȑܑL LT \HTL(8LLLLLt *p@p@ÃhAURRǃp@ӡ AAtC5D"5@"EP[ǃEP"BlVp@p@ÃQVSǃp@ӡ AAW讋M~ t 8<p@p@ÃQVWǃp@ӡ AAt^URn ~ u 9p@p@ÃVJXF0p@ӡ AAtE`URwEPQVUREP V FQVrY5QVY%1V--GhX!}thhY&UR }t EPe[^_ÐUSp@ p@uxWp@ӡ AAt߉]ÐUVSu]MU} t lEt"tQt+t2Dh8".j@hIARQSV(hD" h@"RQSV;*e[^US]C=ﾭu1=H"u)C u#@tjPS u S]ÐUWVS]E{@ﾭu1uVjjSE<{ w5jSÃu!@jWPCEE<u UBEE PSVjjS E<{ w0jSYÃut jWݔ@sE<uSU@PEPjvUCt@4u`5AtVV tH}t: yu2E@ 9Au'@tjW^S6RuvuC+E @@}tE@5p@ xAp@UB 9B|@BStjW@5p@֡ AAtibCUBuXEX@ Ajj AA@5p@֡ AAte[^_ÐU WVSuEPjjVmE kut u$@VUFu,tF)wF)v FF jjVƃu@E7+FtF~EFffG"GfG U G GhffG}tVE/]SjjVG GPjjVt Gf%fGffGESEPj REG!VU@7C@E0U u)Bf8u FBPRTF@@1e[^_ÐU} t*E8t*hH"uuuufile system full %s: write failed, file system is full U WVS}EUZ M;K0u Ext:K`UMs(s<Q))U}~a;{$|1uUB1 h|MQWPEP ~} MUJU1-hMqS,,PhLe[^_Ðdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimUWVS}E w Uzt>N`E싖U^(^<Q))U}U Eu*Pjv0wh2h)EPjEPU Rw8à tu<EEUREPUREPW à taUNd9ZTthB]+] OEPR@MA0A0SE@HEURE;F$|EtgUUF<^(Q)9Ph\jdžzV0U^<^(Q)9|MPhjdž(Pwhܛvhh|UREPURW à ENdPTw<EPURW4 E9E} U)UEPNTPW ]+] OURu>MA0A0SE@HEEPEU 1>u]:hEpV'Phe[^_ÐUWVSEDžt=P"P|MQ U$n@px HLpPT7lMIdT@TPEHPHPLTRTTЙH9PEP]SV|RrEPMXQlP|RrEuMxhS@\EPjEp03|R4 tu8>E@Hx[hxQhPVUR7ƃEt@X\SB9|`CG`)`EPjUr03|Q84 }E@HthxWVMPEP}d @Ëhx19};`utFUZ89|E9xt&=L"t uN6Su=5FMI=L"u6`A`AEMR)ЍAjQQ|P9`}$=L"t u5 u4d19}PUr0pAJd@TPEPpBUJdPTFMY89|189`}u6E9xt uk6([^_Ðmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free UWVSEEPUxf}@s XE%f=@uVxKF,9r1ɉȉ1Eh EEPQURSǃ UBH@UrWUrH@ЉÃtEPWURUBf{xt'PsCxPh\h|)t PWPhǃǃtxu @w ǃ13hUB pVE!Phܣee[^_UWVSUZ,EEuE19]}NUJpUUJl!UUU9U}U9T| }EEG9|u[^_ÐUWVS] Ep N\Et}UDFt 9}MA1E+}t}UDuEx1ljؙ @~,UEEE9}4Fp]Vl#UM9LE9}|E}9}4Fp]Vl#U}9|}YEE9E~1^8<FX9E)EN`UM9tAv}}}EEEv8uE @XxEfE~U  {8}]E!EE}~U t @`E}$M))!jN4MQRS7%KTEE19UyJFE=U t  @`E܉х}JM؉)Es'PRUrh/hٹ}U tM؍M @`E؉Eԉх}J)ʸUG;};~$KpUMЋCl#E| E}~U t  @`E}$M)+K8!jEPRS#K`}W~U t@`PSd$ C8)F$S8)CpUCl#EMЋK8)L jWVSFKpUCl!EMЋeUDMK|MșljщșEĉșыPEȉșɃ~U t@XU׍Pf~U tDTvTƃue[^_ÐUuÐifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodeUWVSEx@Ep F,9rPWUrh1EEPjUF#EFF NdPEp à tuQEXH{U tU tP`#`AC1U{U t  @\}r7PMQEph<,uh[U{U t @\¸ E;C0sC0C NpUFl#EDUB %=@u&KNpUFl!EeM Ɔu1e[^_Ðstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapUWVSEtM}U B,}MB}B)E@8E…}E)ЋMTP"E4U zU t 2 E @`PS- ^1MI8Mʅ}E)ЋUDEMPE4U zU t E @`PS u$EPSjh|h!)M Y,CE9؅}CM yU t  E @`څ}S)щE@8E)!EX""1 !9tDGE+E9~UZ8;]fEPShhFe[^_ÐUWVSE$U ыYlىMЋPhЉE}~*E}M)M (E}M)] uFE$E<0U Bp9|lj}E] MC)ȃtECA9}Uu)MuN+}y}E]UK)tEKI9~Uuމ)ȋUL;M~MU]~)}~ EM])U$MI~ ~] S ]T [^_uid %d on %s: %s UuEPu hjffs_balloc; blk too bigCould not unwind indirect block, error %dUWVSEEDžlPUMY ]px CP tu]C]#8EURUM;K0~h f]C} uvuE@EMu^P t1҉ƃ  ;u F]9wu;w EH0UU#8@#JL];K0EPEPs0Q}ǠWVVURPVMQ7à F]KPMRP]SEUJd@TMI]tu+ u} }]à4 E@UJPMT9wRu M;wEEPj]s0uVEP à tuMQEuu#8@ FL!u!9)EPjQEPUR à 뇐EPEPVQSURRMQP]SuVÅaE@UJPu9w u;vuE@#pL Ur0EPMQVS]SSEPPSURà jjVMQ]SEuNdUPT MtEpEp0URMQ$UBtH+EPMUDP4?FH @<@uMQǃt}EP`UUMqtNEHU )‰U;u~pMtZ}~8EPEHPjEHdPURMQǃ t}ԋEE؃Ur0SMQEE؃NUU;u}~L}|FE}Mt5EPEHPREHdSURMQ|ǃ t}ԋEE؃}M+ ԻA `Ap@ xAp@ = ~jURI9AAu M쉈A AMEBp@ӡ AAt<UB0 B0RGE؋MEԍe[^_UWVSuFC EFV MyP tE @9wu;w ]K0E#8@#HLFEPjQMQvà tu&NtUF]#8BHVE1e[^_ÐUWVSEH8"U Eee 9}}Eʅ}Q)usKEX"EU"90E #E9uEMueeBu;V8~ӃEGEH89|[^_ffs_isblockUVSEu ]@8tC t\vtuj<3nك"38Lكɸ"38,ك"38h e[^ffs_clrblockUSE] U@8t4 tEWt uJTу <уɸ $у h]ffs_setblockUSE] U@8t4 tESt uFPу:уɸ"уha_]ffs_isfreeblockUSEU ]@8tH te{tun<rOۺ+4h]softdep_flushfiles calledUhaU1ÐUÐsoftdep_setup_inomapdep calledUhsoftdep_setup_blkmapdep calledUh@softdep_setup_allocdirect calledUhsoftdep_setup_allocindir_page calledUhUsoftdep_setup_allocindir_meta calledUhsoftdep_setup_freeblocks calledUh@softdep_freefile calledUhssoftdep_setup_directory_add calledUhysoftdep_change_directoryentry_offset calledUh1softdep_setup_remove calledUhsoftdep_setup_directory_change calledUh`softdep_increase_linkcnt calledUh}softdep_load_inodeblock calledUh=softdep_update_inodeblock calledUh softdep_fsync calledUhWU1softdep_fsync_mountdev calledUhffs_mountroot: can't setup bdevvp'sroot_deviceffsUVS5H"h DA5#2ÃuhQA5?2ÃthEPhh-ÃVu5QA3 Ãt*E@ HVu5-ju?ESAU SAB=SASAu ESA  SAEU SAX jjYP˜RVUBDPR?Vu,s W1e[^ÐWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck UWVSEjlEEPuÃOUB<Ur zUuOtKttEPRURiEPRURgÃEE@>tUREp0URÃ}E@?UBxtARhW諡EP‹B0hWÃEPjW6u?UB>uPhPh\dt UB0VEPW]ÃEUB<t$B<}u)EPE@PEPAà UB$B(@BEEB,RÃDUztt %Gx@ ; #|  UBxtWE@<uÀURhW EP‹B0PWcÃEPjWvUB>tvEP9tGxRxR 9P t xW1dEPjYEPu=UZ)PER/ uVjYEPU RUZ)PERP/ VjYEPuE)SUP /EPURWÃjlELPEPSEPEPEDPEPBЃ UB<t$B<} tJE@>tAUr 9Et/E}t jUR1 WO0؍h[^_ffs_reload: dirty1ffs_reload: dirty2UKdPMQzǃ Ep1sx}xMqH UBzBuMQ+ EE1e[^_ÐULWVSUBx@ E}t MAEEEP7ÃUR 3~M; QAt EPhURkjjMQEPjUR?Ã,MQjEP蹢AU J<M؋EPjtPURȚà MQEPjEPhhdUR t Ep(EEMMQEPh RPjh  PURà ExH\TuG0==cw OƇ$uR }u M A>tPh\3"PhtLu}u \jjhLS1EhLP'jjwh31UB whr EpH h UB0 B0uREMy E؈}uƇƇO4T1ЙEЃ$~G,ƃjjV0EEEw0EG8;E~ u+uw4MQEPVEOdPURà VMQEpH O`EM uu^E G8E܋U9Uf$~/UTEM;O,}$E܋E;G,|MU EBdt u U B @Bh(M A@I=EUPMHGtUB GdB$G8B(EEME܃}~UBxM HWEPhPE Pl U)PRM%04M쉁DHG0ÉEĉUȉEȋEċUȃ49w u90v 04}uGt)URWM QEPÃtjUR(ƇjMQ 1jEPj0UBx@Et PJMQEP}tPUR1}t+jMq 0jEP/U ǂ؍e[^_ÐUWVS}9sЉ9sЉLu LJP,G0EU@04EGtÉEEUEEEEEUEU04MyGHЉ8<GLЉ@D1[^_ÐU WVSEUB?tURPEPURPEPÃUw u14$jWÃt ƆG@x@jjEPjjw8 URjtPwÃw$j-jV-jW-Eǀ`=؍e[^_ÐU WVSE}u jPA$Ãu1Whv{WjG0vÖÃWjvך؍e[^_ffs_statfsU WVS}u X \TthW軷C4FC0FC(F K8NC(CEM9}4#FUH U;r s;E}MċQHMA(D9tуE E̍PŨt%MuSEP1t9}t URtEH$U:u1e[^_ÐUAÐUS]M #xAQAt;Hu;Xuu1@[ÐU WVS} 5H"E#xAQAt4;xu'U;PuXVhSa u u1e[^_UWVS]H"E{}CE}WjjC8EP UU xA!ȋ5QAt.};xu };xuEPjj}W u!ʍtXS1e[^_ÐUEHttJPffs_inactive: pushing activeUWVSEpxE="t~4tVh0f{xf{zFFH@<u=WjjjjṼEǃCxfCxKPsV\Ct0`A`AEMR)ЍAjQQVʃWjVcf{xu WjV Ee[^_ufs_reclaim: pushing activeUVSu="t~4tVh,SjV C tP^C 1e[^mangled entryi_ffs_size too smallU|WVSEEPU@ EP U@EUUE@EEEUExUUăeUeFx%f=@t  EpURj@WwÃg E%fEft GH@<tUw 6 EPURW_Ã7u  EENjWDU9u G4E tPURjVY~EPjWjà }tVf}tOURhVt6EPjW)Ã}t uf}uURjV}uBUE;PDBEP}t;utf}}URjV}EURhVtÃEEEE}t}uf}}EEP U܀eGH@LHEȃ}u^`tؙ9w u;vEFdEq^dEȉE!]tVEPjFdRPW%~à t8EVdU[]^lEԉE̋UB HMEDDAFdEЋ EEEut f^ߋ]CHx@AA$XQ)U܃SVQpU܋E;PX|t&uCMAPȃPFP9l u";;Esh^$IߋEfx";}}hu$*Ufzf^ރMQV]SutÃuNuvF\to9w ub9vZ} tEPjU RpMQ]SjuF\RPEPisà } tURhM Qf؍e[^_ÐUVSMu Et2EPEPCdRPQq uuEE@EEPEPCXSd)‰ЙRPQFq u<{Xu E UClfBt NNfNzusKe[^UWVS}] wEPEPGdRPVp u4EUFHx@~ UEBKKfKzuTsOe[^_U,WVS]EEEjEPURjjE܋URPj SUrjw`0uU}uOf{tHvHMA@Hx@~ CC {.uuE;Pt{ .uU 9t1'CE܃U;}`u ;uUe[^_Ðcheckpath: .. not a directory U,WVSuU }BEB;Fu$E1ۃmUBHx@~EEuf}..trE;FtteRZUBHHEPurHAЉÃ zUztujjWjjjjjEPRj^Ã0buh*謎Et P؍e[^_U1ÐUUJEPjRAЅu UE 1ÐU-ÐUUu @PR tA0UE41 ÐU=4?u4?>1ÐUVSMu ]QEPvQBЃt 9Ufyxt F9tRF1e[^UEp pp@@ "P6*UVSEpXp SpF "P*u?HVDt3,@t31e[^ÐUUBtB u B tI1ÐUE@x4BuKB Bt `ABt`AB,R0BtR`AEBtB Bt `ABt`AB,R0Bt `Ab1ÐUVS]Cs UtbPtw>$D.x.h.h.x.x.h.x.x.x.@H@<t<}tt #s PAxPde[^ÐUVSEpXAuLA At `AAt`AA,Q0AtS`AFAtB At `AAt`AA,Q0At `AaACACAxfCAfCCC CDCSC$C(C,C0C4C8C@Cs VW8Ã@uh9:vRPQÃDžt G9Ft h9ut[tRFzf=v  F@fFzNjPPR[ÃtNfNzNSQWjPSjRfÃ0tEwNfNzNjPPQ[NPB;Fu;Gt h9tG9Auh9tFyt2C @t";t9t Ax%f=@uWys vQu Bu iP譤t AttPGxf PwRVà tauNNIIufNzfKzpp jjjXà R A$ Auhh9rPPRt0th9rs1\9tth9Jrt:t1#GdjjPVW_R̢jqSP{ËbtQtsptr>v0tgQjJuOfOzOr؍[^_ÐU\WVSEP@I fzzv @؀@Pq SPUǃzB @IfYx@tAfAzAt BfBzJ`A`AR)ЍCjSSQUǃsBH#x@~#󥋕BAPjp hjjTǃ ǂǂJjh试jpHQ赽 jSSTǃtU_Uǃu]SPRQSPǃ0uQ:HfHzHBfBzJq+ԻA `Ap@ xAp@ = ~j p9AAuAA0AABp@ӡ AAtP[^_ÐUWVSEPUPU@ EE9uURcxxt"EPURCt {uEp vS`u Bu tjjUrSEPǃuNURNNKKfNzfKzEpp jjjURQǃ$EP֜UREPe[^_ÐU WVS]{s WsC@̠P; ƃ?}SװэyMAH;x@}2WPRSK*jjC p jjjjWRMQj?ƃ0EPe[^_ufs_readdir: lost in spaceU\WVSEEԋPUЋBR EUċMЋYډA%)u )ډUȋ}Љ_XEԋPBHx@~Mq jWR*GẼN}}u}؉}EE]܁wtw8 w0AApA@PAwAAzAwmAfw0 w0AwIABpA@w5PA.wAwAAwA5p@ xAp@ujjSTǃNj5p@֡ AAt}؋Ep jURpEẼuK+]4;9s(QAAQfyt AEMQSWẼ+ ԻA `Ap@ xAp@ = ~jW/AAuAA8zp@ӡ AAt}}ԃEЃxuxth-J hMЋY+E)‰UEUĉEUM1AEUGAUЋB ;Eu ;]vfyuՋMЋA+EEȋEUĉAQ wtw8 w0AApA@PAwAAzAwmAfw0 w0AwIABpA@w5PA.wAwAAwAp@ xAp@ujjRƃƋp@ӡ AAtUԋB8B0EUEUċMAEUEAUЋB ;Eu}9zwҋUȋEPMԋY1A}ЋG 9wu G9w3E̍e[^_ÐUVSUZCH@@9| u urVPp1r jrSBe[^ÐUUJr Pr8P0ÐUUJr PB P8PÐUE@8Pufs_strategy: specU WVS}_K\EAtwhXPdCP9CTuVjCTPjsPQGƃ ts4C0C0S:U{Tusj MqE PFfFzN[^_file system full %s: write failed, file system is full U WVSu}E^ C tzt;CtoU;SrE}uFH1s(E+C1s$h^URPVHƒ ~ NE1-h`YwS PhY]e[^_Ðmode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free UWVSEEPUx@s ~/%f=@uVQEKI1v(EEF(@hH`}WPEPSà UBH@UrSUrH@ЉǃtEPSUR?UBf{xt;ft1PsPCxPhZ]hZ$YhCxP,AP,AЋ`A9s `A,A,A10hZUB pV PhZ[e[^_UWVSUB1EE19}61ۋE,D;E|t D ;E~ T U F9|̉[^_ÐUWVS]u{ KttCp@9E uA'tM| uIyCH1w(G G@[^_U WVS] ]Ex URuSPU҃$9|)ËEPjSURU҃uX9|ՋMșӾ;},EPjSURU҃uC9u1F9|1e[^_ÐUWVSUuz ,M Me]f| t>EPj,]Pr Gw tu!{1E@HEGE+E_$1;E t1t>+E1օ}VU )sit+E11ɍC)ȉ9}]<t7B9|19}E<t#B9|VURWƃ} E}F)M O ,]fL ƇuxE G$E } E e[^_cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapUWVSU]Kz ,M Meuf|0u 1EPj,uD0Pr u tux1sE@HEt,1w(Ӊ؅}Cu 0)؅}CEG()؍pEEPVh/ ƒuKuFEEPVhZ/ ƒu%PSU Rh_cXh_SE)ЋMt,C=~Ph`Xh `S؅}C)u2O,UfLƇe}@u ,fDuFvM O(D e[^_bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockUWVSu EX +K1s$;sr/EpVhAbVhWbUBzPS%EPj,MUPEp sr tuMvE@HE+s1s$օ}VE)r&PVUrhb*VhbQU C ,UfD ƃute[^_Ðifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodeUWVSEEP@Ep ;s wPRUrhdPZ1v(EEPj,UDPUr p tutExH1v(:ڃr4PSMqh@dTuh_dOك ;F,UfDMA %=@u ,fLƆur1e[^_Ðstart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapU WVS}Et+G1w$1_$)E PSh'* u@^1E PSh * u"PSjheSheN3)‹E  t,@~Ph`Rh f8Ne[^_uid %d on %s: %s UuEPu h gjhNU|WVSE@EU} } MI M}  u }Ǡ<>t8EPj] SEPmà xEUEPMQW] SSEPPSURà {] MYpEAtjjESUR^sE]UPT MtEpMI]EPEĉEPU RMQ蘪ÃMEȃ }Ǡ<jj] SEPƒEPMQRS]SÃ0yuEptjjUuЋMQ`rE]UPTEpEM9}4#FUH U;r s;E}MċQHMA(D9tуE E̍PŨt%MuSEPkt9}t URjEH$U:u1e[^_Uu Ðext2fs_inactive: pushing activeUWVS}wE="t~4tVho'f{xfu`FH@<uWjjjjjV*E`A`AER)ЍEEKCxPsV)*Ct0`A`AEMR)ЍAjQQV*wjV.'twjVijEe[^_ÐUWVSEEPBH@< CtB Ct `ACt`AC,S0Ct `AcC$Cs EPjCH1v(1$E,L MeEPs cǃ tugRh}SJ1$WHRCxPUzuu0f1 uee[^_ÐUWVSE\PXËK[ HLDž<} XP`A`Ahh0R)ЍAX{tucCHPQ|@@9r uLuCRPP薫PC|Kj0PPXR+(PK|1ۉ(,H9u/L9u%PIj0SSXP'PR D,9L 9LI(9H7HOD#HLHL tHLDž8\At Dž88PdP\rGPSPQ HPC|HLQRXQQgXSf 8tdbd.dPJj0QQXSg&KHD#uHPJ|DHL tDž8\@t Dž88RdP\qWSPS HPP|DHLRPXRfXQe)PdxHW袨Sdg 8td'adbDHLD tHTƒU)‰U)‰U @jt f^AX Q)SVQ%r;AX|>u fff^ރRVQq ƋH u1B\t$;B|sMqq jB\RPu VƉ[^_ÐUSM{Xu:EPEPCdRPQ u[EuX KAEPEPCXSd)‰ЙRPQz uUClfBu K]UVSu] EPEPFdRPv- UCC xL@`Cxf H wr$ܓ 3+# 1ҋEP E@uNe[^ÐU,WVS]11MA|1҅ v}jEPEPjjWVj SMqjU0u2}u,f{t%t#C{.ut{ .u;U t1 CƃMA|19u9we[^_Ðcheckpath: .. not a directory checkpathU,WVSuU }BEB;Fu$E1ۃW}uf}..t sE;Fttcu\UBHHEPurHAЉÃ uUztujjWjjjjjEPRjÃ0xuh #h+Et Pԉ؍e[^_ULWVSEPUM@EY ]䋃ÉEĉUȉEȋEċUȃ]K 9wu9Cv Exu1EE=UBR EUM䊉 tEC]E䋰UJ#M܉)ϋB9slj;Uu;Ev}̋]䋋EU;B|rEPjVMQ]SAEHU;B@u uEPjjEPEPVMQR>EPjV]SEP>E؃ }MUJ@E+p@9}tk]SW@HE܋EP5E؃uHuAE{t-MA|1ҋ]+CS ẺUЅ}uEt PKAUBHfx<|MIE؍e[^_ext2fs_write%s: nonsync dir write%s: typeUlWVSEEP UЋxHM싙]AttMwt `toYEШtUR|WG M tIA|19Gu9W t:,]u(h|hh|hE@ E W1ɉUĉMȋO_ M]M]ȉM]ÉEUEEU9Uw?u9Ew8wUztu8t4EUEUȋ^K9u;CvjVȹJOM̋UB|1҉E܉UMЉMeEe1ۃ}eGW ]䊋 t‹G#E؋)ƋG9s9~ MeMQEP]sEPREPà O_ ӉM]]C|19Uu(9v$WEP|MA|1RP]SAEPx@UB@M䋙)É؃9}ƃWVEBHPÃ}tu<.U؍2M;uu= u<utEHU;WvMAtxt Ef`xtDUt~wMqeEPU܋MQRMQ+E+G)G_ ẺGDU;Wv:Mt2`A`AEMR)ЍAjQQ]S0É؍e[^_UWVS]Cx CS EU tEUCEPjURs9ƃ tu<#KtUC#BHSE1e[^_ext2fs_mountroot: can't setup bdevvp'sroot_deviceext2fsU WVS=H"h DA5#uhQA5?t hEPh'h3VzÃu@Wu5QA Ãt:E@ HWuyju 5QA軂ESAU SAB=SASAu ESA  SAEE SAp hSdjhSEPRh ~Lt'j@S4jj?SEP%h WUBDPR Wuyv01e[^_Ð%s: file system not clean; please fsck(8) UWVSEjlEPueÃUB<~Uz uttptEPRUR ÃjEPuG:ufG:jURgƇE@>t#UREp0URVÃE@?UBxt[EpRhVhURB0hVà tEPjVURjVƇf:ufG:fG:Ƈ}uEPE@PEP覎JUB$B(@BEEB,R hÃUr~ttVFx@ ; #|VxUBxtdE@<uÀURhV,EP‹B0PVoà tVu~EPjVmUB>uEPRV U;rtV~tV~fEEx uVhURu dU)PRs| Lt-Vj?SEPVd@+EPS@| jZEPEPaVjY]SucUZ)PER{t:Ƈf:u `AG0ShjUR}1h[^_ext2fs_reload: dirty1ext2fs_reload: dirty2U,WVSE@<u jU@Ejj}WE PjUR諑 th }WjjEPhhdEP tE@(UURjhRPjh" P}W1ƃ u"ExHUB<PWƃt"uk5W{~UX hSW_SSK ʉ1ljKQEeE EHЉ UUmE܍L81u܉ U$C(1(19EPjGGPURi0ƃ $,PEpH^u4 G; {Ex!U9WHuGXEURhAWuʃEPhW[yujjURE PjW5 th65UEPjBH1s(1$E,L MeEPURJ/ƃ uEPJ1$VHhExPRz]u2WVy}1e[^_ÐU,WVSUBx@ E}t MAEEEP譅ƃ UR~M; QAt jjEPURjMQҍƃ E P<UMQjtPEPƃURMQjEPhhdEP EEUURMQhjEP-ƃ EURpH ƃsjjhLEljSjjh0NjEx hEp EpH[u1EUZ M舋 }uf{:u fC: fC:ƃSSK ʉ1ƉKQ牻 GЉ }mU܍L21u܉Ɖ $C(1(jj P~,1; EPjGGPUR+ƃ $,PEpH*Zu/E G; tEM UQdA @AhA@<I=EPUPH UB$B(MAxU P1j,Et P.MQhEPURMQ}tPEPURjMQ-}t+jEp jURM ǁe[^_ÐU WVSEURPEPƃU{ u,jSuG:ufG:jSCxtt @x@EPhsURjtPsƃstj,~jW~jS~Eǀ`=e[^_ÐU WVSE}u jPtÃu1Whv'WjG0voÃWjv؍e[^_ext2fs_statfsUWVSUP fz8Sthj(MZzLt~Bdtx1EE9E}mvSE9M~ 9~98;Mt/9t+9t'E@E4)9M~9~9~EA;M|MM @EËM AAB)؉A B A+BAABAED9t8jZȃTPEP:VjZE PEPV jUB PE DP 1e[^_fs = %s update: rofs modUWVS} EEV Ut%Ph2L h;EXtzU9SHuCXE{ttW@u{dtKtFURhS_ptt&EPWURStESq]utP@?tEPhvbURWEPv tEURjvEt#ƀ`AUB0WVtEEe[^_inodeU,WVSEEPUE PUReUYEEP5 DAURjjÃMp@ xAp@ࡐAujjHhxǃ NjAp@ӡ AAt]mhWGnjjhjG8PoEEGUr w EGU WGpGt$W5eÃt uo\EPjE HE1v(1$E䋖,L M䋎eEPUrv$à t)unuC(EhGxP]E1$SHRRGu' UR5@5x>AEPÃtu5nU^UBG @4u?,AP,AЋ`A9s `A,A,AE@H@<uOEU1e[^_ÐU WVS]} u@ O wucP(9sSCURQS@Ѓt@Mfzxtu G9tQ;mF1e[^_UEU f ABB1ÐU-ÐU WVSEX 1jjhjpQ(ǃhwHSP} u W# W%e[^_ÐUWVSEX EE PEPvEE; jj EE@PEp'ƃvHE$,PO} uV*#E V$EE; ju }t}e[^_ÐExt2 fs: unsupported inode size Ext2 fs: unsupported optionnal feature UEfx8SuPLwxv XtPxT ufxXt h@`thv} u@dt 1UEp pp@@ "PUVSEpXp SpF "Pu?HVDt3 j@t3n1e[^ÐUUB tB u 1UUBB}t #r PPAzPAxPkyÐUVSEpXAtB At `AAt`AA,Q0At `AaACACAxfCfCAzCC CDA|CCC$C(C,C0C4C8 C@t C@CRhvhz@~vPVRu1aQ<t uDA ?tI y u0t ABQQhpA B <؍e[^_ÐU WVSUB@ J(AM19}ZUB$4tD1ېFtjP x?AC~܋VhpA`ޅuG;}|Mq$+ԻA `Ap@ xAp@ = ~jcV-7AAuAA0MA$A$Bp@ӡ AA 19},UB tjP x?ACM;Y|֋Ep +ԻA `Ap@ xAp@ = ~jcV -8AAuAA0MA A Bp@ӡ AAtEPhAe[^_Ðuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failedU WVSu E t@= #tho9jPSƃt#C$ t Src$σSX1fc$jjs0?MEGE;}1e[^_ÐU WVSu} ^jv0QIF PSA tVՃCt{uS1e[^_ÐUju ut jP蜺U|??udv_attachU WVSE}uU@Ũ #L'E PWURӃu֐|?tbE;Ct[ tQU;SutECt CjhjjS) CCt Spc{p@ xAp@PAujjj(n ƃ ƋPAp@ӡ AAt|?E;Ct[ U;Su+ ԻA `Ap@ xAp@ = ~jV,"0AAuAA0rp@ӡ AAx1[F #FFF FFFUV|?F t |?V P$5|?F$|?e[^_ÐUE@udv_detachUVS]C~ HCCt! CjhC jjS( ǐS t C$B$S$C Ct Sn+ԻA `A5p@ xAp@ = ~jS -AAuAAZ5p@֡ AAt}e[^ÐUudv_fault: !PGO_LOCKED faultUWVSM EPB]$@uh^ 說Bt&5H"jjUB PmX]@Ũ #E+ZZE1+ U RjRPVU0a@ G;}}4E$u;}uE C|u5H"jjCPG XDžTy(u}u DžTTtUAtIEu yu35H"jjEPEPz?AXQ0AEPEPNuu CNf9\cYjh}UWVSU Bt*EM IMD9s f}߿v1S=߿v E߿)EueU%9v‰E);]v]M QSuV'7E)]} #@|u5H"jjP #EPMPQR! #@|u5H"jjPEtjP#1}tOjEP5 #WEPUR%E  uvw멋Ee[^_kmgetwait1uvn_getUWVSE UUU$@E1EUEU9UtCE$7C$t! fC$jh)jjS_ fC$>u`WEPGÃujjjjWURZà uh(j뵐>uSJfc$EE9E/1e[^_Ðuvm_km_init: could not reserve space for kernelUVS]u EA@jhA ?? #???? ?8@A ?$?(? #,?0?,?4?8?<@A$?jVuh???@h'jj+]SEPV0th* 5 #e[^Ðuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failedU WVS} ]u }t 'PjjSWEP th\,UE0u-URE07U2ƃu*h,覇EPU27VcUVE07UR@'t h,de[^_ÐU WVSu E) U9Bv];uVEPCÃt0C$t fC$ PUR*S[ ;urSEXtH{C9r6;Es1S$t fS$ PURSo[ ue[^_ÐU WVS}u E) 9Gv5;]sWSW&Ct P[;]r+Gt"XP9r;Us PZ؅uߍe[^_km_getwait2U WVS]UB,EE% 'PjE PSEPR t 1Ut$UPREP 1 #E+r,DžjjjjVU R;U uEuhU/eeĀ`$U zujjjp0WE0jjjp0WU2 oEe[^_ÐUU E%PRu=ÐUVSu] F|u5H"jjFPIEPE%PSV5VdG F|u5H"jjFPEt jPe[^Ðuvm_km_alloc1: non-released pagekm_allockm_alloc1wU WVS] UB,Eh'j5ASEPRt t 1 #E+r,DžV5A!@t6P$u h\1, fP$jh}1jjPydjjjjV5AR uh1!cy`$jjjp0WE0 C}tE)WjP ` Ee[^_ÐUMU A,Eh'j5AREPQ7uE1vallocwaitUVSu] F,V0)‰9v1?F,Eh'j5ASEPV tjh3jV@ċEe[^ÐUVSp@ xAp@}Phu uƃp@ӡ AAte[^ÐUSp@ xAp@hu uop@ӡ AAt]Uu js00nVBp0RHt-u1Uujh6jh4Ap=192^{,ujs0RC,So;e[^_fltagain2UWVSu]VB0EzOyt0EEj@jjjEPEP+BPWAЃ k5H"jjF PTEWjjjjEPEPF+XSWBЃ t#jhU7jh4AS<1 ?A5H"jjF PV 9Ft5H"jjBP1ۃ ?AE@%u+tJ}t@FPN)щR,P@tt5H"jjF P_1ۅuNE@$ t P?UB%tGjR@010R;E`$1Eu=Ex,ujp0;E@,uS9E EU E@ tM u:蓿Åu=E@$ t P>E`$ϐ5H"jjF P^dECEX Ex,ujp0E@,u:U E@$ t PO>E`$ϸe[^_loanzero1loanzero2U WVS}Ey5H"jjG PhI:Z?A5H"jjG PzW 9Gt5H"jjBPV1?At]jjjjjjAJà `S9fc$U Sv7C,15H"jjG PtσVhS:Z ?A5H"jjG PW 9Gt5H"jjBPb1?Ae<ƅ^jjjVjj;Ià >S8fc$S7U 0e[^_ÐUVSu] u PKe[^Ðuvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!U WVS}u pC,uSh<.xHC,S6{,u;{u5{ u/C$tSh<wjs0SL Ne[^_U WVS}5p@ xAp@ࡐAu,jjtP~à ËA5p@֡ AAtWuu SE؍e[^_thrd_sleepUVSuU M]F$F$F(F`FdFhV,N0^|FxFpdžjjh>jFP FlFttZp@ Ap@AtA5AdžAp@ҡ AAte[^ÐUVS]C|u5H"jjCPEPuu S ƃC|u5H"jjCPEt jP e[^ÐUEt@hÐUVS]ChPShЅs0s,S?3 +ԻA `A5p@ xAp@ = ~jS-AAuAAZ5p@֡ AAtue[^Ðmapent_alloc: out of static map entries, check MAX_KMAPENT# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplUSPATAd #XA\A@`ARARARAPASA@SAQAQAQARAQA@QAPATAXAQA\A@`ATAXA\APAd #TA`AAdAAA}uhd@p}G8EމEC UBE+CztB{0tPE,PC,PMA`}CG{G8Ctw_tCPtzt PBЍe[^_ÐUWVS}}e}me}e0m}m eE#E;Et E@|t%5H"jjEP~t Uu? t KMA|u5H"jjȃP2]%PEPURM Q]S1EPuƃ u,UB|u5H"jjЃPPA}u E}u #@,M )É] E 9N E$9]9^t+FF;EFE9F]9^ E9F$u]9^4uw~(uqF0txudRA}tUBxt R@Ѓ~0tMQVa]^ EXd@|5H"jjEu E$V9t] 9BuQAE@|u+ #9Et!tjhAC8Sp@ xAp@AtCAp@ҡ AAtu hd@mC8U CEC MKECt CCtCƒSu CMKEC US$C(MK4t*jWEPލC,C0 C0UB`3FC^CMJd9rxu C9F rZx]C|u5H"jjؐP1e[^_ÐUVS]M uCpS$9u@PA;Hr9t=9H v4TA2PC(9H v;HrCp@9uCp1[^U WVS}] G,9s} u8;_0w1} u9uWxG$9t83EPSWBt} t1@EX U } uʋZ E4;w0w9r֋JG$9t9qr׉WpEАe[^_UWVS}u G,9sƋG09EvE;uvuEPVWu];svVSW(GpEXGx9prGxEEW$U9KM9K?E;C sPSW SUC +s{(tPsWC(CCPBuBCPsh@ #B,K )PB,S)‰PsE@CPsh@ #B,K )PB,S)‰Ps+ cCs s7`O`SCB)wdEC]]M9t E9CEU1e[^_ÐU WVS]} {0t WS\CtstCPzt PBЃsC8uShA!7p@ xAp@ࡄACAp@ҡ AAt_e[^_ÐUS]MU C,9sh ujRQS u 1]ÐU WVS]} uEPWStU9zuE9B u zuz0t 1t4sp9SxuKxE@AEpC`HEC`/CpCx9uCxK`EPE@BMA8uQhA蹕:p@ xAp@ࡄAA Ap@ҡ AAtue[^_U[9t9srˍG$E9tr9ssm;s sVSWC}tUS U!USK9t$Eʃ@tʃRs s7[;]t9srG|u5H"jjGP1e[^_ÐU WVSu }}}} E@|u5H"jjP<UB,9sƐUB09v9vEPVEPt];svVSURx EXu$!;{ sWSEPUS$[9t9{r؋E@|u5H"jjP1e[^_ÐU WVSu }E@|u5H"jjPQUB,9sƐUB09v9vEPVEPt];svVSUR EXu$S;{ sWSEP}}}&UB|u5H"jjЃP3EC4[9t9{rUB|u5H"jjЃPh1e[^_ÐUWVSuE@|u5H"jjP4UB,9E sE UB09v9u vu EPE PURu)E@|u5H"jjP]}U ;SvRSEP5E$;{(tS 9s+C9t9PvUB|O5H"jj5[9t9sr]}$D;s sVSEP C(PS(us sEPC([9t9srUB|5H"jjЃP{(u*Cu#tCtVE PjjSURK E ;CvPSUR;s sVSEPLC(S 9sSM$C9t9PvA9t;U vK(9tU 9S wE@|u5H"jjP[E$9t 9s.5H"jjUURE][E$E9t'9ss"{(uss sUREtɃ}t_5H"jjEP{K(;]t9rUB|u5H"jjEPTjWU REPE5H"jjUR%1e[^_ÐUWVS}u5H"jjGEPG,9E sE G09v9u vu EPE PWuCi5H"jjEP5H"jjEP]]9ssACuK 9v+G$S9t;Jt5H"jjEP=~[9srM]OU )SC 9v+M MKt#ytEPEPRQGЃEEE [C9r5H"jjEP1e[^_U WVS] u}EPSEPu10U9s#E$9t;Zr#B9uۋZ R9r޸e[^_ÐU WVSu ]jhطA҂ǃSVEPjW e[^_ÐU WVSu] 12}PuuVt S jÉdže[^_UMU A B A ÐU WVS}w t\VEp@ Ap@WaEG W p@ӡ AAt蹽V e[^_Ðvm_allocate of PT page area failedUWVS}w uhjVF|Pv0v,[EE߃h' jjh8EPEP0th$`Tp@ Ap@W`EG W p@ӡ AAt踼V e[^_ÐUS]PupC|u5H"jjCP{`t(EPs0s,SEtjP3ShطA]Ðfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)U,WVSEEjhhPOUB|u5H"jjЃP访MA|Pq0q,>E¨Ej PR觡}?}E@(E U$U9gMQt haHRЃ uhb1R}G$E tjjjjWEP腆 UB|u) #9t tjhAY~C8Rp@ xAp@AtCAp@ҡ AAtu hd@xQC8]؋uE@(x0tjP#qUBtPzt PBЃMA`Q$A$@CZC}wGW )‰PsM1}W` E@|u+ #9Et!tjhA>}C8Sp@ xAp@AtCAp@ҡ AAtu hd@\PC8ߋu{0tjSpCtPzt PBЃC(K }G`W$G$@CZCUB0t&@uz(tBjjjjSMQS }(t0SEP舋Uz0t3Bu&B tB$Pr rM1A}O1E@ UrBJ )Ps}7EP tC$Ps sURMIM}9UBdMAdB|u5H"jjЃP踻E߃h' jjh8EP}W th$`NEe[^_U `Agfff)9uh>A*@ #@ #9HAv hAbUWVS1@At+B1<|<~<uw wGRu1۾D #ʋE)  ENy[^_ÐUA!]SLj0S%hh0?AVWEP4jEPVWUR-e[^_ÐUWVS]1҉ @At|B,ulJ1wc$hhhhhht$wfC5@ #9s'fC!@ #9s tffCRu@?AC,@?A119}1ɐAA)ljƃ$C9|N %v vSqESjQ 1ۃ ;P #EEA}?}EP)9~ )RhuhBhu=EA}RE)̋MA} ~]EUAMU|0 M;Ar%;A w  0x%lx vm_page_physload: tried to add RAM after vm_mem_initUWVS=0?Auh}q6}vEPh}Y6P #u&h~:U RMQjhH~:#E9E} =Au1Ґ$E9E} AtP #9UEuh~5E19}!M; Ar$E9U} M;AsUҍAEP #;U~1H܉MÐA<u E܃J;UދUEM HEUBEB }t BMAAUEPP #}u]e[^_Ðvm_page_physrehash: WARNING: could not grow page hash table UWVS1ɡP #~1҉ƋAA)É$NuE9M}e9M|Uwrw6 w0AApA@PAwAAzAwmAfw0 w0AwIABpA@w5PA.wAwAAwA5p@ xAp@ujj[RTÃË5p@֡ AAt講uhh71;u}ؐDF;u|p@E xAp@=lApAElA]pAKtA19uSt C B C DS CCK K#tAlADC # tAlADC C#tAlA\uF;u|Ep@U AAEt蕚@+ԻA `Ap@ xAp@ = ~j[W(0AAuAA8zp@ӡ AAte[^_Ðrehash: physical memory config [segs=%d of %d]: 0x%lx->0x%lx [0x%lx->0x%lx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d UVSj5P #h351;5P #}-As ss3h5 $F;5P #|كh64hJ45pAhn4e[^Ðuvm_pagealloc_strat: bad strat %dU WVS} uE@?A;\?A|;`?A}d?A9H?A}h`A1ҋEu}tMAw@?A;X?A;T?AxdA9H"gt |MH"1ɸ0A‹uDBA~:E0A0Au뿐Vh(/ t CACBS @?AEP{USMK fC$fC&fC(C,tYfC*} U#tAlAЋ p@ xAp@CBC BCB p@ѡ AAt論CSB CB CSP K$@C@fC*MQ1e[^_ÐU VS]EuvjjVjuuu SB t1 #P,Uh'jjSURPn tVF1u]AS #+A,C #tAlAЋ p@ xAp@CBC BCB p@ѡ AAt]CSB CB CSP K$@C@Sjjjs0Vh@09Ee[^ÐU WVS]}SC$@C #tAlA4‹ p@ xAp@St C B C FC S p@ѡ AAtpSt CB SCB SCc$CHCfC&} E C{fC& #tAlAЋ p@ xAp@CBC BCB p@ѡ AAt͓CSB CB CSP K$@C@[^_ÐU WVSu~,F$@t$fF$F$@F F#tAlA‹ p@ xAp@Vt F B F CF V p@ѡ AAt Vt FB VFB VFf$FHFfF& tF*t$fF*F F*t'tFBFDAVf* D?AF*t@0tuFLAt FBFTAVf* H?Af~(t fF( P?A?VZ0ADFVED0V6tfF*@?AW e[^_UVS]C$@C C#tAlA4‹ p@ xAp@St C B C FC S p@ѡ AAtPSt CB SCB SCc$CHCfC&[^uvm_pageratopUWVSuh@uh_( }EP #tGMA9r;Ast)މ7AMJut E@A1e[^_ÐUSjjjh@hAhA5 #ZA h@PAAAA1ۋX #tCv]pager_mapU WVS}}tfp@ xAp@0AuWjj ƃ Ƌ0Ap@ӡ AAtau 1JE01] EhjjSEP5A蝶 t+ ԻA `Ap@ xAp@ ~jV講0AAuAA0rp@ӡ AA%}PAjhjj5AE ut6UEjjjp0VA0ֻ uˋEe[^_UVSu] A@|u5H"jjPAAUR3RVP:=PAtPA5ANA@|u5H"jjPݑEt jPλe[^ÐUWVS] u} EPEPEPMqEPB ЃUu9usu9}v}UE) M;vEMA) EE1UBC$@u%fuj@s0tc$K%@C$ fC$js0u EM UMEtu ;us 2;us*VUR^ÃtC*yE AGEe[^_Ðuvm_shareprot: non-object attachedU WVSUJBth"rBR )‰Ѝ<0Yt%C9r9sE Ps0[u܍e[^_U WVSu}U}tFMAx$t&u RURM QWSUR@$ЉÉ M EU}tUBUR7SMQ@EP7SEPi.ƃtu3ub}}\?} uQjhWSU RMQE6?} u(EPhWSU RMQ } Xe[^_ÐU WVSu }}u3t+tUHPE@PE0URK-EUE;]9}u;B*tt-B @ !tjB Prf@$ t PB$tFB*t($fB$jp0p d SB@jR@0Ѓ<$fB$t.jjp0Gjjp03H$EEU;tL|FE0U}u2t*F*tF UP EPF Pvee[^_pagedaemon: deadlock detected! UVS1p@ lAp@dA9H"uhp$5`"h`AVujjh@?AÇ0p@ӡ AAt躇e[^ÐUVS hL?A`?A9} TDžl\l8[^_ÐU WVS @A@?AP;`?A}@A "1@A @At=l?AthHAu6hPAu" @Au=l?AthHA@A)؉áH?A=d?A)1 @?A`?A9}t?A;p?Au9x?A}u)΋@AEC$C*u{u K, fC*C$~eC*t+C x t"jC p !C @ c$NC* t.jC Ps[tjP!c$N~ js0ίS4@AO ]t4,e[^_UPhPhTh>>u3PhSRT1ɉEEDMEUUEPVMȉDžo_t?NxttDžOBx@ ?$vjj\j9uƃjQ2à t!PVSDžj\VCwvjRÃtDž|jj\htÃjj\jtƉߋ2C4 xtuBx@ ytuUB0衊QVSjj\s jPBRthSEPtVjR(ytuLjj\uj\Su @4 Dž􋕬RjMQjjhCAlx[^_swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap U|WVSE 40;=QAtURB0jW ÃGtuvEP‹B0EPWÃHEU ƃGHPEPGHDPwHBЉÃGH@LU @ǂD=u*҉)Ћh #tVЉƃu E p  EtuJUE1} sjj\j pÃ5h #h #hSSjjjj\EHPjS^U 0 t7jVjPth^sE $5t?A5x?A;=QAp@PHDB B  ;]~ htjSVU 0Bth)U $t?Ax?AShUE)PhB EPU RUE U B$ BEp?AUR?1;=QAtEP‹B0jW؍x[^_Uu h/hujhlrÐUu h/jujhlrswstrategy: vnode type 0x%xU WVSu^T Su!F4F0F0Vh( +( 4@ttPhPi=p@ lAp@VT4FDC1 tM{<uG{4uASPt CTBT CT@STCPCPACTACPACFEp@U lAp@C@S<)‰)G@N C4tF{\t SzS5AA$~tG0G0FG4Fu1~ u+@u!FuV5(@q$W" EPUp@U AAEt-^e[^_ÐU WVS=l?A:5@^~9CE$; EPjjjjR0p 0p040N89u <F <<<9tR888F<9Nu^ F8^U$t?A(ED8F믐89 v E8~} t 1e[^_Ðwarning: resource shortage: %d slots of swap lost U WVS]} SHjW+(S0a tWhL)$)=t?Ae[^_UEPuuu BU|?A x?AEuPju EPt tx?AUWVS}E E} PjEPuEtep@ lAp@Ӊ}e1}udA9H"P5лATƃp@ӡ AAt)[u ~0F,AȹAFlFhF!CeEFHEFTFxp@ lAp@ DAA1 tLy<uFy4u@QPt ATBT AT@QTAPAPAATAAPAA< DAF\p@ӡ AAtOZ DAxtu @x@ FDU Vju4Xj\Bcj\S7c5H"jue[^_growshrinksbrk: %s %ld failed, return = %d UWVSMU y EUeƋE)1ҋYK$9u ;C  0%Eu)u 1~,hjjVEPW| u6 1QSEPWu )1*P}P~Phe e[^_U WVSM E@ E;rSU )9sI) )UBP4@0 9u9v1E[^_ÐUÐuvm_coredump: user process with submap?U,WVSE@ EEUBRЋMA(1][(]E$E9GUBthpVMA I][ ]߿vEߋE;r%‹ );M]ff% HffUME)ȉEURjMQj jWVCPEP] SjE0uZMAƃ]SjEPj jWVuuU RjE0u uMA][]E9Ee[^_uvm_deallocate with null mapUMU Eu h4t %PRQgs1uvnsyncU@@jjhjh0AVTuvn_attachU|WVS]}  CjhjjSQ Cu݃{tuCxP )ЃPV:F$K~ F$;F(r@F(5H"jjUR;1e[^_ÐU WVS]u {CECT@t [j h@1‹K8D|BtK8D|JHK8T|K8D|BCtCPS SCBBJJ rBB$B ;~ ǃ}t+}KWEVu WEVt}uBEk9fwVit Ey}eEX]C(UBHl9v}t:MQ] SEP:$EE> }UBXE3EMA0E} E];C,UB0MA,Y<)É؋U ]KTEP(v ʉKT1Ɖ1UJTMA(]C0#DtC9|h+<0#ȉ؋TTdG`vE8#9}$0#Duh?C9|ߋ8#Ӌ 4#9}"0#DthS跴C9|߉<#@#e[^_ÐUS4#h5 #1‰0#jPR5 #XjP50#hAh50#]S!S]ÐU4#4#j0#HRP5 #pXÐU4#4#j0#RP5 #:Xgdt_get_slot botch 1gdt_get_slot botch 2US (Ajhjh(Ar(Auڀ (A@#tá0#D@#d<#;8#th4#9|0=~h=0#AuK<#<#8#(Aƒ(At$(Ah(Au؋]ÐUS] (Ajhjh(Aq(Auڀ (A 8#0#d4#=~}98# @?0#@#fD@#(Aƒ(At$(Ah(Au]ÐUVS]Dƃjjjj hS0#Pshe[^ÐUE@h%PÐU WVSu ]ǃjjjjKSV0#PGEx`e[^_ÐUE@`%PUSVWl$|$11 $ 3u] m9r)߃!$D#6[fVvfv[6v[ !؍4$T# VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV)y$#6fffvfff_^[]h#路d$%sreal mem = %u (%uK) startup: no room for tablesstartup: table size inconsistencyavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory UWVS,FA11jjjS(APh@D Fv΃h 5(Aoh(?h 4 @ y PRhjƃj%P5 #w*ÃuhS)؃9thuVjjjh@V]S5 #% #,jjjhVS5 #j%(#jjh @hPjjjh@Vh4A5 #"%$# ݂@?A PRhȱ#P P5 #h 諱 CA"t0@ܺAĻAǃ4CdH1ҐHBvƃC` CtCܺACSChC`Ћ[ðAe[^_ÐUS],Aࡀ"@Ã=#u> @gfffgfff)‰#= #u# #  #= #9v  #9 #9#~#=#u!$#=~ #|@ #+ #[Ðcpu_startup: cannot allocate VM for bufferscannot get physical memory for buffer cacheU,WVSj jj #PhhA5 #: th Ū #ș= #EU~EEEE@E}jjPjhhjh0 u>#)~j9vjjWjhhj P轔 tʅ~6jjEPjh5,FAj S蒔 th }tEP讗}EU; #}kEu5hAE9E}]C] t,jjjw0Vh@?? uԁEEU; #|e[^_586NexGen6x86486DLCCyrix486DX486SX386DX386SXIntel686486386Dual OverDrive mP6RiseRiseRiseRise686 classWinChipWinChip 3WinChip 2WinChip C6IDTCentaurHaulsM2 class6x86MX (M2)M1 classGXm6x86 (M1)486 class5x86MediaGXCyrixInsteadK7 (Athlon)K5 or K6K6-3K6-2K6K5Am486 or Am5x86Am5x86 W/B 133/160Am5x86 W/T 133/160Am486DX4 W/B or Am5x86 W/B 150Am486DX4 W/T or Am5x86 W/T 150Am486DX2 W/BAm486DX2 W/TAMDAuthenticAMDPentium III (Coppermine)Pentium IIIPentium II (Celeron)Pentium II (Deschutes)Pentium II (Klamath)Pentium ProPentium Pro (A-step)Pentium/MMX (Tillamook)PentiumPentium/MMXPentium (P24T)Pentium (P54C)Pentium (P5)Pentium (P5 A-step)486DX4486DX2 W/B Enhanced486SX2486SL486DX2GenuineIntel3DNOWSIMDFXSRMMXSERPSE36PATCMOVMCAPGEMTRRSYSAPICCX8MCEPAEMSRTSCPSEDEV86FPU%s: broken TSC disabled U} u%" "uhxÐ%s: xchg bug workaround performed UE t t"#€"#"#À"#1"#1"#2"#2"#3"#3"#<"#<ɇ"#"#À"#uh %"Ð%s: F00F bug workaround installed US]Sh跨]Ð%s: disabling processor serial number UE u }% "u; "t22 0uh@&% " "CeleronPentium IIPentium II XeonPentium III XeonUE1҃ttJk"w\$(@@{HPP4,$"CuC| Ecpu0identifycpu: strange family valueUnknown" "%s %s%s (%s%s%s%s-class, %dKB L2 cache)%s %s%s (%s%s%s%s-class)%s: %s %d MHz %s: ,%s%sWARNING: CYRIX 486DLC CACHE UNCHANGED. ULWVSE "uQ"4#M,#Mԋ0#MUЉŰ8#U؋<#EEa MM" h5E}eE1E#EF}!j E0h "|u؋UUȃ}uLEE= "tE "~}Ea MMMEEȋE܋UȋRUԋMȋIM#]~}~Ew}u&u!}t}uEPEFUЍMȋDE}uFUȃPEFUȋT U؋MȋDTEĺ}u-= "~$}"w~URE4#a ЋM܀9tPЋM܀9tPЋU܀:tPMQEPURhRM4#a ЋM܀9tPЋM܀9tPЋU܀:tPMQEPURh(h@0}tMQEPhU҃h@hhAB"tt&5A9s%#Ɛ4FA9sЉA9r##)H9#~##)ÍC9}#e[^ÐU ??)Ћd #Dž@hP5#QUE4@Ð dumping to dev %x, offset %ld dump area unavailable %d succeeded device bad device not ready area improper i/o error aborted from console error %d UWVShAAjA=?`=#u#EP5?h 豚?)5?h #ЉÃh@肚uhFm?)Ћd #E'E;l>AEE0FA #@EE4FA)׃E+# y)=%# )yPhX詙jjjV54@h@0+ h54@UR5?U҉ÃuEcEEuE;l>A$  !A,FA=@wh$耏OHEE;l>A10FA4FAE 9s9v¡,FA 9v9}Kw2ށvjVRVRS 9~jSVSV jSRSRS EU;l>Ar "؍e[^_UEU PAÐUEPQ @ÐUÐU=@u@GUSdh dhh5D # h5D #]Sm11҉hh "ؐUWVSE }u]U IM %$(,P,p,,,,,,,--uXPAt@cE\u URSVWHPEPSuMq!t EpEjEPSVW~?mj?h "SVW>Z5"'5"h ?UR*=A~5P@SVW< hP@MQSVWp<-e[^_Ðbus_space_map: bad bus space tagbus_space_map: pa 0x%lx, size 0x%lx bus_space_map: can't free region U WVSu }t }t =AA=Ah`-=0@PEPVW,}Ã}t=wD"ƋU21aEPuURVÃtB=0@PEPVWtURVh-h-؍e[^_ÐUU E}tPuuR1Ðbus_space_alloc: bad bus space tagbus_space_alloc: bad region start/endbus_space_alloc: pa 0x%lx, size 0x%lx bus_space_alloc: can't free region U WVSu] M}tt AAAh@/;Zr;J vh/ՄEP=0@PujuWQSR{Ã0u~uEU$U(1iE(Pu Wu`ÃtE=0@PWu5A}tWuh/Èh0趈EU$؍e[^_U WVSuE EeE)P5 #dǃu _E0;]sKjjjSWh@ }u jjjjSc!;]r1e[^_Ðbus_space_unmap: bad bus space tagportpabus_space_unmap: %s 0x%lx, size 0x%lx bus_space_unmap: can't free region UWVS} }t }t~AAE}AU+D" U=v[E8Vh@}lj})SV5 #` h2=0@PUREPURj{t0EPUR(2}u#2Ph@2@h23e[^_ÐUuu uÐUUEU 1ÐU WVS}4EPjVGÃt6VSE {ECEC E$CCE 1 e[^_ÐUju AÐUvP #~)1ۉAAA)Ɖ@ $JuޡP #~#1ۉAAA)Ɖ$Ju(A,A(AL #e[^Ðpmap_alloc_pv: kmem_alloc() failedUVS|A5p@ xAp@Aujj#hà ËA5p@֡ AAteu h?tSSRB IuC S|AS(At (AX,A(AC(AS?H|A(AC PS utCBC,ASSCЍe[^UVSUӁC HK ȃt =Tt2,AC,A,ACS|A|AtCBC,AS+ԻA `A5p@ xAp@ = ~j#S0AAuAAZ5p@֡ AAte[^INVALID PA!UWVSEMI(AL;{ q~@tCGC,ASACAYC )|AC t =|AS}uEP #tDMA19r;As tۉAMJuuh.BvyURA4~=p@ xAp@utvˁC uX(AC PS ut CB C,ASSCABABEUMU u=p@ס AAt6D];+ԻA `A5p@ xAp@ = ~j#SM-AAuAAZ5p@֡ AAt%ke[^_ÐU WVSu] }9s,jjEPSVh@ 9r։e[^_US}u+jj"j-ÃjSS1]ÐUS]jh5 #1hPh諾3h@ ‹ fC C ]ÐUS]tfK uSj"S]ÐUEh05 #UEtf@ UVS]$C 0h@c F;H"u"؍e[^ÐUÐU,WVSEu E%E%@;uVMQ t֐?uMu@VEPC Eu%@Mu:E)@)9v }щtA}) օfEEE@tMI}OE8 MMEP #tIMA9r;As}t)ߋE8AMJu AU}$`E@A p@ xAp@E;Au+;qu&tBABA?A@t7};zu;rtыt!E;Bu;rutRp@ӡ AAt9M;u}t "؍e[^_ÐU,WVSu }EP #tEMA9r;Ast)މ7MAMJuE}EEeU‹E@A]=p@ xAp@{=p@ס AA:ssVyE@tNNEE AUu$` 3;]u CS'u=p@ס AAt "؍e[^_ÐU WVS] EEuMQSuVEe%@;]SMQǃtԉف?uuu@p7u/E)غ@)9v щtA) Ӆt=EuA߿w w$ Љ;]_}t "؍e[^_pmap_enter: too bigptdi %xptdi2 %xptdi3 %xU,WVSE}} v hMKiE PUR`ǃH"tx tE;tU haKXiE ߁jjSWVtU hiKiGEP-ƃt5H"jjURjPSWb t5H"jVEPU REPzǃuU hrKhj}ttt}t E@UJE%;E" EEEP #tKMA9r;As}t)ދU2AMJu AU$`E@A p@ xAp@E;Au.U ;Qu&tBABA2A3ыt$E;BuE ;ButRp@ӡ AAtUB}tB] EEEP #tHMA9r;As}t)UAMJutyURA=L #t]5p@ xAp@{uE CUS‹E BEB5p@֡ AAtUE A }t } ߿w  } w }t "؍e[^_ÐUUE t t tjjRw RÐUVS]uu S>t2t @t &@ttCKt H`e[^ÐUVS]M t u1Q %9t@u %9t 5 "ظ [^ÐUS] Surtt% 1]ÐUÐUÐU,@U "؃h5@U(@E% ,@E %  "؃h5@5|@ϲÐUMU E}tI@uA߿v9=w2)=u)RQtt%jjPrUAAAAAAAAÐUWVSu }EP #tEMA9r;Ast)މ7AMJu] [A<5p@ xAp@AE u#tCt?wwBU t 5p@֡ AAt!?u‰5p@֡ AAt1e[^_ÐUWVSu }EP #tEMA9r;Ast)މ7AMJu uvA=p@ xAp@}t AU {tFt9re[^_ÐU WVS}u Mp@ xAp@;yu*;qu%tBABA+A-ыt;zu;rutRp@ӡ AAte[^_U WVS} u=L #tXp@ xAp@~u~EFc‰zEBp@ӡ AAt [^_USUE ($S\P %x U,WVS=H"u,E?AE0tEEEE= #t9p@P PuBIOS disk mapping UWVS=@gQA =TPpǡ8AE$M9QƉwD%)5H"h jVT #ЃtPEPhkGTQA G_EWD   Ӂ  #WEGD EPHMIMG0 G0Wje[^_qU WVSEu }ɉ v)׃FFFFFFFFF F F F F FF˃rt FJunUmU +UU)ѡnUmU +UU)Ӆ ˉ[^_USPAu1=X=8Auh8AS¬%uuu Sň #Ћ]ÐUSPAtJX8AtP8AEPjS迶tuMt1"%uuu SŌ #Ћ]ÐU= #tPAtxt1/PAtBuu rŐ #ÐU #tPAtztPlPAu#P%uu RŔ #ÐU1ÐUS] Mbtu+= #tBjA0ud #1V #tPAtztPlPAu%P%QuuSRŘ #Ћ]ÐU= #tPAtxu=PAu uu PAp޺UPAt p@1US]PAt*t&Sp@ Ѓ uPAj p@ Ћ]ÐUS]PAt)u #= #u Sp@Ѕt #]ÐUUS#=#t1SЋS~PAt;P~PA;uҋPAt SCЋ]ÐUS]#=#tDJ8Bu/;PAu 9u1,z~PAZRB1 :u]mii_attach: phyloc and offloc specifiedU,WVS] E1t}th$t@1ҿljC u C$ C U9S$tE쐐9B8uFR0ujuEPC4Ѓ=f}t9uu~juURC4ЉEjuMQC4ЉE]EEUU h0xhwEPMQƒt$C$B0t C$J0H4S$C$B4rS$tjCPhv>[0ue[^_Ðmii_detach: phyloc and offloc specifiedU WVSE} utthv>@ tRH$tKY0ut;y8u-t;q uK09FLjv8v$@4tK0K0tK2 UBC0e[^_ukphyUÐ: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present U WVS} E0h#MQ ЃP%PA P_Shĕ#F(G@UBG8GDԖGH~wLv wP$WLGLjw8w$@4ЋM#AGT fGTuSh# We[^_ÐUVS]U uBC(u t;t@;C@@;C@t-CLjs8s$@4Љ‹CLRjs8s$@8aB@4tCS5P;C@u:u5Su"SSVS1e[^dcphyUEPH @uu 1: internal PHY UWVSu }h!C(F@GF8FD4FH^LC FPC(CE0t^,@`U0t(,@pExu9FTSU,pE1ɉȋUϐE,`1ɉ띐jh`F@ &PSFTx!~TfFTt Vbe[^_ÐU WVSU zE@(u J}t5}L}BGU;B@0GGu;F@2A4 E@PB00u,0 ,p0;G ttUMQ 0u,p틓,p$,Bp$BpG%=u 0tu,h틓,h$,Bh$Bh0u,p틓,p%,Bp%BpG%=u40u,p틓,p =E,Bp =20u,p틓,p ?,Bp ?Bp0u,h틓,h ,Bh Bh0u,p틓,p$,Bp$Bp@G%=u  0,p0Wu;F@A40u ,` ,@`ukUBXHJX1t"X,0.,0UBXbPjRgMQuVEP1e[^_ÐUWVSEHLA0A,A0 @4 0u,` ,X`tI,0u,p|^,@pKu,` ,@`pPt#AC<v uI0bftUBU tI0LtUBU@t I05}UBU tI0!@t I0 tI0I0A0uj,p틖,p$uI0uI0I0A0u,p틖,p$x,Bp$Bpf0u,0u,@0tI0I00u,0u,@0tI2[^_ÐUVSMAL@AP0u,0틓,0%,B0%B00u,0틓,0,B0B00u,h틓,h$,Bh$BhAU t@0t,@p@,p/,p0t㋃,@p0u,h틓,h ,Bh Bh0u,p틓,p ,Bp Bp0u,`틓,`,B`B`} tc10u,`%p=Pt,@`%p=Pu14hwF~APu APe[^USE@L@0u,h틓,h$,Bh$Bhh0u,h틓,h ,Bh Bh]amphyUEPH n`ut@`tu 1ÐAm79C873 10/100 media interface: %s, rev. %d U WVS} uF Ph0hPNC(G@FG8GDGHܣ_L[ _PWGLjw8w$@4#FGTfGTt We[^_ÐUVS]U uBt;t@;C@@;C@t-CLjs8s$@4Љ‹CLRjs8s$@8YB@4t;S-@;C@u4Su!SSVS1e[^U WVSu^LCEC,C0 FLjv8v$@4ЉǃFLjv8v$@4 ǃ tK,FLjv8v$@4ЃtK0C,@tK3 u K0FLjv8v$@4ЃtVFLjv8v$@4ЉǃFLjv8v$@4!tK0vu3|@@t K0_ uI눐FLjv8v$@4f} K04@tK0& t K0 tK0 UBC0e[^_getxscannot allocate scsi xs U WVS}5p@ lAp@f uGE t"5p@֡ AAxOjhXjWf tfO |At-tCBC5p@֡ AAtXwQ5p@֡ AAtwE PjhÃuWb h^m1 E C؍e[^_ÐUUJ b|At |AP|AB|AfA At$fAQAxt q@could not get size UWVS}] j uVwE%Sjh Njj]Sj VW@u%UC C C BWKhV1e[^_UWVS]u j}WwEVjh'j2jjjWSqe[^_ÐUWVS}u j ]SvE@EVjhjjjj SW)e[^_ÐUWVS} ]juVvEE2Sjh'jj2WjVEPe[^_UWVS] }juV?vE]WjhjjjjVEPe[^_ÐUWVS] uj}WuEE]Vj'u0uPjjjjWu9e[^_ÐU WVS}G EGtWjWOtW7jWƃu3UBWЃttst G,뻐_0t"ts4C0C0C< C4G(C@UBx t W@ ЃjWt S8e[^_scsi_scsi_cmdscsi_execute_xs: invalid return codeUVSufF,F$F(FXF @VЃ tt]VЃtOp@ lAp@ujhjVFtp@ӡ AAtr~0t9jV!QF,ېh# e[^ÐU WVS}E(PW'ƃu }~ EP^YSu X^EFEF EF$EFE FE$F0FTcVGBVÃtE(PV1e[^_scbusyunknown error category from scsi driver US]C,$DhpǬp1S{,u}*NVA A RhKK hf; e[^_probe%s(%s:%d:%d): UUBPBPB PBtPRh ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenseASC 0x%02x ASCQ 0x%02xCheck Condition on opcode %x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02xU WVS]s ]s4CPh^jVPhE Ftr h!-~}j h/,F@tPhD,F tPhXhfVNB B B tQhz~qVNB B B tQQhXjVÃtSh3~tFPhjVÃtShϱ} tw<7uCw<3t Whujh)ERWh)vE7}uEWh6M7PhD8EKG~vhfe[^_%s, CDBParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dUS]U t tuC$u"4l"#hD@D@[uC PC Phٰ-u;4l"#hƴhD@D@C PC PhٰR{KH$4Զ༶༶Ht;ȃPCS Pϴ@t˴PhhD@CS Pϴ@t˴PhhD@CS Ph.CS PhEhD@|1]USjjh0qÃhSg p@ lAp@ࡐAtXACAp@ҡ AAtUf؋]ÐUS] p@ lAp@t CBC p@ѡ AAtfjSr]ÐUSMp@ lAp@AtC9up@ҡ AAte[User command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code U WVSu~0uv h(Wƒuv hB ƂFXF,w|$`xహԹĹ̹F(v$)Ɖs$C[hCY CXPC(PF4PJC[CQhd"C['C[QhC[ W(e[^_user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrU WVS}1ۃWYuhC B 9G SCSI%d %d/%s %s%sUWVS]E tPhl{Pt@pUeG|1ۉ%@t. t t1`t)DžxQ+DžxohDžxQ໳E$p (08XXX@XXXXXXXXXXXXXXXXXHf^VNF>6.&h0UjGPE܉lPCjGPUhR+jG PuVxPg|t]PSEPG$PVhRlPpRtPhpH[^_DECTZ30TK50 not configured UWVSUB4M U<yjjj$WÉߋMq0 E fCUfSC"#C"# PSj2h@N5"#h@Sb @ƀ@@~ ƀ@ @~=@uY@uȋXjV@ ЉE"w7V _C,SuVGPGPPEPVE EU Ѓ9v؃PwVI ajj]SjjURE Mȋ@u EffẼjWSTwu5p@ xAp@Aujjh$Cà ËA5p@֡ AAt8E=+ ԻA `A5p@ xAp@ = ~jSkE/AAuAAZ5p@֡ AAK=8AjEPSGPPEP%E t[+ ԻA `A5p@ xAp@ = AA?uGCS)ЍH|6TB$ Buȋ@uBffBIyЋUȋ@u ff;EvEPwCPE+ ԻA `A5p@ xAp@ ?tE5p@ xAp@Aujjh$?Aà ËA5p@֡ AAt6j@j SjjMQ E fSuȋ@u(BffB@u ff1f; v zvB+ ԻA `A5p@ xAp@ = ~jSB-AAuAAZ5p@֡ AA5EȋXjGPGPGPPMQxuȋXjWV@UȋXjWR@MȋXjjjjjQuȋXjjjjjVUȋXjjjjjRMȋXjjjjjQuȋXjjjjjVjEP JjUR~ 6jjM3jjuhjEf?tEHjjUojjMSj?Pu/fH0`EP?MȋXGPPQB WuVO WEPE?%)ƃt E%uURWSMQuE EP>)ȉ>у}t*}uUUE}u 0E}0EE9E9}jEP_/EHs@f}M+ ԻA `Ap@ xAp@ = ~jUR:9AAu MA AMEBp@ӡ AAt-}u}u1uURWhUE%% Rje[^_ÐUWVS}u LJLJ@j ]S.E%Vjh NjjuVj ShuoUMB B B ~tUF F F Bcwe[^_ÐUWVS] uj }WO-EEEEE]EEjjh@ jjjj WEue[^_ÐU,WVS} ]u }9tVEPEu_C@9~))x>D2 PD2 PD2 PD2 PD2 PD2 PEP[^_UWVS}] j uV/,EG]EEEEEEEEE Ejjh Njjjj Vbe[^_ÐUWVS}] j uV+EK]jjhjjjj Ve[^_UEhjhjjjjj߷ÐUWVS] uj }WG+EBuME@EEEEEEh jhjVuj WEle[^_UWVS] uj }W*ECuMEEEEEEhjhjVuj WEe[^_UVSu] jjSjjVl u(CS)ЍjPSjjVCu1e[^ÐUu ut1ÐUÐUÐU,WVS}u j EP)j]S)   $ H$  <EEEhjh0ujjSj EP迵EF1EEF Ehjh0ujjSj EPl0Nj FPEEE F Ehjh0ujj Sj EP0jFPEEVEEEUE F Ehjh0ujj Sj EP覴0UF $F VjFPEP[ 1QEEF Ehjh0ujjSj EP,E$F1EEF EEj EPFP hjh0ujjSj EPƳ1EE F EE jEPFP{ hjh0ujj Sj EPftJ1BEF ?Ejjh0ujjSj EP#u 1e[^_ÐUlWVS} j uEPs&jT]Se&EE EETGEhjh0ujjTSj VE螲0w]jV&C€FC€VFC€V€V$FC€VFSC C C ‰V SC C C ‰VC C C ‰VCF O(1e[^_ÐUWVSu j ]EP%j}W%EE EEFEhjh0ujjWj SE:uGFGF1e[^_UWVS} j uEP$hSt$EE EEGEhjh0ujhSj VE觰0uhGPPx 1[^_ÐUWVS} j uEP#h4S#EE EEhjh0ujhSj VE0u>45 ‰WB=wRGP8P1[^_UWVS} j uEP #hS #EE EEhjh0ujhSj VEH0u> ‰WwRGPP1[^_UMU wX$\p|RQ5RQ)RQRQ"RQ dUWVS]uj}W!jBE P!E]Ehjh NjVE PjWEe[^_ÐUWVS} ]juVs!EM]hjh NjSWjVE蹭e[^_ÐULWVS}u Vjj]SW uE$ EVjSWle[^_ULWVS}uVjj]SW u"E EЋEEҋEEԋEEVjSWe[^_ÐUTS] ujjEPuuEшEӈCEՈCE׈C1]ÐULWVS] }WjjuVEP@ u,EEECEӊCEՊCEWjVEPue[^_ÐUTLTU,WVS}uh NjVj]Sj/ u1E EEEEEEEh NjVjSe[^_ÐU$SU] h NjujEPjuEECECEC1]ÐULWVS}] uh NjVjEEPji udh NjVjEPjND u?"EوEC"EۈEC"E݈E["]߈]h NjVjEPe[^_ÐU1ÐUWVS}] j uVOE]EEjjh@ jjjj V蚪e[^_sdUUEPjjh.#rE %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted media%s: WARNING: unable to establish shutdown hook UWVS} EU2B$XF.#~f~ vfF LJ.#GEGX_0S%WSCF ttLJx LJx`FuUB@uh褷z|"# PjRWÃ1ۃjUBPYPgjUBPbPLjUB PsP1t #x5"#RWЉÃEPhtO t ctKYUJQZ Sr2r1É1Qh蒶 h$ h2shcWh ]| uURhH7e[^_ÐU1ÐU WVSEEp@ lAp@uEt)B$F$B4B0B0R V$u׉p@ӡ AAtUr1; #}*T #?ujFPVS{#C; #|1;#}* #?ujFPVSG#(C;#|܋U|t P\1e[^_UE0P;ÐUWVSEEeEPhl.#ޘƃu N0MQ軟Ã~htGehW.ÃJ|hjW/Ã'OhjW¢ÃGuO fGxjRVЃu jVEPe E%U)ƒt(9}uY} t }`t Fd F`Fd F`FhMQV螗1:g~huhjW趡gEPCVb؍e[^_U WVS}U)ƃQhl.#ܖÃu C0EP t `t!Cd!C`Cd C`Chur txxtjS@Ѓh@jŠ`@t!jjf`EPS>1e[^_U WVS}GDPhl.#ÕƃuG4O<1s(t G4@utG4G4WD%)ƒt' PWV~\p@ lAp@WP̕Vs p@ӡ AAtV!+G0G0GU\WVS} Džu)Rhl.#Ãu MButQt@w"Q @t6w pd t,3 Q@t 'qdtw mdt Q`u t#DžBDžmdwFedAwpd sd tlGrdAt|Q+mwqdhdt~gdfdjSEP=jPURSMQ}eU%)ƔMqE$S0R/ijMQu=gdu5hU% RS􋅴PUtsM9t jE8PӘOMf9tDžBtEfBrEu Dž \U2SjBtDž*uMQEPWUR讫 S[^_SCSI opticalSCSI disk%s %sU WVS]hS>h@EP-U C(M S0u K,C4щS8 uC8dfC} XujhI jhVCPu YMUU bы}DwRVh`CPjRCPE SjuV0EEEE  Sjhpjj,WjVEse[^_ÐULWVS} uG VEEȃtHj]SEE?E Vjhpjj,EPjSEt CEU U ЉG uG @G E GEȉG1e[^_Ð%s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry U+<+`+t+,+,+I,++,D,jVSjEPjSDǃjj+uVjEPjSǃsjjVyjjSXjjSkFjjSOǃ*jjS5jEPjSǃjjjSc1K1jVS0uc0CPu{Tt 9|;sTK0s8K0IE~|S<5Eu!uuEPQURsL近KAjSǃt0CPhE"'ECMO8t ؙ؅} EEMEE]Vjh jSu jEPwLT}e[^_UWVSu ExLGudj]SEVjh0ujjEPjSW}u.EU ЋMAPUE E ‰QT1e[^_ÐUlWVS] E@LEUr@ j}W EMSjh0ujVEPjWEPn|@uvUE E ‹MQ\UE E ‰Q`EAd}}I0E`0UB@tPPEPMI1e[^_ÐUlWVS]u CLE{@ C4u E@t 1jEEP+EEWEEPEU⏈UCfF@Dž9,CWPRfjFPPWF @C,WSv ?tGbPPh7茀%f=uK fuK $`C ?tC Ph8Ec44F1jhF0PVZ~1tn~1Dž9,"#@4tj@PVVS 44~B@ @t%?[^_ÐUWVS]CE{j uV1EEEE]jhL"VEP)Ye[^_ÐUEx<~@<PÐwdc_atapi_get_params: drive %d not present wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramswdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d US? tPw$GHPA A Rh9>? thQ>6ySEPGۉ5p@֡ AAt؍e[^_Atapi error: %d ABRT ILI EOM MCR U WVSuE E^41F,F4EC=?}Ph@xEt({u"C =?}h@axEtK =?}h@8xEtK@=?}h@xEt&=?}hAw{uF,=?} h7we[^_USU] jRЃ9]UE @L`FjPuzUSUJp@ lAp@jRQEp@ӡ AAt]ÐUMU u j$jRQU WVSu 1E FjC PjjjhPVC G<OHF(tcC GL`FpEPGPvFPhT,bE@, %s: %d-sector PIO, LBA, %dMB, %d cyl, %d head, %d sec, %d sectors CHS, %dMB, %d cyl, %d head, %d sec, %d sectors %s: WARNING: unable to establish shutdown hook UƃuG4T|O<1s(Åuv G4tu G4WD%)ƒt# PWF~\p@ lAp@WP>VW p@ӡ AAt趽V>+G0G0G\$bcccccbF0F0F47bCAb;Nb3`t`W`Ph*hHjWhXZVO<0/h]bBV`"`"PP'whibVF0F0F4&8@u ~CPhkbUF@V<)‰PC0P?V}lS![^_ÐUSUdp@ lAp@QRp@ӡ AAtF]ÐUu h/hujh_'ÐUu h/jujh_U WVS}Ph0?8Ãu "C0EP?ƃ{httuOtu8 tpPjSD jSMQ0%)ƒt*9}1u W} t }`t Cd C`Cd C`ChMQ>S81EP>S8e[^_ÐU WVSU)ƃQh0?{7Ãu |{0Wd>EuW} t }`t!Cd!C`Cd C`ChujS. W&>SB7Ee[^_ST506/MFM/RLLESDI/IDE diskUVSu] hS萷C(vS0|K,rC4щS8hxufCjhffCjhgCP[) jPCPF)xSEE9EEM9M}u@t 5@Ѝe[^_%s at %s dev %d function %d %sU WVSu} t&Sjv$v WWSh' vvh'u"Sjv$v WShX'[^_UVSM ]Q t;Cu Bt ;Ct1<SQu@Љƃt jss  Pjss e[^set_pci_isa_bridge_callbackU=@t h"E@E @ÐU WVS}u jVWƒt\j4VW|ۃtDSVWe%;Eu}tE}tEۅu1e[^_pci_io_find: bad requestpci_io_find: expected type i/o, found mem pci_io_find: void region U WVSuFwth p@ Ap@VE PURhjVE PURVE PUREEWVE PUR p@ӡ AAtu hE$$#Euh+$,}tU:}tU} t E 1e[^_pci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_mem_find: expected type mem, found i/o pci_mem_find: expected mem type %08x, found %08x pci_mem_find: void region pci_mem_find: 64-bit memory map which is inaccessible on a 32-bit platform pci_mem_find: reserved mapping register type UWVS]EEEEe}ECwthN}tC'~h=p@ Ap@SU REPjSU REP2SU REPaEVSU REP }tPSU REP2EjSU REPSU REPEURSE PUR =p@ס AAt訅th}t;EtPEPhuM1ۉ1ɋE1 Ӊȉ$؃$!!ډ u h29t:wt4u}u}th` h!9}t $U}tE$$#EU} t E 01e[^_ÐUjuujuu u ÐUuuujuu uUuu uƒtÐU WVS} uE]MU uRQSPVWEP/RQSPVWEPre[^_ÐUWVS]M Uu}t/CtpEPEPEPRQss ) uM.CtAEPEPEPRQss u[EP uVuuS蕓t 4t}tEU} tEU }$tEU$1e[^_.UWVS}u 1ɻf;<u f;tu At1[^_VGAmiscellaneousRAIDIPIfloppyIDESCSIATMFDDItoken ringethernetXGAaudiovideoflashRAMCardBusNuBusPCMCIAPCIMicroChannelEISAISAhostparallelserialRTC8254 timer8237 DMA8259 PICmousedigitizerkeyboardgenericCo-processorPowerPCAlphaPentium486386Fiber ChannelUSBSSAACCESS.busFirewireundefinedserial busprocessordockinputsystemcommunicationsbridgememorymultimediadisplaynetworkmass storageprehistoricINVALID VENDOR IDComputoneTrigem Computer(2)Quancm Electronic GmbHNetPower(2)Buslogic(2)Picture ElementsRISComKofax Image ProductsNetwork ApplianceAurora TechnologiesLinear SystemsStallion TechnologiesThe 3D0 CompanyAztechArielPMC-SierraHAL Computer SystemsMichels & Kleberhoff ComputerSpecialix ResearchLSI SystemsMesa Ridge Technologies (MAGMA)DCM Data SystemsShivaDocument TechnologiesNEC(2)International MicrocircutsPinnacle SystemsNetwork PeripheralsPyramid TechnologiesVideoTronPathlight TechnologyXpoint TechnologiesMotorola(2)United VideoRadstone TechnologyLeitch TechnologyBarr SystemsEastman KodakApricot ComputerPro-LogScitexCannon ISGalileo TechnologyActelInnoSysPower ComputingPure DataMicroUnity Systems EngineeringBarcoSierra Research & Technology(2)Hamamatsu PhotonicsConvex ComputerBull Hn Information SystemsFujitsu(3)Bug SapporoInformation Technology InstituteMind ShareDigital Communications AssociatesLambda SystemsGage Applied SciencesHytec ElectronicRatoc SystemToucan TechnologyDensanArtop ElectricHermstedtBitFlowHiLevel TechnologyMatsushita Electronics(2)Shima Seiki ManufacturingAdvanced Techonoloy LabratoriesDataworldForksFujikuraTelematics InternationalT/R SystemsAtto TechnologyA-Trend TechnologyAlfaSilicon EngineeringSBEMitron ComputerBridgeport MachinesAdobe SystemsAlteraLoughborough Sound ImagesInventecWorkstation TechnologyConnectwarePolaris CommunicationsCentre for Dev. of Advanced ComputingThine ElectronicsMutoh IndustriesImagraphAdvanced Peripherals TechnologiesSynemaOA LaboratoryPFU LimitedMegasoftMaxtorPeer ProtocolsParallax GraphicsHarlequinVoarx R & DAvsysPeriscopePine TechnologyMelcoLand Win ElectronicMegatekJAE ElectronicsThinking MachinesDigiNikonIC CorporationAnnabooksCanopusVMICWin SystemInterfaceForceWorkbitCincinnati MilacronNetPowerCrest MicrosystemIntervoiceEquinoxSanyoLeading EdgeCycloneFWBDynamic PicturesCiscoMomentum Data SystemsFuji XeroxMercury Computer SystemsEicon TechnologyMitelPhilipsComputervisionImaging TechnlogyInfomedia MicroelectronicsRavicadLinotypeHermes ElectronicsFirmworksVigraEurocore/VigraLeutron VisionMulti-tech SystemsZilogEmcPrescision Digital ImagesEldecTricord SystemsTeledyneBerg ElectronicsDatacubeData TranslationDuPont Pixel SystemsAtmelRNSSCOPowerhouse SystemsRoss TechnologyCPU TechnologyZnyx Advanced SystemsMini-Max TechnologyXenon MicrosystemsSiemens AG / Siemens Nixdorf AGProteonStratus ComputerRasterOpsJazz MultimediaNCubeFast ElectronicSoyo TechnologyI-O Data DeviceThesys Ges. F. MikroelektronikTruevisionPC DirectAltos IndiaMatsushitaCreative Electronic SystemsS-MOS SystemsAlarisAchme ComputerTyan ComputerPeritekRacore Computer ProductsXilinxASCII CorporationArtists GraphicsIntegraphics SystemsAlps ElectricVademGainbery Computer ProductsMicro IndustriesTandemAptixCERN/ECP/EDURohm ResearchThomas-ConradAdvanced Peripherals LabsBCM AdvancedCetiaAutologicHualon MicroelectronicsJabil CircuitMolexFuture+ SystemsFujitsu(2)Citicorp TTIRadiusMentor ARCOmronFujitsuDataexpertMedia VisionRambusXeroxAwardSamsung SemiconductorsAuspex SystemsICMBoca ResearchMostTseng Labs InternationalAdvanced Logic ResearchDapha ElectronicsMitsubishi ElectronicsSTB SystemsDatabookRaytheonCabletron SystemsCardExpert TechnologyMicro Computer Systems (M) SONCornerstone TechnologyHoneywell IASDDigicomSierra SemiconductorBenchmarq MicroelectronicsInformtech IndustrialRacal InterlanGlobe Manufacturing SalesEverex SystemsQuantumJuko ElectronicsMeidenshaTrigem ComputerZida TechnologiesMegachipsGemlight ComputerPackard BellSamsung ElectronicsAppian TechnologyAlacronFirst Int'l ComputersNational InstrumentsEncore ComputerSystemsoftElonex PLC c/o Oakleigh SystemsData GeneralMicrocomputer SystemsCache ComputerJ. Bond Computer SystemsTulip ComputersParadorForex ComputerEFASupermac TechnologyData Technology CorporationInterphaseGoldstarGateway 2000NetWorthI-BusChaintech ComputerAdvanced Integration ResearchGIT Co.MitacDaewoo TelecomCity Gate DevelopmentDFISequentHyundaiAten ResearchDiversified TechnologyMitsubishiTexas MicrosystemsAlcatel CITOcean Office AutomationMasPar ComputerInfotronic AmericaVtech ComputersWipro InfotechFoxconnTeknor MicrosystemsElectronics & Telec. RSHICLEfar MicrosystemsHitachiYoung MicroAnigmaCo-time ComputerFountain TechnologyElsaGenoa SystemsIPC CorporationAsustek ComputerComputrendKubota PacificLogic ModelingSolliday EngineeringTatung Co. of AmericaSeiko EpsonAMPHitach MicrosystemsComp. & Comm. Research LabBurndyCompaq(2)Miro Computer ProductsTMC ResearchOlivettiWYSE TechnologyLSI LogicSiemens Nixdorf AGZenith Data SystemsOKI Electric IndustryHitachi Computer ProductsPictureTelVitesse SemiconductorAT&T GISElitegroupUnisys SystemsSPEA SoftwareICL Personal SystemsLSI CanadaMicronicsVideo LogicAST ResearchPhoenix TechnologiesEpsonNetFrame SystemsReply GroupMartin-MariettaDVDTVZoranPCI-ST32Ziatech1221Zeinet754744724F740C740737738734724YamahaX3201-3 (21143)X3201-3XircomMPC106 PPC PCI bridgeMPC105 PPC PCI bridgeLinksys EtherPCIWinbond(2)Linksys EtherPCI IIW89C840F 10/100W83769FWinbond90CWD9610WD34C296WD33C296AWD7197WD7193WD33C197AWD33C196AWD33C193AWestern DigitalP9100P9000WeitekVirtualVMware82C92582C97582C14782C53582C53482C53282C54382C54182C596/597 Wildcat ISA82C594 Wildcat82C593 ISA82C592 CPUVLSI TechnologyGDT7529RN/GDT7629RNGDT7519RN/GDT7619RNGDT6529RD/GDT6629RDGDT6519RD/GDT6619RDGDT7558RN/GDT7658RNGDT7538RN/GDT7638RNGDT7128RN/GDT7528RN/GDT7628RNGDT7118RN/GDT7518RN/GDT7618RNGDT6518RSGDT6558RD/GDT6658RDGDT6538RD/GDT6638RDGDT6128RD/GDT6528RD/GDT6628RDGDT6118RD/GDT6518RD/GDT6618RDGDT6121RD/GDT6521RDGDT6111RD/GDT6511RDGDT6557RDGDT6537RDGDT6127RD/GDT6527RDGDT6117RD/GDT6517RDGDT6121RP/GDT6521RPGDT6111RP/GDT6511RPGDT6557RPGDT6537RPGDT6127RP/GDT6527RPGDT6117RP/GDT6517RPGDT6555/6555-ECCGDT6535GDT6125/6525GDT6115/6515GDT6557/6557-ECCGDT6537GDT6127/6527GDT6117/6517GDT6550GDT6530GDT6120/6520GDT6110/6510GDT6000B/6010GDT6000/6020/6050Vortex Computer SystemsVT8605 (ProSavage PM133) PCI-AGPVT82C598 (Apollo MVP3) PCI-AGPVT82C597 (Apollo VP3) PCI-AGPVT8501 (Apollo MVP4) PCI-AGPVT8371 (Apollo 133) PCI-PCIVT8363 (Apollo 133) PCI-AGPRhineII-2VT82C686A (Apollo 133) AC-97 AudioVT82C686A (Apollo 133) SMBusVT82C596 Power ManagementRhine/RhineIIVT82C586 (Apollo VP) Power ManagementVT83C572 USBVT82C1595 (Apollo VP2) Host-PCIVT82C586 (Apollo VP) IDEVT82C570M (Apollo) PCI-ISAVT82C570M (Apollo) Host-PCIVT86C926 AmazonVT82C693 (Apollo Pro Plus) Host-PCIVT82C691 (Apollo Pro) Host-PCIVT82C686A (Apollo 133) PCI-ISAVT8605 (ProSavage PM133) Host-PCIVT82C598 (Apollo MVP3) Host-PCIVT82C597 (Apollo VP3) Host-PCIVT82C596A (Apollo Pro) PCI-ISAVT82C595 (Apollo VP2) Host-PCIVT82C586 (Apollo VP) PCI-ISAVT82C585 (Apollo) PCI-ISAVT82C576 3VVT82C586A IDEVT82C561VT82C505 (Pluto)VT8501 (Apollo MVP4)VT8371 (Apollo 133) HostVT8363 (Apollo 133) HostVIAV96DPC i960 (Dual) Host-PCIV960PBC i960 Host-PCIV292PBC AMD290x0 Host-PCIV3 Semiconductor3CP5610US RoboticsUS201ULSI SystemsUM8891NUM8886NUM9017FUM8891AUM8886AUM8886F PCI-ISAUM8881F PCI-HostUM8886UM8710UM8886BFUM886AUM82C891UM8881 HB4 486 PCIUM8673F EIDEUM82C886 ISAUM82C881 486 ChipsetUMCET6300ET6000/ET6100ET4000w32p rev DET4000w32p rev CET4000w32p rev BET4000w32p rev ATseng LabsPyramid3D TR25202TriTech MicroelectronicsHPT366/370 EIDEHPT343 EIDETriones TechnologiesBlade 3D3DImage 98503DImage 9750TGUI 9682TGUI 9680TGUI 9660CYBER 9525TGUI 9440TGUI 9420CYBER 9397DVDCYBER 9397TGUI 9388TGUI 9360TGUI 9350TGUI 9320CyberBlade i74DWAVE NX4DWAVE DXTridentFast Infrared Type OToPIC100 PCI-CardBusToPIC97 PCI-CardBusToPIC95B PCI-CardBusToPIC95 CardBus-PCIToshiba(2)R4x00 Host-PCITC35856F ATM (Meteor)ToshibaPCI1451 PCI-CardBusPCI1420 PCI-CardBusPCI1410 PCI-CardBusPCI2031 PCI-PCIPCI2030 PCI-PCIPCI1251B PCI-CardBusPCI1211 PCI-CardBusPCI1251 PCI-CardBusPCI1225 PCI-CardBusPCI1450 PCI-CardBusPCI1221 PCI-CardBusPCI1220 PCI-CardBusPCI1250 PCI-CardBusPCI1131 PCI-CardBusPCI1031 PCI-pcmciaPCI1130 PCI-CardBusTSB12LV23 FireWire3DLabs Permedia 23DLabs PermediaTLANTexas InstrumentsDC-690CTekram Technology(2)DC-290(M)Tekram Technology (1st ID)82C565 PCI-ISASymphony Labs(2)82C10582C10382C101Symphony LabsSurecom NE-34Surecom TechnologyST201SundanceHMESun MicrosystemsVelocity128NVidia/SGS-ThomsonMemory Stick SlotCXD3222 FireWireCXD1947A FireWireSony83C170 (EPIC/100)FDC 37C922FDC 37C665SMC5597/5598 USB6326 AGP Video530 VGA63006205620455985597 Host55965591 Host-PCI5582558155715513 EIDE551255117016 10/100BaseTX900 10/100BaseTX630 Host-PCI620 Host-PCI85C601 EIDESiS530 Host-PCI85C59685C49685C50162155597/5598 VGA5595 PCI System I/O Chipset85C503 ISA86C20586C202 VGA86C201 Host-AGPSISDVDmagic-PRO64GXSigma DesignsSTG 1764XSTG 2000XSGS ThomsonTigonSilicon Graphics984x GESchneider & KochSonicVibesSavage/IXSavage/IX-MVSavage/MXSavage/MX-MVViRGE MXPViRGE MXSavage 4Savage 3DMSavage 3DTrio3 DX2ViRGE GX2ViRGE DX/GXTrio3D AGPPlatoTrio64V2/DX86C968-3 (Vision968)86C968-2 (Vision968)86C968-1 (Vision968)86C968-0 (Vision968)86C964-3 (Vision964)86C964-2 (Vision964)86C964-1 (Vision964)86C964-0 (Vision964)86C864-3 (Vision864)86C864-2 (Vision864)86C864-1 (Vision864)86C864-0 (Vision864)86C928ViRGE VX868Trio64UV+Aurora64V+Trio32/64Trio32ViRGES3RS56/SP-PCI11P1 ModemRockwell5C478 PCI-CardBus5C477 PCI-CardBus5C476 PCI-CardBus5C475 PCI-CardBus5C466 PCI-CardBus5C465 PCI-CardBusRicoh81298029Realtek85808500Quantum DesignsISP2300ISP2200ISP2100ISP12160ISP1280ISP1240ISP1080ISP1022ISP1020QLogicUltra100/ATA IDE(2)Ultra100/ATA IDEUltra66/ATA IDEUltra33/ATA IDEDC5030PromisePLX TechnologyPCC-ISESPijnenburgPT86C523_2PC87550PT86C523PT86C521PT80C826Picopower TechnologyCMIC_HE HostCIOB30CNB20LE HostCNB20HE HostPCIHB7I/O BridgePCIHB5ROSB4 SouthBridgeReliance ComputerRZ1000PC TechnologyPMC/GNIC2Packet Engines Inc.RM861HA82C82282C70182C70082C621 IDE82D568 IDE82C568 IDE82C558 PCI-ISA82C557 HostOpti82C092GOmega MicroOC2326OC2325OC2183OlicomOTI107Oak TechnologyGeForce2 GTSGeForce256 DDRGeForce256VantaRiva TNT2 UltraRiva TNT2Riva TNTDAC64NV1NvidiaImagine-128 T2RImagine-128 IIImagine-128Number 9NDR4600 Host-PCINKKNX82C501 Host-PCINexGen MicrosystemsPacket Engines G-NIC53c875J53c895A53c151053c87553c88553c8953c89653c1510D53c86053c810AP53c81553c82553c82053c810Symbios LogicSIIGUniverse VMENewbridgeNetVin 5000NetVinCMI8738/C3DX AudioCMI8338B AudioCMI8338A AudioC-Media Electronics Inc.NetSecGA620NetgearMagicMedia 256ZXMagicMedia 256AVMagicMedia 256XL+MagicMedia 256AV+Magicgraph NM2360Magicgraph NM2200Magicgraph NM2160Magicgraph 128ZVMagicgraph 128VMagicgraph NM2070NeomagicI/OPowerVR PCX2NECNS87410DP83815 10/100DP83810 10/100National SemiconductorMV1000MutechDAC960P RAIDMylexSM56MPC106 Host-PCIMotorolaMGA 1064SGMGA G100 AGPMGA G100 PCIMGA ImpressionMGA G400 AGPMGA G200 AGPMGA G200 PCIMGA Millennium II 2164WA-B AGPMGA Millennium II 2164WMGA 1064SG 220MHzMGA Millenium 2064W (Storm)MGA PX2085 (Atlas)MatroxCollage 155 ATM adapterCollage 25 ATM adapterMadge NetworksMX86250PMAC 98727PMAC 98715MacronixLS242 DVD DecoderLuxSonorVenus ModemLTMODEMWin Modem V.90K56flex DSVD LTMODEMAT&T/LucentPNIC-IIPNICLite-OnS3 805LeadTek ResearchSerialDual SerialDual Parallel BDual ParallelParallelLavaDS1SSIDS3HSSILAN Media CorpKTIIT8330GITExpressADSP 2141IREITT3204 MPEG DecoderAGX016I. T. T.AEONInvertexPowerstorm 4D50TIntergraph82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit82454NX PXB82451NX Mem & IO82450KX/GX (Orion) Memory82450KX/GX (Orion)82740 AGP82443GX82440BX AGP82440BX PCI-AGP82440MX Power Management82440MX USB82440MX IDE82440MX PCI-ISA82440MX AC97 Audio82440MX Host82443BX82443BX AGP82443BX PCI-AGP82443LX AGP82443LX PCI-AGP82810E Graphics82810E82810-DC100 Graphics82810-DC10082810 Graphics8281082371AB Power Management (PIIX4)82371AB USB (PIIX4)82371AB IDE (PIIX4)82371AB PIIX4 ISA82439TX System (MTXC)82437VX82371SB (Triton II) USB82371SB (Triton II) IDE82371SB (Triton II) PCI-ISA82820 AGP82820 MCH (Camino)82801BA AGP82801BA IDE8256282801BA USB282801BA SMBus82801BA USB82801BA LPC82801AB Hub-to-PCI82801AB AC-97 Modem82801AB AC-97 Audio82801AB SMBus82801AB USB82801AB IDE82801AB LPC82801AA Hub-to-PCI82801AA AC-97 Modem82801AA AC-97 Audio82801AA SMBus82801AA USB82801AA IDE82801AA LPC Interface82840 PCI82840 AGP82840 Host80960RP ATU82806AA PCI6482439HX (Triton II)82380FB Mobile PCI-PCI82380AB Mobile PCI-ISA82441FX82437 (Triton MX) PCI/CACHECOMP/DRAM82371 (Triton MX) PCI-ISA and IDE82371FB (Triton) IDE82371FB (Triton) PCI-ISA82437FX (Triton)82806AA PCI64 APIC8255982557EE Pro 100 SmartEE Pro 100EE Pro 10 PCISAA711682092AA IDE82559ER82815 Graphics82815 AGP82815 HubPro/1000i960 RN PCI-PCIi960 RM PCI-PCIi960 RP PCI-PCI82434LX/NX (Mercury/Neptune) PCI/Cache/DRAM82426EX PCI-to-ISA (PCIB)82378IB PCI-ISA (System I/O)82424ZX (Saturn) Cache/DRAM82375EB PCI-EISAIntel8849Integrated Micro SolutionsINIC-950 SCSIINIC-941 SCSIINIC-940 SCSIINIC-1060 (A100U2W) SCSIINIC-850 (A100UW) SCSIInitioWDT 50x Watchdog TimerIndustrial Computer Source77201/77211 ATM (NICStAR)IDTOlympicMiami/PCI82351 PCI-PCIGXT-150P 2D AcceleratorAuto LANStreamerCPUISA w/PnPCPU - Alta MPCPU - Alta LiteMCAIBM65007751Hi/FnNetRaid-4MJ2585BJ2585AHewlett-Packard25SS-3010 ATM (ASIC)155P-MF1 ATM (ASIC)155P-MF1 ATM (FPGA)Efficent NetworksTMC-18C30 (36C70)Future Domain801 SoundForte MediaATM PCA-200eATM PCA-200FORE SystemsFreedom PCI-GBusEvans & SutherlandRoadRunner Gig-ERoadRunner HIPPIEssential CommunicationsES2898 ModemMaestro 3Maestro 2ESOLO-1 AudioDriveMaestro IIESSCT5880AudioPCIAudioPCI97EnsoniqLight Pulse FibreChannelEmulexPCI-SCIDolphin Interconnect SolutionsSmartCache/RaidDPTViper/PCIDiamond MultimediaDECchip 21154 PCI-PCIDECchip 21153 PCI-PCIDECchip 21152 PCI-PCIDECchip 21150-BC PCI-PCIDECchip 21150 PCI-PCIDECchip 21052 PCI-PCIFarallon PN9000SXDECchip 21142/3DGLPB (OPPO)DECchip 21041 (Tulip Pass 3)DEFPATGA2DECchip 21140 (FasterNet)KZPSAZephyr NV-RAMDECchip 21030 (TGA)DECchip 21040 (Tulip)DECchip 21050 PCI-PCIDECDM9102DM9100Davicom Technologies550TXD-Link SystemsPERC 3/SiPERC 3/DiPERC 2/SiDell ComputerGXm PCI-ISAGXm Host-PCICyrixCyclom-Z above 1MCyclom-Z below 1MCyclom-Y above 1MCyclom-Y below 1MCycladesEctiva 1938SoundBlaster Digital InputSoundBlaster LiveCreative LabsC-Bus II-PCICorrollaryCY82C693U PCI-ISA82C599 PCI-VLBContaq MicrosystemsSoftK56 PCI56k WinmodemConexantPMAC 98713RL100-ATX 10/100EthernetCompexNetFlex 3/PBNetFlex 3/PNetelligent 10 T/2 PCIEmbedded Netelligent 10/100 TXHost-PCIProLiant Netelligent 10/100 TXDual Port Netelligent 10/100 TXIntegrated NetFlex 3/PNetelligent 10 TNetelligent IDENetelligent 10/100 TXPCI-ISAPnPUSB OpenHostNetelligent ASMCQVision 1280/pQVisionTriflex Host-PCIPCI-ISAPCI-EISACompaqEX110TXCogent Data TechnologiesUSB0673USB0670PCI0650APCI0649PCI0648PCI0647PCI0646PCI0643PCI0642PCI0640CMD TechnologyCS4281 CrystalClear AudioCS4280 CrystalClear AudioCS4615CS4614CS4610 SoundFusion AudioCL-GD7541CL-GD7543CL-GD7542CL-PD6833 PCI-CardBusCL-PD6832 PCI-CardBusCL-PD6729CL-GD5465CL-GD5464CL-GD5462CL-GD5480CL-GD5446CL-GD5436CL-GD5434-8CL-GD5434-4CL-GD5430CL-GD7548Cirrus Logic6900068554655556555465550655486554564310Chips and TechnologiesCinemaster C 3.0 DVD DecoderC-CubeGPPCIc't MagazinFlashPointMultiMasterMultiMaster NCBusLogicBt8474 Multichannel HDLC ControllerBT878 (2nd device)BT879BT878BT849BT848Brooktree5805Broadcom56015501Bluesteel NetworksPCI-VME Interface Mod. 2706PCI-VME Interface Mod. 617Bit3 Computer Corp.ALS4000ALG2302ALG2301Avance Logic(2)AVG2302AVL2301Avance LogicAU8830 Vortex2AU8820 Vortex1AurealIDE-2015PLAtronicsMyrinet LANaiS5933 PCI MatchmakerApplied Micro CircuitsMach64 VVMach64 VUMach64 VTRage 128 VR AGPRage MagnumRage Fury AGP4xMach64 LPMobility 1Mach64 LIMach64 LGMach64 LDMach64 LBMach64 GZMach64 GYMach64 GXMach64 GWMach64 GVMach64 GUMach64 GTMach64 GQMach64 GPMach64 GMMach64 GIMach64 GDRage ProMach64 ETMach64 CXMach64 CTMach32ATIAX88140A/88141ASIX2000MI2000MT2000PV1000PVARC LogicKeylargoGMACUni-North AGPUni-NorthUni-North EthPaddingtonHeathrowOHareGCBanditAppleMegaRAID Enterprise 1300MegaRAID Enterprise 1200AMI756 USB Host756 Power Management756 IDE756 PCI-ISA751 PCI-PCI751 System Controller79C974 PCnet-PCI Ether+SCSI53c974 PCscsi-PCI SCSI79c978 PChome-PCI LANCE79c970 PCnet-PCI LANCEAMDAcenicAlteonAT24AT22Alliance SemiconductorASP-3940U3WASP-3940U2WABP-940UWABP-930/40UA1200B1200AAdvansysDell PERC 3/QCDell PERC 2/QCAAC-3642AAC-364AAC-2622AIC-7899 Ultra160AIC-7899FAIC-7899DAIC-7899BAHA-3960D Ultra160AIC-7896/7 Ultra2AHA-3950U2D Ultra2AHA-3950U2B Ultra2AHA-19160B Ultra160AHA-29160 Ultra160AIC-7892 Ultra160AIC-7890/1 Ultra2AHA-2930U2 Ultra2AHA-2940U2 Ultra2Adaptec(2)AIC-7895AIC-6915AHA-2940UWProAHA-2944UAHA-398XUAHA-3940UAHA-2940UAIC-7880AHA-2944AHA-3985AHA-3940AHA-2940AIC-7870AHA-2940AUAIC-7860AIC-5905 ATMAIC-5900 ATMAIC-7855AIC-7850AHA-2930CUAHA-2940AU/CNAIC-7810AdaptecAN985AN983AL981ADMtekM3309 MPEG AcceleratorM7101 Power ManagementM5243 AGP/PCI-PCIM5247 AGP/PCI-PCIM5237 USBM5229 UDMA IDEM5219 UDMA IDEM1543 PCI-ISAM1523 PCI-ISAM4803M1621 Host-PCIM1543 Host-PCIM1531 Host-PCIM1523 Host-PCIM1489 Host-PCIM1461 Host-PCIM1451 Host-PCIM1449 PCI-ISAM1445 VL-PCIAcer LabsM1435 VL-PCIAcerRhineII8139AddtronEN1217MPX 5030/5038Accton Technology2051 Host-ISA2051 Host-PCIACCM 2188 VL-PCIACC MicroelectronicsPC4800 WirelessPC4500 WirelessAironetEscalade IDE RAID3warePermedia 3Oxygen GVX1Permedia 2500MXPermediaDelta500TX300SX3D LabsVoodoo3BansheeVoodoo2Voodoo3DFX Interactive3cr990 TX-973c980C 100Base-TX3c980 100Base-TX3c905C 100Base-TX3c905B 100Base-FX3c905B 10/100Mbps-Combo3c905B 100Base-T43c905B 100Base-TX3c905 100Base-T43c905 100Base-TX3c900B 10Mbps-FL3c900B 10Mbps-TPC3c900B 10Mbps-Combo3c900B 10Mbps3c900 10Mbps-Combo3c900 10Base-T3cSOHO-TX3c556B 100Base-TX3c556 100Base-TX3c555 100Base-TX3c595 10Mbps-MII3c595 100Base-T43c595 100Base-TX3c590 10Mbps3c4503c3393c9853ComOZ6832 CardBus2 Micro Incunknown %svendor 0x%04x product 0x%04x"%s %s"vendor "%s", unknown product 0x%x (unknown class 0x%2x, subclass 0x%02xclass %s, unknown subclass 0x%02xsubclass %s, rev 0x%02x) rev 0x%02xU,WVSUE ]fUMME?yt2Ef9?tytEf9uf9QtAtAuEEEEAuI M<?=<?tE;Gt ?t;Gu1?twt >tE;Ft t >t;Fu}u#PEPhh SWà 0}tMQEPh?PMQh`S%Ã}}hSÃuEPEPh;PhSÃtuEPh PhSà EPhSEPhSue[^_cy82c693_initUVSup@ Ap@=@t1p@ӡ AAtw1;5@tthEPjjj"VA tp@ӡ AAt,1155@E@@p@ӡ AAt0@e[^cy82c693_readUVS]u p@ Ap@=@u. p@ѡ AAt0hS ;tC;u SBCX p@ѡ AAtL0Íe[^cy82c693_writeUVS]u EE p@ Ap@=@u< p@ѡ AAt/hcSSBE;tC;tCUP p@ѡ AAt/e[^UEP %=t=m=xqR=YAw9=`84w=x',=xP=xU =x`w=Y=xa=xp=xw;=xsw=xr=xt=x=xt{w=xtr=xtks=xt_=xubV_tLw tEw wHrC7Qw;Pr6*=t#w=w$=r=t=u 1: unable to map registers : error allocating pci data %s: OptionMode = %x %s: couldn't map interrupt : couldn't establish interrupt at %s : %s %s: Using left over BIOS settings %s: UM@jjEPEPjjjW thMEPjww 觜jjj %4ƒ u(hS8‡^G GBGBSLCP MEPUREPVu7S[CP  {4tS8t{4u S8C8@{4u S8C8@Ee{4u S8C8@ƒU{4uS8C8E܃S at?u UBE@K4uS8ŸS8Ÿ $C8!ƅt܋S8 K4uMS8JS8MS8 QS8 US8ŸZS8|ZC8@tC8@{4tC8@ {4tC8@ {4tC8򈐟{4tC8ƀ|EPG1PG0Pw,w P tCPh%guw ƃCEPShbjuw KC00uAh`tVhhSYtVh5p@ lAp@K4uS8„K80C8 t 罁πtˋC8EPS?K4uS8K8?ЉC8@DžtC8?Pt3{4t C8ƀD1S8D"S8†{4tC8ƀt\}t-EPhS8ZE `"EE{4tߋC8U`PZU㈓JS>CPhA EtSt%S0X5p@֡ AAt'$ 5p@֡ AAt$S}fe[^_ÐUS]CLj@p0 t'{4u S8„ C8v 1tt 1]ÐU WVS]{L t{4t;C8j@w79tWs4uS8„S8C8E} teMt,C8U5}t } t[8ÄEɀ}tQj@w7De[^_, parity checking enabled%s: External SRAM, %dns access%s UWVS]S+E1EjjjSS+ƃ 6EjjjS_Sƃ K4uS8‘uOC8t@u/S8’,S8’6S8’6C8 u{4tȋC8ƀ{4tƋC8ƀjWjSS\ 9umK4uS8‘uOC8t@u/S8’,S8’6S8’6C8 uE{4tƋC8ƀ{4tƋC8ƀEPWEPS e[^_%s: Reading SEEPROM...checksum error done. %s: No SEEPROM available. UWVS]C4E܋C8EEEE t E EfE fEfEfEfEfEuVS< Et\Hj P}WVEt!11WB|tf;MtE}t E묃}uE‰EfEfEE19}|E@tcmS8ZS82EfmS83ES80ES81fmEF;u} w@t@1;uEfE}U:tMf M@t@t&Ef ES8pcEtUf UM9ЃfuEfEtf9Ef!EtK1ɋU:t{4tC8LpM9UfUt-(S8 /U:t tɀ{4t͋C8L EF;uEJEt @t@}}t@u EufE{4C8HZ{4S8EЈB2{4 S8fmEЈB3{4C8UP0{4C8fmMH1EtMt{4u S8C8@u1tu QEPSEPh[^_%s: Manual SE Termination %s: Manual LVD Termination isnot%s: internal 50 cable %s present, internal 68 cable %s present %s: external cable %s present %s: BIOS eeprom %s present %s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! %s: 68 pin termination Enabled Secondary %s: %sHigh byte termination Enabled %s: 50 pin termination Enabled %s: %sLow byte termination Enabled %s: Primary Low Byte termination Enabled %s: Primary High Byte termination Enabled Primary U,WVS}uEEM 9I] SC C u EEEEtyEPEPEPEPEPW uEMu %EEEEEQ] SSC COtEPEPEPWQEPEPEPEPW uEtEu&}t }t}tGPh`Tt}t }t}tM@}}t@}t@~}t#tM W8M&] }tE4t؋W8MB}tMEPW\W8]>E PP@QtM tM@4tW8]BEPW~E 8tHP@ e[^_U WVSu}]u3@ U ƒƒMe[^_ÐU WVS]u }jSSЃ4j SSЃMсEe[^_ÐUS]{4t3S8B {4tS8B{4u"S8S8吋S8 ɐS8BҋM ҋM{4u S8S8RM[UVSuE E u*HBu,(V8)V89t~4tՋF8Xj.5 ]~4t‹F8Xj5tV8~4tF8Xj4tV8~4tF8Xe[^ÐUS] uHBu S8 t{4tC8HjR4K4uS8S8C8@EtC8@E]ÐUVSE] t1x4u P8@8@u1SSC;tKSC K;u S S SC uh3NuK3uS SSSxSC ut܋SCSe[^UE8u PP P@Ð%s: Data Parity Error Detected during address or write data phase %s: Signal System Error Detected %s: Received a Master Abort %s: Received a Target Abort %s: Signaled a Target Abort %s: Data Parity Error has been reported via PERR# %s: Latched PCIERR interrupt with no status bits set U WVSu~L~4uV8’ F8@u1V8’jw7譄Ã}FPh k@tFPh O tFPh" 3tFPh? tFPh\ tFPh ߭uFPh íSjw7蛄1t~4F8ƀe[^_UWVS]EEEE9ES2SU;tFSCM2K s u S S SC t܅u,SS,SSE2C뽐SSECS1=(f?)f?tS 0U;t@SCM K3u S S SC t܅u(SS(SSESSE2CCStSCM2K s u S S SC t܅u SS CS)f?tS 0UG(f?9{OMsC 0E;tASCM K3u S S SC t܅u(SS(SSESSE2CCStSCM2K s u S S SC t܅u SS CSUsK 0MO"fE;tCSCM K3u S S SC t܅uSSSSECSfeK"u#SSu%'SSE2C)SCtMt؋SCM2K s u S S SC t܅u SS CSOE+EMU f BCE;SCM K3u S S SC t܅uSSSSE2CCStSCM2K K3u S S SC t܅uSSSSECStSCM s u S S SC t܅u SS CSEEE9Ee[^_UE@ f=u%=tw =t =u 1Ð %s: unable to map device registers adv_pci_attach: adv_init failed %s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s UWVS} ]C EfLJj ss }C"=t=u0=u<w0 Rj ss =~EPEPjsEP} uEPjuu3H tGPh`G0EG4CG8C ffLJW th2EPC1PC0Ps,EP tGPh胦uEPÃwVWh%juEP|G@0u6Vh8tSh#h Sh W e[^_U WVS]{0s4F fFfǃƃƃƃƃƃƃƃƃƃƃƃfǃƃƃƃƃPE+ƃƃƃfǃqfǃPVW < fǃƃ ƃƃƃ ƃ&ƃ,ƃ2ƃ9ƃ?ƃEƃKƃRƃXƃ^ƃdƃkƃ< u(t4F `V1fxV ]< vktF PaV `WV POV `\V Ixƃƃƃ#ƃ(ƃ2ƃ<ƃFƃUƃfu tF `ƃVW f=utF IfǃtVW)1ƄƄƄ@~e[^_ÐUC<u7EЋU MQEPVW EUM؈E%PEPVWjj@VWAfE"PVWVEPVMQTEPWWE]1B@OvCC MKECK4K$Caj jVEPMMUE MSW2 EhSVMQ>VEP)uTVMQVEPw MtjAEPVMQUEPWY EM VEP#MEx[^_U WVSEx0X4ƀEPKSWiUƂSWmM)ЍPEP1UƄ"tjAPSWF~΅tfC uS ff=u S fC f=tESWYuESWEƀƀEe[^_ÐUSE] Sj0p4p0X؋]ÐUWVS]E E{0s4EMEEЈ ˆ "EMA$<w A$<vOEtMAtˆEt(MAtQtEM:tdPjRVWPjJVW PjSVWEPfE PVW E:tMQEPSe[^_QUANTUM XP343011071US]{v8jh#XCP%ujh3XC P u1]HP TANDBERG TDC 36WANGTEK NEC CD-ROM DRIVE YAMAHACDR400UWVS]}E E$EMErf}u#jhXGPVu EU }t}u E ˆ}ugjhXwVu%jhXGPu E }u"jhXVu E }jhXwVu%jhXGPzu E }uN<\G  ud@GE1ۀtbj ~8u!MAЋ\V<!E@N<\CEG9|GGE1ۀ%j 2~8u!MAЋ\V<!E@N<\CEG9|1ۀtSj ~8uG؋PV<0Nwt3owird|@ ǃ?ǃuQSSfu `HuZPu+sC @phjL6cǃǃ |<tr dxr ǃǃSUCS`߃ SC|$n on on o oSo9u]RxrF{8u PS< CsC @phjDu)$fǃ_$`ǃ,ǃ,uǃ ǃS`߃Se[^_Ð Xs4os 0s4os\ @@@@@x U WVS}EjPW>ft 1:jPWÃjPW pv pv t$9uf~ t-^ F PPWf#Cf;CuE}utf~t-^FPPW}f#Cf;CuE}u:f~t-^FPPWCf#Cf;CuE}t.f~t'^FPPW f#Cf;CuEUwe[^_ÐU WVS}] jVWt=t =vt/KFvԅu(jjWt=t=v 1  e[^_ÐUUE @t ǂZf}ǂ I tǂ5tǂ!uǂ1ǂǂÐ%s%d(phy%d): error: reset of PHY never completed! U WVS]tMr*chjE PSǃ hǃjE PS-ƃf}GE PsC @phy@?`ǃjE PSǃjE PS‰ 9tPjE PSHVjE PS2jE PSkǃǃ jE PSEƃ u(~ SN=cǃ*jE PS!PSuce[^_ÐUWVS]tllats tn| ulPtu*%;l Al.TS<1u{8tS!| E}d&EEhQO}d~7ǃ5PS< PS<ǃ@@@ @@@ @@ @@ e[^_Ð 4oP}{UEl Ð,4ok{USM y8u Q<A< K[U WVS]{8uDS<SfSC fVfSC fVfSC fVw tdt t.}fF fFfFEfF fFfF]UfFfF?fFh/MfFfF=fFhSCV SCV}\W<1|ECFCC*EFFCFCC*EFVSME9Uslj fEx8uGЋM\Q<'E@Mt'Gu ǁGE"M;Yu9Et׋Et*GUu ǂGM}~PA Ut)@u ǂ@E M}C%EUcuuf;|o)A WEBEBEB fEUt&9uURqP譔 WPbMaEEE@L@tU@1Ҁ;}M<;t#tE4JU8ZtKMbu?RGPoPEp‹B @phbMb E@HU;ZuMY}u5p@ xAp@pAuj5"hoà ËpA5p@֡ AAtYdtYfCp@ xAp@fAp@Ћ AAtdCC CfCCjj@Ã5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAttcC t#CKC(C$C,C0CuS1ۃ}t%GG UWMOWEPQ߅uE]bEP B% BUJ W % ЉAMA A XY ;AuA GUux]Pυ[Ѓ~bMYE11E}tEMMQ 9e[^_ÐUWVS]\EEEl9pdlMQB ``@t @``!Sli{8t`S<4{8t6K<<h {8VK<8l v<Stryloop + sizeof (scrh->tryloop)assertion "%s" failed: file "%s", line %d (u_long)p == (u_long)&scr->data_in + sizeof (scr->data_in)(u_long)p == (u_long)&scr->data_out + sizeof (scr->data_out)U WVSuU л ߁@:`4PIy9thm hhhdžPp@\PIy\PP9th hh8hdžSPp@PIyPP 9th hhxhe[^_%s: ERROR0 IN SCRIPT at %ld. %p: <%x> %s: ERROR1 IN SCRIPT at %ld. ncr KVAR out of rangencr_script_copy_and_bind: weird relocation %x @ %ldUWVS}u uE}$EE9.}uePtSGTUEu++EHPGPhh@BW  '$UWT뭐UM롐$$$$$$PE%=pu1ɋV%=pu11t++EHPGPh:h@BV tuG}uo}u:PtHGTU\QE>Eu#u(tt =u "BBEtt'>FFFE@DFE@HFFFE@BFUr$r C PW8ƒ}AuF,EPSWy3Up@U AAE #~EtGhC(D'EtGhC(D GhC(C0C(C,[4WhˆS$C UB @UBKBEǃE ߋ%e EuFǃƃF @ƃ ~Tt FT4 % Љǃ UBICx}tCyW< CyCzC{C|uFEC}EC~FKC 5CUJMb)¡ȻADǃi  wh4  4ff 8CG<@ uEp@U AAEt u$1*W<yW< Urt/Bh??W. Nt E@tۋUBwVhI8tG<@h>8nG<@ WE@uO8u W<,G<@,PVhڻjhW^ UBuCySW ]C,tu e[^_CCB=%lx STAT=%x/%x %d parity error(s), fallback. extraneous data discarded. illegal scsi phase (4/5). extended error %d. %s: sense data: %xCOMMAND FAILED (%x %x) @%p. CMD: GOOD SENSE: STAT: %x HOSTERROR: %xU WVS} YE iF9ǀǀ@UJh选H$PR|9E ǀV BMRCpsc_link->target & 0x0f)%d.%d MB/s (%d ns, offset %d) UWVS}M EEUU8u W<GEEFu S<$ C<@$PVQ{8u S<C<@P{8u S< C<@P{8u S;us9}t U{Pu sTCTPWhbCPhN1{8u S< C<Ph F~σhZ e[^_F <%d|%x:%x|%x:%x>%s: have to clear fifos. %s: handshake timeout %s: INFO: LDSC while IID. %s: target %d doesn't release the bus. %s: reg[%d0]: %x%x%s: halted! fatal errorUVS]/S< tC<@PjSs8u S<Cccb = %p P%x%x RL=%d D=%d SS0=%x CP=%p CP2=%p DSP=%x NXT=%x VDSP_BASE=%p VDSP_OFF=0x%x CMD=%x OCMD=%x TBLP=%p OLEN=%x OADR=%x internal error: cmd=%02x != %02x=(vdsp[0] >> 24) phase change %x-%x %d@%08x resid=%d. newcmd[%ld] %x %x %x %x. Uheader.cp%s: int#%d t%d+- (remove)+ restart job .. -- remove trap in getcc reselect by t%d. negotiation failed sir=%x status=%x. sync msgin: sync: per=%d scntl3=0x%x ofs=%d fak=%d chg=%d. wide msgin: wide: wide=%d chg=%d. M_REJECT received (%x:%x). M_REJECT sent for M_IGN_RESIDUE received, but not yet implemented. M_DISCONNECT received, but datapointer not saved: data=%x save=%x goal=%x. queue full. %s: queue empty. UWVS]K8u S<0C<@0E1u S<C<@$EUUu S<CC,FFMAh@F FQlHVF % ЉC,ME4Uf Ft :FjjhÃFMf hSE ߁% ‰CFCVCEPhSF^e[^_Ð%s: actlink: diff=%d, new=%d, req=%d UVSu ]VF8v((tCfS Z f9vJ f)fZ (N!8v(ыS ffB Ns Fe[^Ðncr?: scattering virtual=0x%x size=%d chunk=%d. seg #%d addr=%x size=%d (rest=%d). ncr?: scatter/gather failed (residue=%d). UWVS]fE1EhE EPHu 1E ߁E% t )ƃ9mE9}wEMu}tPtL%)9v9vEE))ËE ߁E% t9tEuU uU4fEtf} kuESh3:e[^_ÐCACHE TEST FAILED: reg dstat-sstat2 readback %x. UMEy8tQfF9EFEUv?8l?uy?8q?t`FEV~wFEfF8E;~8wF8fEfEFE V8F9vЈEEFfEF8EURDu#E}v}vDMAPjEBMAPjD*-EPMQpEUBPjEP EE}Dt%3P EDt EE}v}t ExlkMQ@pMLEPj@Ur`r\4MQe[^_U4E}}tExl@pUPV/e[^_ÐUWVS]E{lu SpCp@E1;{8}_uBEt1V=uWCPh-j- EG;{8|Ee[^_ppbUUB f=u =@0tB$z'u<u1 %s: not configured by system firmware pciU,WVS} ]s h,jsV uGPh,>EόECECEu҉UC(EC,EjhxEPWe[^_pci at %s bus %dUE tPhfE,Ephp/,U WVS]} πt${8uS4PS4P /S4BP "{8uS4PS4P$ S4BP$BPjdw{8uS4PS4P  S4BP BPhD{8uS4PS4P$ S4BP$BPjd y8uQ4 1 A4D C~Ɓ]Ɓ\1[^_ÐUWVSfEE@EUZ8uЋP48fȍAfEUB4@8HfMu&EP4:f#UBLEPUB4@:f+EfEEx8u EP47 UB4@7]ED f=xtƍFfEUf9UYC%9uʍ)9~hjEPjGPBPà t4jSED)PWS;jSTÃuUBL)fEUjEPjFPBP`à uUBL%EP48Ef8jS-FfEfEeUz8tŋR4EfB8tfV4>fF4X>ft tF4fX>ftYt Vt V t V-f}VV Eh~8uV4<f F4f@<t WEe[^_ÐU WVS} 5p@ xAp@pAuj5"h+à ËpA5p@֡ AAttYfCp@ xAp@fAp@Ћ AAtGCC CfCCjjhÃu !`5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAt~C t#CKC(C$C,C0CuSgswjWGC CWS ;%<)PCCP~C<C <E]L1e[^_U WVSE8]1X %W4 ]< 8Lw4 KȉRWrMQ(t]4R8a]_4p % D 8b]_4< L4 FD]J%(]]L<ujSVYSPh=P$jjjEPWE f=9t f=tf=`u Ƈ8.f=)tEPURhJƇ8UBGvrUVS] up싓p Bp Bp up싓p Bp Bpj up싓p$Bp$Bpj褋Nye[^ÐU WVS]} up싓p$Bp$BpMIt4 up싓p EBp 2 up싓p$Bp$Bpj̊ up싓p$Bp$Bpj萊 up싓p Bp Bpe[^_ÐU WVS]p@E xAp@U BBfB @p up싓p Bp Bp up싓p Bp BpS9jU PSjU BPSjU BPSjU BPS up싓p$Bp$Bpj  up싓p Bp BpjЈ up싓p$Bp$Bp up싓p$Bp$Bpjd up싓p Bp Bpj( u$pppp up싓p$Bp$Bpj複 up싓p Bp BpjhOy up싓p$Bp$Bpju: upu@ptU f zjچ up싓p Bp Bpj蜆= up싓p$Bp$BpjX up싓p Bp BpjEp@U AAEt/gu1e[^_ÐU WVS]u =p@ xAp@ up @p up싓p Bp BpFF up싓p Bp BpSjPSjFPSvjFPSfjFPSVjFPSFjFPS6 up싓p Bp Bpj茄 up싓p$Bp$BpjP up싓p$Bp$Bp=p@ס AAt8e1e[^_ÐUVSuj]S fCE CSV~Ce[^ÐUWVS}u j]SeUCCf{SRe[^_UWVS1E؃1t NyG~[^_UWVS]11C4EE u1.EAG@EUB5toMtUP t@ @%1&1.t܋@ tӋ@U-Pȃ  AEEtPUuȃ}tJMHw:>EEe tËp tx tUPe[^_US]hjSnh jSf|jSPjS,]Ð%s: autonegotiation not supported %s: invalid autoneg flag: %d %s: autoneg complete, %s: autoneg not complete, link status good (100baseT4) (full-duplex, 100Mbps) (half-duplex, 100Mbps) (full-duplex, 10Mbps) (half-duplex, 10Mbps) no carrier UWVS}] uEW4U@ jWu&tGPhE@# ]t/ t zt_qWh@KLV m(tƇWUfB2ƇƇEf@2ƇSGPhۻ*jW t&tGPhjWtGPhjWÃjW th+jWVƃjWI t"tUB( h=ttE@&!hJa}}E@& hb=@t @tUB#߀hzE@# ރhSWfSjW thWtƇƇUR1e[^_ÐU WVSuF4EjVdž# t$jjh# Sjjj#S׹ t"jjh#P跹dž# t8E@Djjj&S膹jjh& Swdž& @t,E@Djjh&PCdž&f})E@Djjj(Pdž(tjjj Pdž e[^_Ð%s: canceling autoneg session %s: selecting MII, 100Mbps/T4, half-duplex 100Mbps, 10Mbps, full duplex half duplex U WVS}_4tHGPh[ƇƇfC2jWÃ%PjW+GPhjWÀ王u  uh  uh$ uh.߃e } uh7hDSWSjWge[^_ÐUWVSMu 1 ufuG@t6uf틑$fB$fBt4 uf틑fEB2 uf틑fBfBt3 uf틑 fB fB[^_%s: reset never completed! UVS] uf틓̀fB̀fB1j x uff|@f} F~uCPhh/xe[^UEP fu=e0t8w =C0t/=at%fu = tf3@u u1: failed to enable I/O ports : failed to find i/o space : failed map i/o space : couldn't map interrupt : could not establish interrupt at %s : %s address %s %s: no memory for list buffers %s: MII without any phy! U,WVS]C Ep@U xAp@hsMQ<hss ƃjss Ejss E܃jjjVjPV jGPVjGPVjGPVjjVjjVjjV8jjVjVƒUjjV }t*jjVjjV KyJjjVS}ujVGtf _jjVujjVjjV }thjV]Ep@U AAEt.}u1e[^_ÐU WVS]u S@=p@ xAp@FFjSx$EthjSQjjSjPSjFPSjFPSjFPSjFPSjFPSjjSEjjSjjS }thjS=p@ס AAt-1e[^_ÐUVSuj]SS.CE CSVhjVCe[^ÐUWVSu}j]S-CE Cf{SV>hjVRe[^_Ðtl%d: autonegotiation not supported tl%d: invalid autoneg flag: %d tl%d: autoneg complete, tl%d: autoneg not complete, link status good (100baseT4) (full-duplex, 100Mbps) (half-duplex, 100Mbps) (full-duplex, 10Mbps) (half-duplex, 10Mbps) no carrier UWVSu EEU4UjEPÃu(}UPhft{ thjEPhIjURÀPjEPh@KLIU$u ƂhjEPhhIjURÀPjEPOUfB2 EƀƀUfB2Eƀ#VUPh83MjEPjURà t6}tUPhXjEPS!}tUPhqz}thjEPǃjURƃjEPÀ练t2t*UB( }ht,t$E@&!}hz}&} UB& }t]hK@t(@t E@#߀}t-hUB# ރ}thptjjEPjjUR< %PjEP}th UREtƀƀUR)e[^_ÐU WVS}%] ujjCWjjCWe } ujjCWfjjWjjCWjjW:jWƁE Ee}u@}u}uKfƇjW] PjWPjWIfƇjW%PjWQhjWA}uB E %=ujjWjjW}uBe } ujjWWjjWPjWW6e[^_ÐUU2BB2B B2B  1‰11ʃ?ÐU WVS} E@p1ې;PPEPiC~e[^_UWVS11]4EfEEEPEPEPE}~jj(EPjj,EP C5t iEJ}EPSEPE4S  ANj]t CEuVj(EP6Wj,EP'e[^_ÐU WVSuf1ېVC~1ېhLjVC~ƆhjV~hPeBhDjVaV( jVf|e[^_ÐUVSu ù̀ u1ېj0VCv1ېjjVCvhjVZ} t%uhjV8hjV%th jVj3jEV u/,  8@?tʋʁ  t@jjVOhjVcj@jVVj jVIjjVPho0h0hAh@jSFLJULJ ULJ$(BjjjjSWA0 ujjj"SFj"SG j SGV+Vt> jjVGXP_Wh43-e[^_ÐUuÐU WVSU uE1p@E xAp@2i w#1i  i t/i tp"5i 6i(UJ4xu%SXSVC0PS3S UB4t@u,S{@tSSSSma1i uC0PV=C0PV @ǃ4u2S|1"RPVEPFǃUp@U AAEte[^_Ð: can't allocate memory for buffers UVSu2jjS uh4}zSPR% V1ۃ PVf^Cvdždžy1e[^Ð%s: cannot allocate mbuf cluster UWVSEEUtME􋒸UEMMEEB@Uu ǂMAEu1UF ]V % Љ6Gt>~U:!p@ xAp@pAuj5"hƃ ƋpAp@ӡ AAtetYfFp@ xAp@fAp@Ћ AAt+FN NfFFjjL"ƃp@ xAp@=DAujj DAV t!+4A @ |AF DAp@ӡ AAtF t#FNF(F$F,F0FuV '1uBEPh5:EP&UBT M0vEpjPO0UBF FMAEFV % ЉAURf&u EMU@MfA EP<9sЋUfBfM,50Ef@2UB(tMQPE}UJ5e[^_ÐUWVSE4MBUUuE@|fbUBfE;5p@ xAp@pAuj5"h pA5p@֡ AAt=tcf@p@ xAp@fAp@Ћ AAt@P Pf@@jj;5p@ xAp@=DAujjDAB t,4AR )‰ @ |A@ DA5p@֡ AAt?B t-BH@(@$@,@0@uP#u)EPh5};EfUB|{@ ߁% ‹EPfWUu0w]_ _UBXt WP0CG GGWEPV.2UBxEf@e[^_U WVSuKIB7"t f؃t tf}wffde[^_ DPE APE PTAPMA%s: PCI fatal error occured (%s%s%s%s) U WVS]E,u00.0pEtЋ0p tWS tC,u000ut0C|t*SNCeutC0PtmK=tF=PtL=PtQ=PtV=PCPh\=zS: StC|tm=v0"@,tދ0SS2SQufCbEe[^_Ð%s: device timeout %d packets, reinitialization seems we can continue normaly U WVS}5p@ xAp@CPh?ySO t&GTh?^yS S h?;yt Wn5p@֡ AAte[^_ÐUVSE@4u108CqV;uQuIQ87,t0@8S1P08'F;A(s),t؋0@8Q61e[^U WVSEu @4tG{W;uЃuV,G;C(sS6C0FC,FFFe[^_ÐUU$t u Bt BtR$%s: failed to init rings UWVS]{05p@ xAp@G4@SS CPh~Bv5p@֡ AAt~E %e0„ EU %e0 E0@0D0H0(0  0,0E %e E,0U %e E,0A@,0AD,0AHSSS),0@,0@  G4t @$fG4fg4St tSo6[0uW\5p@֡ AAt71e[^_ÐUS],u0 10@ ,u0 0@ h,u0 10@ ,u00@Iyԋ]ÐUE@et,u0` 0H`ÐUMt3,u00,u0p0BpÐUMfyd,u0P0@P,u0T0@T,u0X0@X,u0\0@\ÐUE,u! t00 t%s: can't stop Rx DMA %s: can't stop Tx DMA %s: can't stop TX DMA UWVS},tk0a1ې,u0 0@%=tjC~,u00a떐0@uGPhHp,u0 0@uGPh,HpWWN ,u0|0@u0 0@iEeUEe UtEUf*E85p@ xAp@pAuj5"hà ËpA5p@֡ AAtmtmfCp@ xAp@fAp@Ћ AAt3CS SfCC&0$jj@Ã<C <E@<C CW0SPsC UBS % ЋUBE@UfB C<9s‹EfPf,+0$1ې,u0 0@ujC~ƒ,u 0 0@uGPhCHm We[^_ÐUVS]5p@ xAp@fCb,u010@,u0 1 0@ S,u0 0@ h,u0 0@ S&cd5p@֡ AAte[^ÐU WVS1]4Uf@@t PNy1]tUff@@t PNye[^_Ð%s: WARNING! rx_desc is misbound or misaligned %s: WARNING! tx_desc is misbound or misaligned %s: WARNING! frag_list is misbound or misaligned UWVSEǀǀǀǀ1U4fFu ߁% ‰W G uG %=vEPhM{j5p@ xAp@pAuj5"h pA5p@֡ AAttcf@p@ xAp@fAp@Ћ AAt@P Pf@@jj ;5p@ xAp@=DAujjDAB t,4AR )‰ @ |A@ DA5p@֡ AAtB t-BH@(@$@,@0@uPuEP'@ ߁% ‰WGfu1UtfFE ߁% ‰S C uC %=vEPhÍe[^UVS]M u,tn0 ΃p01,u00u&0@0tjF~,u(04% ΋00덐0@4e[^U WVSuM }],u04 0Z4,u ϋ000 σz01ې,u00u'0R0tj$C~e[^_Uuu u}ÐUuuu u)lgghPjP@ & 4JPJ.0US]U`Vs#S f;uA9u`Vr1[Uuu1 ne_pci_attach: impossible: can't find I/O base : can't map I/O space : can't subregion i/o space : couldn't map interrupt : couldn't establish interrupt at %s: %s U,WVS}G E܃WƃuhV;bhV]EPEPjwURWA thVaEPjuuS thVaEPjjuS th WaE EU EjwEP7 PjwUR:8E ǀ ~t0EPEPEPU RFЋFU FEEEF U EPG1PG0Pw,EP9 th&W`uURU:ÃE PE PhjPS jFPSjFPSjFPSjFPSjFPS0u,$틓,$ ,B$ B$j0u,$틓,$%,B$%B$jQ0u,$틓,$%,B$%B$=p@ס AAt11e[^_ÐUVSuj]SE CECSV Ce[^ÐUWVS}uj]SøE CECfsSWe[^_ÐUEPdÐUWVS1E؃1t NyG~?[^_ÐUWVS]EE{4E0u2,-,6,8;,pG5titƋ,p0tË,@80,@<,81&,<1.t܋,@80tӋ,@<,Pȃ  EAEEtxu˃}tIG,U 0t,@ ,U4fG2e[^_Ð%s: initialization failed: no memory for rx buffers U WVS]{45p@ xAp@SSfǃ: 0t,@0u,,<txtE 0u,,,@낐0u,̀X,̀G0u,@0,@0u , ,0u,틓,%,B%B1ɐ0u,@,D@A~ɃS7ue[^_ÐUE@4t Rn1ÐUVSEu PFFe[^UWVSu E8p@U xAp@EPVW4UREPÃ~Up@&2i w$1i  i t0i td5i 6i(EH4UxuWuEPUR1< WWUB4t W@@t W1i1i uEPUR\EPURhÃ4u3WQ1ۃ#VPEPURoÃEp@U AAEtI؍e[^_%s: watchdog timeout UVSuFTCPh.S.SSH t Ve[^UWVS]C4Ef@2Sh~N0u,틓,%,B%B0u,1 ,@0u,1 ,@0u, 1 ,@ E?U:tPE8ENyӃhDP覑E?U:tPGE8ENyӃh@DPNUfb4e[^_ÐUucwbbiosno bios: configuration mode %d (%s)UExu'=AtP5?h+U=?t Ðpci_make_tag: mode not configuredpci_make_tag: bad requestUVSU Eu?ttGh& ~h>&  L ~h>q&f   щȍe[^Ðpci_decompose_tag: mode not configuredUVSU M]u?tt5h%t %t t.$tt f te[^Ðpci_conf_read: mode not configuredUVSu ]?tt/h܏&% މ 12  ù ؍e[^Ðpci_conf_write: mode not configuredUVSu ]?tt/hf$ މ E 1*  ڋE e[^U?u{At u"uK  uu?9 =u1u? ?1Ðpci_intr_map: bad interrupt pin %d pci_intr_map: no mapping for pin %c pci_intr_map: bad interrupt line %d pci_intr_map: changed line 2 to line 9 USEU]tp~Phܑ&[tu@Ph&9~Rh\&#uh& 1]Ðpci_intr_string: bogus handle 0x%xirq %dUE t uPh\!Phh@&@Ðpci_intr_establish: bogus handle 0x%xUE t uPhܓ'!uuuujPjǜÐUu jpci_map_int: failed to map interrupt pci_map_int: interrupting at %s UVS]jf8t8PhftPh ftPh]>>> probing for %s* %s%d: irq %d already in use >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s%d >>> probing for %s%d succeeded >>> probing for %s%d failed UWVSu d^ UB88B< Nj2:NtUtuPMQh@6tUBUumrluj2NtUu1}t}tMQh@UUBMEmsrhuj2rNtUt-}t}tWMQh~@UmMEUBˆs}tJ Nj2NtUtuPURh U1e[^_US]jS uǃhǃ1]Ðbtattach: bt_find of %s failedUVS] uSV tCPh F|C@CHtP5A S+S ǃǃ$f ǃ 0?ǃ@?fǃCPSh jjsDvrC< jhPSe[^Ð%s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping U WVS}d{u@1Ґ{u"T9u\B~GPh@C C C RWXƃuGPh6C}2t u du5PGPh"Vh8VWx CT9u \{?de[^_ÐUVSuN@QÄ|1J t-EfEfEjjEPjVQVt Vwe[^ÐUE ǀdÐU WVS}] 5p@ lAp@SWPtPT PTPu Pp5p@֡ AAt\e[^_ÐUVSu] hlSl] ߁% ‰\|h X SVe[^%s: can't malloc ccb btccbU WVSu=p@ lAp@t6PtTTTTPxKjjhlfÃuFPhFSV'E u%jhjPId=p@ס AAt[؍e[^_ÐUM |UhXt9\uUMU ǂPTPQIÐUM\HT9uQ\~ztՉ\ÐUWVS}G@E`"~CW~.EfEfEjjEPjWEP/PtTT TTP ߁% ˆVVVdtFFUB`@u2h `"Mb)RSh8:T9uw\`e[^_Ð%s: exiting ccb not allocated! should call debugger here (bt742a.c)%s: host_stat %x %s: target_stat %x U WVSE `du!EPh]h{,U zt)Bu C,PEPh%VM yt_At t!+{4u (C,9C,.PEPh7C, C(E PURMKSe[^_bt_find: illegal bus type %c bt_find: illegal drq setting %x bt_find: illegal irq setting %x UWVS} Ep|jduh{uKtP<0uh_uj]SyWEEEPjSjWV EEt.~MuAt}FtPhX?ڐfE@fEE]EPjSjWVFC <@thtE UEPjRjWV0E t) tt4@t=t &)1$ PhjEt7 t t#I t3 t$:@t+1 = 5 - %PhtE$Ãw@WDOHSEf8t89tx]f8Eft9tNUf@QA@1e[^_3.31parityno paritysyncasync%s: %s, %s %s targ %d: sync, offset %d, period %dnsec ULWVSE@@EċuSPr-EʏfEʀfEʃjjEPjURMQ E EURjPjEPURE EuEPjVjMQEP E\tURktfR}Whq]1ۃUΊD3 C~MyS2~!ĚEERjPjQEPF 1ېD3 },€upt!D+΍PPSWh C~1ۉUDcƄcC~U\M\\dǁE؁E % ЈEEEE݃jjEPjQURpe[^_542B: model BT-%s, firmware %s U,WVS]C@ECSEEUEPjRjSEPECSCT.ECUEu}WjVjSEP@CVSWE <2 <3u.}2v(EWjVjSEPFCWSX J;Uv B< tt}2EEUEPjRjSEP]ECLECMECNECOSP KLJ9v B< ttEBEBKLJ9v B< ttCLCPCSPCLPhe[^_ÐUEx<~@<P.b%s: bt_scsi_cmd, more than %d dma segs U,WVSE@ EP UE@EPR ƃuUB,E`UBhEt F*Uz$BFPFPr 6UB$NVHUEEE@ E ߁E% VL1 BBB}tN%E)ȋ]9vÉ)EE%E}t ߁;MtBBBBE}t+} ]j!EPh`E %e EVFBBBEVFBBB&FF@@@FF@@@fUBFBFV( % ЍV$F$BBBF FFFF F @@@p@ lAp@VEPp@ӡ AAtMUu1ohEPUR^tJVhEPUR8 t$VE@,VURe[^_U WVS}]w@t9V} WE @t1hkKuɸe[^_timed out AGAIN U WVS]`@ x Pgh$r 5p@ lAp@dth.F9h63`@,ǃhdSW 5p@֡ AAtKe[^_U WVS]sEPjj s|V[ t18uV4ǃj uVh`tǃhǃ e[^_%s: could not map I/O-ports U WVSu ]{EPjj s|Wb[ tFPh^~@EFDhzFPVhtjj8Ps^F<$Ve[^_aha(aha probe)%s: aha_cmd, host not idle(0x%x) %s: aha_cmd, cmd/data port full %s: aha_cmd, cmd/data port empty %d %s: aha_cmd, host not finished(0x%x) UWVSE }UUE tEE N} uE}t> Nj22hNtUtuPMQh(*tUBUumrduj2gNtUu)}tMQhh@UUBMEmsrduj2rgNtUt)}tWMQh@UoMEUBˆs}tJ Nj2gNtUtuPURh U1e[^_UÐUS]1ҋ @9}C|9QAt4B9|jjS uǃhǃ1]isapnpahaattach: aha_find of %s failedU WVSE] UU@ @pCtP5AVSEP tCPhhNUB|C@CHtuP5ApSS3 ǃǃfǃ?ǃ?fǃCPShjjsDEpPYC< jhPS e[^_Ð%s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping U WVS}Wd;u:1ɀ;uB|9uZ@A~GPhKSA A RW ƃuGPh(e }+tu uEPGPhh,VhPjhVaVW0WdB|9uZ@;8e[^_ÐUVSuN@QÄ|1J t-EfEfEjjEPjVQVt Vse[^ÐUE ǀÐU WVS}u p@E lAp@tPjhVA`땐jjhKÃtZSVMEPPhSF]u2KCAQRҍKCAQ!CC@@CC@@C€SMQ$ЈCQ$ЈCC CCC C C @@5p@ lAp@SEPc$0GjhjSq@t⃻t>UtPw$w OPw$w ZOSMQW荽 5p@֡ AA025p@֡ AAt2Eu1dWURYtBSWMQ6 tSG,SEPe[^_ÐU WVS}]w@t9V} W_E @t1hPKuɸe[^_timed out AGAIN U WVS]5p@ lAp@PjhS)N@ x Phth9h@,ǃSW 5p@֡ AAtf0e[^_UWVS]1hPV/1S\`Pjjs|RS@0CdhRjjS|RP!@ uOE @tt@V=9ǃtǃǃhjhdnDj`\UD8[^_ %s: couldn't map registers %s: can't allocate memory for command queueU WVS]u }h\WVlGFtGFpPjjw|R>0u#FxPjjG|Pvt> tFPh^FlF|FpFEP^`Shd/jj8PwA ft5N0v@FDFHFLVV0V0F @tV0F4^\F\F EEVHt LJ j uS@e[^_ %s: can't map i/o space %s: can't subregion i/o space NE1000NE2000NE2000 (RTL8019)%s: where did the card go?! %s: %s Ethernet %s: couldn't establish interrupt handler UWVSu EXh 1EEEEPjj Ur|S ;0tFPhEPjjuS@ tFPhX UEt t&tuU Q^Sh[tEPEPEPV׃džuuujVCSVhHU tIM bǁ ǁhǁǁǁ ǁǁ(ǁdUhlA @A4  E \tt}uUU EX}tEڀʀP}uU u E@ t}t/EX7}uU EXtUQjhl?U R jjjM QLtE Ph@XOE uM E t-uM Bj<E \t)}uUU mUB B_U  t(}uUU 8UB B+Mf8uEPE PhlOI] SU RhЍBu4uD9\uǃǃh E}tjuV"}tjuVm"}th uWS"Ee[^_ %s: can't map nic i/o space %s: can't map asic i/o space %s: can't map shared memory 168%s: 3Com 3c503 Ethernet (%s-bit) %s: configuration failed %s: wildcarded IRQ is not allowed %s: invalid IRQ %d, must be 3, 4, 5, or 9 %s: memory test failed %s: can't establish interrupt UWVS] h\EpxEPjjUr|V0tCPh^çnEPjjUB|PV tCPh{臧2EPjh E\W CPhGUUUUU!#TU'U+E EEǃ1ɐ A~1E@j2)#E@h(E@1ɐuUU9A~̅E@U!UTUuTUu,ETtǃU!FǃtP{Wh-tU!ƃ` HtIbǃǃ ǃǃlǃǃǃdǃl j$jh?S7tWh芤5toC @tfǃt fǃtfǃfǃ  fdp\U`UBcfǃtfǃ fǃ&  fdptUtUBU8@ wW$Dtx|p| x@tpWhJU8PWhD+U=U =U =U =U =tEHtE@ tE@ tE@ tE@ StWho莢<ǃ@@ǃptǃtǃptǃtǃtǃh#ǃ #ǃǃsVh*pS2 ftP5A|VSh#jj8PwWpe[^_UVS1۾j jjj4@D #P C~԰ !!!!h 栰(桰桰桰桰h栰 栍e[^ÐNo-maskable interrupt, may be parity error UhD-j;1; stopped loggingstray interrupt %d%s UVS],? q4w-v-RSh-jʇe[^ÐU WVS1E1ۋ >At BËR uMy1Ґ1EMtEE}~hAB~ċtApA Ћ lA xAxA |A ӉtApAhAAE1M㋖ >AtB hAR u@E}~1EU< >AtE}~=~ У\"\"!\"[^_U1intr_alloc: bogus typeU WVSu }uhc/赅}1Ƀwftas\p@tJ t B: E1HE;u#1ۋ >AtC@ ut9]~ω]A~t E81e[^_ÐUE Uw7t2t.p@ }t t t1Ð%s: isa_intr_establish: can't malloc handler info %s: intr_establish: bogus irq or type U WVS} u=0"PjjÃuE Ph0w tuE Ph0m1p@ tt " 4 ;4 t t1d >A >At p @ uE|?l?EECCC EC{E C؍e[^_intr_disestablish: bogus irqintr_disestablish: handler not registeredUSU Bwu h2輂 >A >AH @ t9ut @ hD2jR >Au ǃp@]Ðisaattach: ISA bus already seen!U=QAt h3 QAUWVS] SEPuuuE PEPfǃ 3FEE=,FAvEt  @;FvMFEEPjEPkÃu >EPSE^tEtPE PVEPJǃt#~tjvfVEPe[^_U WVS}] st SWjVSWe[^_ÐU WVS} wFAEPw wEPEP u%EPEPEPEPWEPp(FAuEPEPWEPOÃukEFEFEPEPEPv WEPà tGu WEP EPEPEPEPWEPÉ؍e[^_Ð_isa_bus_dmamap_load_mbuf: not implementedUh5m_isa_bus_dmamap_load_uio: not implementedUh5-_isa_bus_dmamap_load_raw: not implementedUh$6~U WVS}u ^tFu VW#VW!e[^_ÐUE U@t r4u/t*pp pStppp :U,FA=vRju$u uuuuu u:Uuu uÐUuuuuu uÐUuu uÐUuuuuu uÐUWVSMUˋEE]E E1tB EiaE@9sSSEPsw̅t"9t EE9E}t1ׅ}uׁ9r1e[^_U WVSE XUSURSRp{Wp hsEP<ƃ u$URC PssWEPxƃ t#sWURCCC Ae[^_Ð../../../../arch/i386/isa/isa_machdep.c%s:%d -- Already 0! UVSuE XAuhch$9hL9CHAss VsCPVsCC#e[^ÐU WVS}UAp@EPӃ؃Pu1t Ph@tPE PVFЃ t1jSjE PuuVF Ѓ tuVF1:1ۋU;Z}'1ɉTU D CU;Z|ۋEG@e[^_ÐU WVS}Ap@_tSVFЃSVFGe[^_ÐUUA@@Rx t jRP@ UUA@@Rx t jRP@ clock_batteryROM_cksumconfig_unitmemory_sizefixed_diskinvalid_timeRTC BIOS diagnostic error %b UE$pqthL;Ph;}ÐUS4C`"4}@4}@[ÐUu'UU pq@u1RoUC@@ ‰ÐU WVS]ƃxF4@BÉș=`"Dž~%9~ )))))΅[^_ÐUÐU4C@@ HuT¹)Ѻ Й CAÐUVS1Éփh@B91) jh@BRP}LhCA@H"$$hCAB<uR<u0?f hCA?A??AQ ZR4PBhCAx} #hCA8u @Gx}@H"$$hCAğ?f hCAȟ?A̟?П?hCA8tu @} lhCA@H"$$hCA?f hCA?A??AQ hCAhCA:B|^uTz uKzuEBH"$$hCAPB= up7hCA@H"$QhCAxu!@H"$=hCA7%@H"$=hCAWe[^_U,WVSH"$@S ,?A%;hCA ǁz| {} 5H"$P|UHxM@x?hCAS!uh?EPS5hCAh?EP5hCAS(uVth?VVh?th?VVht?stuH"$MHx$UP|EfECEUCS !tuj&tuSS5hCA St EuOhCA8u%?f?C??h?Sh?h?K{} ^}hCA8t?fx?C|??9hCAx} 4?f?C??CS U MhCAx} hCA8uEğ?fȟ?C̟?П?CS hCA@H"$t?fx?C|??CS EFu?U{} $uG?f?C??CS M hCA@H"$ue[^_ÐUh =ÐUj(ÐU WVSH"$@K,?AEhCAx| {} LH"$x|px@x?hCAPPtS uH"$px$x|h?SS5hCA?F} ШtjO=}Mu{} hCA0hCAfhCABCBR CS uSJSS5hCAS}u]hCA8u3@|Sc= g3Ex8E&uohCA8uEx|x uxtSx} v3xRSS5hCAS}uSS5hCA6y}uSS5hCAXhCA8tu S;{} uA ?f?C??CS hCA@H"$e[^_ÐU VSH"$@Krx,?AhCAx| {} 8{~Y;u\uhCAx: 0hCAx} u.hCA?f hCA?A??,hCAğ?f hCAȟ?A̟?П?AQ hCAwut$tu ;tu:ugSuCu{}W)Pu;tCt>u5hCA)u uthCAPSP{e[^U RA?U RA ?U WVS}H"$p,vEH"$@,EEmeu }u1!H"$E,?4u}t8j4)H"$Ë,?Mƃu9H"$p,vơH"$@,@t}u3H"$p,IuơH"$@,e[^_U WVS1M RAutPdAH"$ RA,?<tW ttku'r,tơH"$@,cdA]r,tH"$@,.r,=tơH"$@, jr75dAe[^_UVS1uL?tt7tnxH"$hCAC,?AIH"$Iȃ{t  7pe$(4@LXdp|ࠔଔดĔДؔ LT\h|!{c"(C,% -([,O%C,7/D18w":5dAFr H"$Bx$K H"$`}AfACAACS 2o3g-H"$@x:"j H"$`}Nj$ B|$@|P5dArrH"$dA )tCH"$e[^U VSMu Qyu(ğ?fȟ?F̟?П?FV f}9tVf}&?f?F??FV wAE]A Cf}PS>}EUfEEj hl?SEP[ UJUEfVEUFV V:51e[^UWVSƅEXxu$ğ?Ufȟ?B̟?П?1ff|1?Uf?B??MAQ f}Ex ƅMAQ EUf}!PEP=}EUEU؃ډEUEuV34MAQ EUPEPz= }EUEUEUMEUBh?REPV8MYMAQ EUP]S=}EU}WSS uVWWfEE jh?V]S_ SSWfEE jhԝ?VEP3 U؋M+UM̉U؉M܋EfEEԉEUM]Sr h?SEPSS:fEuEPhD?WPV;h?URVS th?MQQh? h[^_US]jCP;KC]UMfiftQÐUMfQi) ftQÐUMfQi) ftQU|WVSExEP 4v)GEEh?EPURhD?6EMAE؉U܋EE܃}} E܋EE؉EE܉EEEEP"EEh?EPURMЉMQ;6E Eȃ E]SuVVSE jhL?SEE]SfUUEMQ0}t.ğ?U fȟ?B̟?П?M AQ EEE}t;MAQ ؃ډE؉U܃EPm0h?URMQRV EPH0EEEh?]SURMQh?EPPSp7 h?U RMQS4E P/UM SVSMEEEEE9EvSIMEEf} u Dt=}EE Et+}}SE]U]f}GO߅}ۉ1ftFEt@EEPft'EPtMffGfuۋUJ‰UEM fQEUM AQ Q.x[^_UlWVS}Eh?uVhD?WKE Et h?]SVhD? h?UURSW]EEă | }̰vE PV>EfEMĉMEȋỦEUQ]Sq7uVSSsVjhL?V]ЍEPEEES-h?SSUR5 h?E PSUR1E @U1e[^_UVSuM ]1EE!EUaEUUF!EUUFaEUEtEUu3us[^U\WVS} EPxu+ğ?fȟ?G̟?П?GW %MAEA Ef}!PEP6}EUuVEPP ]SVVfEE jh?SEP^fEEjhԞ?S]S@SSVE)EȋEE̋UJUċEfWEȉGẺG W, h?WMQW*h?WEPW0G |%w  t hŷGe[^_U|WVSEEHxu.ğ?U fȟ?B̟?П?M AQ Tf|:f|] SU8EXP X P2+UJE]CS EUf}!PEPe4}EUEEUUREPPLMMQ]SS8fEE jh?EPuVfEEjh?URMȉMQt]SSEPU؋M+UM̉U؉M܋]K]ԋEfE]UM}W2* h?WURW(h?WMQW/.fEE jh$?]SVVVEPXfEE jh4?SURM)MȋMMfEE]S)UJUċEfEUEȋỦEU]Sq)h?SEPS1( h?SURSh?SShD?% }th?M QWS h?E PSW x[^_U VWSu} ]MT U U1Exk1EEE'UUEgEUUE'EUUEgEU ED EEEEEEtEUyEEF[_^U WVSu]}NE PU 8uWSRV=,PM AV)‰Ѕu,A N )ȅuNE P9u 9s~WSU RV/u(ğ?fȟ?C̟?П?CS jWSVM Q/U ZtuSM QVd=ucu>E 2fFCFV CS   U zu3u~} 赵fFCFV u_t.uE x} uuwfFCFV ]U 8ufFCFV ?S37u1u~} uM fACAQ CS e[^_ÐUWVSu]}VE @E EU RUN)u/M A N )u"FEM Q9ȅu 9UsEU UP t~WSM QV-uD}u} ğ?fȟ?C̟?П?CS WSVE P$-vWSM QV)bWSE PV(Nt}uSU RV軱0}uZuAM 8fFCFV CS  ~}{Zu7}uE x} U fBCM uS}t}u+E x}βulU 8u S趱VfFCFV CS <}u4u~} 耲uM fACAQ CS 3e[^_UVSuhCAKV4u>uE~} ,>uu {}(C<umw8u~} 辱hCA8uLuO:t1'u<wL{?-{t ~u,C@t ~uF@u Dj2hCAx| ~}t hCA:tupiFQ)‰Ѕu)F Q )‰ЅuYV9u 9s~9u$}9ue[^US1ۃhA`t@tjM+1Ft~"tt@EH"$b}$ X|]ÐUS1ۀ=,?At$H"$Eu"H"$`}$H}EjA;P `tQ@t9H"$`}$H}EjaH"$@x\H"$@xGt~"tt@EH"$b}$ X|]ÐUS1ۀ=,?At$H"$Eu"H"$`}$H}EjABP`tV@t=H"$b}$H}E}ujNH"$@x]H"$@xGt~"tt@EH"$b}$ X|]ÐU RAPU RAPthCA@H"$ÐU= RAt ^jntNhCA@H"$$hCA@H"$ÐU RAPU RAPthCA@H"$ÐU= RAuajtXhCA@H"$$hCA@H"$迡UVSuH"$K؃zt ͬ<hCAf hCAFAFV AQ H"$`}[^ÐUhD?qÐUhT?YÐUhd?AÐUht?)ÐUh?ÐUh?ÐUhğ?ÐU RA?UVWSu] }F CuJ~ 跪 { 衪 G8 VC)ƒW ~t{uWSV菨W\~u&{t{tk{b5 +S{u~tW2P`k{u~ug~^ O{ FGFGFGF G 8 u8ue[_^GU WVSdASXUƃCPJUǃSlU5A=A࣬Af=A} AAA%Au8A Au A| j*AK=uAA?A=u=Au AO| jޥA7A%AA|j諥hAe[^_ÐUVSdACP"TƃSTà } AA%=~9uuA?AA?A=uAu= Ağ?fAȟ?࣬A̟?П?ࣰAA Apj覤AA  Ɖ5A AhA,AA  Ɖ5A Ae[^ÐUS5dARÃ} AAuA Ağ?fAȟ?࣬A̟?П?ࣰAA A%}=j蛣AAAAhAm~CuA?ANA?AAA%AAAA]ÐUSdASQES{Q‰U M u2ğ?fAȟ?࣬A̟?П?ࣰAAWuv A]U]AEUAAA?AhA]ÐU5dAPu1ğ?fAȟ?࣬A̟?П?ࣰAAH~ A AAAAAhAU5dAdPu0ğ?fAȟ?࣬A̟?П?ࣰAAJ~ A AAAAAhAoÐUWVSdAE11EEEPOÈƃ؃ƃMyE PO A u7ğ?fAȟ?࣬A̟?П?ࣰAA A,5A=AA?AhAre[^_ÐUWVSdAEhCAZ?,?A~&j輟H"$@xs~{j艟hCAfEJMBR EU=@MEP t& PCH"$@xu11ۋMujH"$@xt11hCA8Jr <u111x<u1ɾf<uJr S<u0jA芞H"$@xC1ɾjZQEPMVEPM PEPMe[^_ÐU,WVSdAE,?AhCAfEBEEBR EUEE== j襝E2EPƒtV}u%}uhCA@tR`+RLH"$@xu1]u}1ɡH"$@x% =t; tC=t17 ‰ у}t }uс}tKE=v0EuEE@E=?J@EEEM U ց}~%jH"$@xu3E% <u 11<u 1۾<u@hCAH P  ց uj薛/@<uC]ULWVS EPUPUljU܉UUԉU؉ỦUЉUȡH"$E^?Ff~#jWl>jEP^>/f{f~QfENMFV EU=@MEPuW>uUR>jW=jEP= 1vW=v U<u jW=jEP=1r<u$jW=hURt=H<u$vW\=v EPM=!<uvW4=v UR%= À>t̀PEP_=E E E E E E E E E E}菚e[^_U WVS}u ]2EOVuuSVW`OJu ~| u} 觏ğ?fȟ?C̟?П?tuSVW菍u/t4u~} Du_fGCGW @uFuS6u} ufFCFV CS Ee[^_US]S C x$u t31k ʃ)KS C{@}"{~[CCS [S袎[ސUS]S C xu tlj1k ʃ)KS CUVWS}G _U MM"??΁Ft t7 thtt?uS?tL u&^r)u u ut*%1? %1? t5 tctt?uN?tGف u#فr&u ut$?rف t|?m t. tMtt ?u8 u=?t- u2rut?sG t??=?t%=?t%@9GG _[_^P蓋XP躋X?QOك@sK sO 1YO 1 ˉډ1Yy@uO1  ȉ11YUG11Y?G`?,=?tb u t41ۃo ȃ)O?Pj$XXP賊XPjXXGW_PjXXUVWSu} ~ 螊  舊 ~N+O} ^F f_G }VW1f s ?f@s t t1"ډ1fAs t 11^F ssG[_^UVWSu] }F= Ɖ C= 诉 {uJK V F90?r),?1(?10?tG,?(?F?F ?1 ?$?FV 0?;S rw;Cr0?+CS ??K s,?c )??,?c) ???t,?CS ) ??? ?;S rw;Cr+CS ? ?,?u(?c ) ??(?c)$? ??t'CS )$? ??(?,? ?$?;S r1w;Cr*+CS  ?$?(?,?u s0? $? ? t$r+KS spu0?tG,?(?O‹(?,?^UVWSu} F= ] SG= F <11ۋFg4?8?Fg 8?ӋF g8?ӃF g ыFG}Gu%4?8?O4?8? tUVWSu} ~ 袆  茆 N+OG _}VW1҃ s T@s t t18ډ10fAs t us t 111)щʋNىˋN ȩuS u< u+uo@@GGGG 8؉Ӻo ȃ)OvG _G~[_^W[UVM u sSV1V[^Ã@s VF^Ã`s@F1҉V^1F^UVSM u@sW r2 V1 éf F[^ËV1V[^Ã`s0@F1 éf 1҉V[^1 ^1ۉ^[^UVWSuF N1҃~uڣL? P?T?@u֋ L?ƉƉƉ P?)ȋ L?sЃЃ؉u1HljƸD?D?@?SE;SE =SES S SU}tE C~M}tCjdS}uSSE }tE CjdS}u SCuu*}6ECCt}u}uSuƇuƇ }CƇ }C }uSCu}|| tNp>fp8tE@xt Jp@ tAp@U}}0Fp tEp@U AAEt3뵐ƇE Up@U AAEuI3kNqjh"hFPV[à tJFptB€Vpu u W`Ep@U AAEt2Ruf| FpsUp@U AAEt2FhVUR "Ѝe[^_ÐUWVSU?C4EUs8Fp uUOFhu V$"Ѓ=p@ tAp@Fqt2$}tUB`"PC t e[^USE 1?u6p@ tAp@jp@ӡ AAt]ÐUSME XP$@(1[ÐUVS1۾%[AjVSCvQfAhVh%[A}, Cvލe[^U WVS+?,?xHAAEt }}B P &t f t P #GG?? u1 f  P ~7W‹<^AP PW5p@ tAp@ t$  P?? t  P?5p@֡ AAt? u, f t6 P ?CAPRk1e[^_waitvtUWVSM ]uV<(SAv  ?@NjP> "?$ @jP11UA, F~#(?@MUHPqMpt(?9=p@ tAp@5(?F<^AjhQ9 h,^AP5Ã(?9ut=p@ס AAz=p@ tAp@1(?9tBF<^AjhQ9 h,^APF5Ã(?9tt=p@ס AAtdSE2PUB0u =AKQ)?<t<"Mt t\ ƒ t;=?ujj(?P[@jP   t;=?ujj(?P@~jPFnSMQhKEPe UEM.|*9 +;=?u S }tJUɅ`"Mb)R4P`"}PhU2t ƉuSEPh KMQhSEPhK@EPÅuLMʃ4tU2MQFE0e[^_OMOmOnOsOvOyOpOrOuOxOqOtOwOC[6~[5~OBOA[4~[1~OD[3~[2~ ?/.,MmNnBbVvCcXxZz>< "':; Ll Kk JjHhGgFfDdSsAa|\}]{[PpOoIiUuYyTtRrEeWwQq +=_-)0(9*8&7^6%5$4#3@2!1~`dfUE=3?t 4? Ppcvt: kbd led cmd timeout pcvt: kbd led data timeout pcvt: kbd led cmd not ack'd (resp %#x %#x) U WVS5p@ tAp@?     ;?tz?h-t hC JǃS t hC )ou=u?PWhC u5p@֡ AAte[^_pcvt: kbd tpm cmd timeout pcvt: kbd tpm data timeout pcvt: kbd tpm cmd not ack'd (resp %#x %#x) UVSp@ tAp@E?ht hD F_ƃ5?t hE 7u=tPVhLE sp@ӡ AAte[^ÐUSddthQKuIEEEEEEEEEEEEEd1]ÐUSddthKuIEEEEEEEEEEEEE`1]ÐUSduhYKuGEEEEEEEEEEEE`]U}u#?%?$?"?Ðpcvt: timeout controller write cmd pcvt: timeout writing kbd init cmd pcvt: kbd reset cmd timeout pcvt: response != ack pcvt: got KEYB_R_RESEND pcvt: no kbd detected pcvt: timeout for loop pcvt: response != OK pcvt: kbd SCANSET cmd timeout pcvt: kbd SCANSET data timeout pcvt: kbd set to XT mode pcvt: timeout for kbd ID cmd pcvt: kbdid (resp 2 = %d) pcvt: kbdid (resp 1 = %d) U WVS11j`thG 1pjEth H pdt I󐐐h'duڋ5p@ tAp@hh0H }uhMH o=u}uhdH woC~6h}H ao/?5p@֡ AA-htuhH oN=O11C6=t"}t vhH nj @uKhnt hH %jRt hH h I gn5p@֡ AAt>p@ tAp@hth&I n/?O=ulC==}5At0Tt+5=u-p@ӡ AAvl/?DPhDI m/?'=tu /?Ph_I nmp@ӡ AAtEe[^_ÐUjO0?ÐU0?Ðpcvt_kbd: malloc of Ovl_tbl failedUS}u =С?=С?u-jjh(@uhL h1۹?@f@f@8@'@D@@7@&@DHIy1f?IyС?]ÐU WVS}] G~v (f;)?fC?ujCP?CjCPh~C C)?ujCP?ҵCjCPh~C 蹵C)?ujC'P?莵C&jC'Ph~C uC&)?ujC8P?JC7jC8Ph~C 1C71e[^_ÐUWVM} )?0v /f}D045@ WQR1e^_OQOROSOP US]FhL@؃PcN@fN@}Hft f  =ġ??ơ??ġ?fơ?N@$P S S S $S S S XP S XP Q XP S S R \S 1(A=%?t7="?t@ @(A@(A@=#?u?="?u? tP)?u (Ab@W?N)?u (As@/?&)?u (AQ@?tҋ(Azv? B<`8?f )f CPPy  P HPht%?  f JRI?  P?f )f f9tHPP?( u f P[]ÐUWVS?(  " B9t Q?$ f9 s$ f9 w.PR R?$ f  ?$ f9  " C9u" f ? AEؙ}Ɖ }" fEfQf]f‰Nf" f9vRUBf9UR" Bh QUؙ}Ɖ Й} fAff f9sVRf9vPRR?( u f Re[^_U WVS?(  ( ?  f)f9v)" f)f9v)f9sBf$ f f$ f ?( t?( @t?( }`"}Phwe[^_ÐU?( t$( ?" P P0?( ?( ÐUWVS1fE ?QZQ)ffU 4Z" JM9wxEEJ~jϋAA< tWfUG?+RU}ыUJ9uU }Gf};uw ׋MI9|׋ A [^_ÐUWSA=$RAtE߰эAftJ?@PhPPC4"ЃfOu `"}Phǽe[_UVS]u =9?t4tk t wtgn}F$)Ɖt tQtt&EF9:-s.!"t t[^ÐUugU WVSE~1P4(SA= ?t;5?u2?=9?t38?} uFfE AfMq]f;Ef^~#t~$fv~%rfhf]=$؀ X ः ̃ ̃ ̃ P d x ഄ Ȅ ܄   ( ༐ ~"^ `"}Ph}9 F- fN ȈF VFH9 fF FF|0]t VtBV ^Й1ɅtNSFF VBPF B)P t fFf)F FfFfF Vr fFf)F F^ K 7 F5F5F5V[ V: V; FD0] Vw: Ɔ F5 $4 x ༐ Ȋ ഌ P ༐ X l ~,ti~6tcF8F-u[fF FF,Vt3FPFF VBPV PF)RP~Vt,VF@)RF DBPF BP~Gf_wSu"^ ׋}f |PfkVF5V3} fNfMYG3 ǃ368Vi=Gfw GfNwV9ƆnǃЃ>]$h 8 8 8 8 8 8 8 8 8 8 ༐ l ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ऌ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ d ༐ ༐ ༐ t ༐ V3V4V<VIV;Jǃ߃Z$̌ ऎ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ 8 8 8 8 8 8 8 8 8 8 ༐ l ༐ ༐ ༐ ༎ ̎ ܎ ༐ ༐ ༐ ༐  , < ༐ ༐ L ༐ ༐ \ l ༐ ༐ ༐ | ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ༐ ଏ ༏ ̏ ༐ ༐ ܏  ༐ ༐ ༐  ( ༐ 4 ༐ ༐ @ L ༐ ༐ ЉÈW@ ;F5/V=F5 F5 Vs+V+V+V,Vw-V;,wV,gV;WVG=GV>7V>'V>V>V8V,V3V2V>V#3V'} ~f}V;9vV &jV3^V4RV8FV8:VP[>VǃptqtAVOE VEF5&fpuV-} uFfEF5V NЙN~,tVFH9}F,EM;5?u2?e[^_Ðvt_coldinit: impossible equipmentU WVS ?`Ajj 0t$ 0h #D"xHAfǀZxHAf8Zt#D"xHA?Af?At+)?-?=Au#{*?)?-?=Au#{[D"xHA?)?A'D"xHA?)?A-?=AtfAfx?&fA=)?u f?f?fA'?1(SAxHAFFF fFfF AfFF"F#F$F%F,F0F4F5F6F7F8F+F)F*fFF&F'F(Ɔ( uA=)?u(? ?Q숆 ?B"ƆƆUAUAƆƆƆƆƆCdžH?džH?dž?dž?džH?dž?ƆƆƆdžFPƆ Ɔ Ɔ Ɔ Ɔ ƆV?V) ? ?Q?@ f^ N1NFE1uV:F)r>^F)P)ӃVPRFÍBPn(^Ff)^ VF*F )…~!RF BPA PmƆ fdž fdž fdž dž dž dž dž G, 21ۿA3ǃA)?t2~<u7? ?QD3 ?BD3D3 ]D3M D3 D3ǃAOyA? ?BUA? ?BUA=0?u se[^_Ðpcvt: scrollback memory malloc failed pcvt: copy memory malloc failed pcvt: screen memory malloc failed, NSCREEN=%d, nscr=%d U WVS= ?t)?t~t.EfCf)C 4?tPY4?3?C S)K9| fCf)C ]ÐUSMYt; ?t14AQ 9uAPSACPRjBQ ]ÐUVS]u VS$~u 1CS*P3A PhSC5CCfC C8C&C)C'ȈC(C$ƃCS;St_fC)fSfCfCPu fǀ fǀ CfǀCxxtjjpx迷CAPS S e[^ÐUU1Ƅ@ ~ƂUVSuE ]҃=fVwl=uVuw/=pVw=tVz=sVh=dV w=gtXK=oV!8=gVw+=hV0w=eV,tW=nV=rV w=qV=iV0SG)?<S;)?<S&)?<lSfkVSPVS>A=)?+VS $=)?VS 3SSPu%jPBЍ(SAP=u&hBЍ(SAPku{vfw fCAfdvfCAd fCACAP5?$.?x*u!=`A`A 1e[^pcvtUE  P@@ ÐUE@L @@ @4@@@0ÐUWVSuu (?'?H9~}1ۊ )?A<w=SSSA|-?9|B1A$uF| 9~1ɀ=,?u uF| 9~ 1S(SA::(?9u&? ?B? ?B[^_ÐU WVS}|-?E9|JU EUAGG $ @D=)?uG]~]G=~D uD$HD =)?u<uؙ#"tؙ*n#at tU/t%ؙ8ؙÃ',!ؙ1' A(SA1SSA9EuEPW, , KyՃjj(?P=e[^_ÐUVS]|-?9| B1ACD$ƃs D CAC[^ÐUSE| -?9| Y1ۋP|с~ 1ɋP| ~ 1҃ PRQS. ]ÐUSM] )?AA-?A'?A Y(?AS(SAD+AA,?A$*?A(+?A,A [ÐU WVSUBu]  ÃS5p@ tAp@CES<<^AtjjEPhv U RQ 5p@֡ AAtz(?9uExux tpSSAAUBEx t @ YAUBw=zuP5?2&PE %P(SAR e[^_ÐUVS]u 1 -?919ARS`A SC5C&C8C$ StAfCfS {PufCfǀSfC)fC)C'ȈC(CtxxtjjpxCAPSWSj B9(e[^Ðpcvt: scrollback memory malloc failed U WVS]=p@ Ap@AtjP腅jjCS)E PAuhĤ {d1ɾA0SAǁ4SA(SAfDC)E HfD, NyȃC)SPs3m^CHC =p@ס AAtwe[^_pcvt: copybuffer memory malloc failed UVSU5p@ Ap@BXB);,AvPAtjPTjjSAuh [,A,A5p@֡ AAt"we[^ÐUVSu] =w1 @S%[AF&[AF'[AF [^ÐU WVS}] 7wXvES UʊG%[AG&[AG '[A(?9ujU %[APV e[^_ÐUEM }tB$?A$?A$?$?$?A$?AU? =.?=8?t 8? =9?=2? ?xHA)‰9̵?t5̵?? ?B̵?? ?B̵?A ̵?9е?t5е???Bе???Bе?ÐU WVSu] A^+S@N)AԵ?}ut9}}VG)9|)~1FPRFÍBPZ(^Ff)^ ;}}bE)VPFNjBPA PY3;M}-E)VPFȋHPA PjYEF*V)V(F)H9~ȈF(F&V((ˆЍX^'N V9~ffFfV e[^_ÐUWVSEE)?<}-?9]UA<2p19}81ɐ<1t&A;AuD28DuD2 8D G9|̃}(_-?E9}AA<2t(MA;AuD18D2u D1 8D2 t1C;]|Ċ?փ}t2 ?ƉA*EϐEdǀA? t UրֹA? ?BA?A ?QD3 =Au=)?uQD3$[^_ÐU.?BBBB BBBU.?BBBB BBBÐUBBBB BB=AtB .?ÐUVSBBù B[^ÐUVSBBù߈B[^ÐUMxHA)?ttvv 1==At ? t $? ?ÐUWVSu}VlÃE Eá? ttt tu c119}ECAJuCB~X?<3ujjh y33t]j SoWSEP3Ue[^_ÐU WVSu]Vǃu]X?tO? t#tt tu{h WX?Se[^_ÐUVS? ?SE ?B? ?C8t SE1FM߰ sȉ C8t SE1 SE[^ÐUWVS}u EFHMyEE1һE"D:MM1BK~eE}~EE1һE":MMDBK~eE}~[^_ÐUVSu] FCFCF C22D B ~[^ÐUS]M ACACACA CA C A C A DB~[US]M 1Ҋ B ~[ÐUUM BABABABABABAB AÐU=At2=`Au z?gz?ÐUVSup@ Ap@=P6PAP7PBPDPHPLPPPTPXCP\PP@ÐUUz8uqB8B9BB:BBfBBAB6BBB7BDBHBLBPBTBXB\CB@BÐUS]1ɀu _2)?<"C+AH|R8Iy8)?<C+A|:uuhH?SqƒЃ*$               H                        C5 $`           ่?w?kȺ?_?SH?GȽ?;ƒЃ**$                                        C5 wi$           H?&H??ȷ???QS][?62;1;2;6;7;8;9cUU?B0B4RUWVSufF F1]V  AEf P^ CtDك Dك!fF FGF)V9|fF FF[^_UU ?B0B4RUu[[?13n[?21n[?27;1nU WVSuj$| ?F0F4@@@[FP ~gfff0@FHgfff))0 ;C;;CFP ~gfff0;CFHgfff))0 ;C;RC;~0È^4??F0F4VK?F0F4V3e[^_ÐUVS]C:C&:C( S(C)9~fCf)C CC&8CuVSQ eKC(S)ЍV)QS QCƍBPC AP8CPC BPA Pn7e[^ÐU WVS} WG)9~փWG@)RG DBPG BP8W  A f P_ CtDك Dك!we[^_ÐUVS]C:C&:C( S(C)9~fCf)C CC&8CuVSu oKC(S)ЍV)QC APS QCƍBP6CPC()@S‹BPA P5e[^ÐUVSu VF)9~ӃrYVF@)RF BPF DBP_6F BVTPF)A fse[^ÐUM A)H9~ƒRQ3 ÐUM A)H9~ƒRQ7 ÐUS]KC)9~ʃRC BPA Pn4]ÐUÐUVSu] $   ( l 09~;tAw{tn|tMhK@ 2C$S ƃC$SS ƃ/t;H9+Ј+ƃFK$  < < < < < < < < < < ` ` ` ` ` ` *t)J)t*t)&)N*t7)ƃ*)@=+))ƃ*Sƃƃ\{SmFw</,//< /:FЃN/,/ //ƃ/t t 6;t-ƃƃ0S0t3F?w131@1mF?w2;2@2:\u SJC$C5ƃƃC$C5ƃe[^ÐUWVS]EtSƃ+<wM+xE<u ,)ֈEE4 S3RN1BA9} )9|Ƅ‹E}t ASe[^_ÐUU1ƄƄ@~ƂÐU,WVSuF+A<Uߊt <~v~tVvƆ]S3P}߉A$ tEt< tt"0EPS.EPSEPSGEPSEPjPW[V&e[^_ÐU WVSuVM=uF# tF%e[^_ÐUEu ƀCƀCÐUM1ҍDBvUMt/ t ktCaAQ)PA BPA@PQ PA)RQk!APQ PA)RQHÐUMt3 t Vt7LAQ)Q )PA P A @P1QAQ)P1QscrlckU WVSu~&uzF':F)ur?9u:F*uc=)?tZ9u  t~=xHAV)+U Nҍ:9vRWFE CPK,>KM K@VF'+E RF&V‹APF&E VAP+FE PF(+E @V‹BPA P* t't=H"tjh] j2 Pe[^_ÐU WVS]{&C':C)?9u:C*u{=)?tr9u  t{=xHAKU ҍ:39s=C)+E QSC)E ЍWRV*CS)GG)։3ASC'+E RC&E S‹ APC&SAP*CE PC&S‹BPA Pl) t't=H"tjh] j2 P虚e[^_ÐUUM  B5 $ L       9u9u9u9u^9u9u.9u9uUS]tGK09t?{4t9CPhPPC04"ЊC4ʈS4K09t<uʋ]ÐUEƀ)ƀ*ƀ+ÐU VSE@+A<t<U1ېu3C~VjPEP<C^~e[^UUƂ/Ƃ0Ƃ1Ƃ21Ƅ;Ƅ3@~U WVS} E+0E5E0UDكu  fEE9E|[^_fdcUWVSu^1EPjjv|SOQ uEPjjF|PS0Q t!1UU%tE@jd_t׋E@juS|;huSjuSdždžh juS&UjuSUe[^_Ðfdcattach: couldn't map I/O ports U,WVSu }_EPjjw|SP uEPjjG|PSO th '^@EFDEFHFLFxFpFpFth rVURVh jj8PwRF<0~ujjgÃEEE|EPSEP0EEjh( EPVEPUЃ~e[^_ drive %dU} uE0h 1fdcresult: overrun UWVSE@@EEpDE1}uVF$VS\ Vh F{e[^_%s: drive %d: unknown device type 0x%x UE Ut%0tOt@tYH tAPt @t2`t )?2?*L?"??PRuh E1ÐUWVSuFD%8?EEH ؅} NT|Vșu F@PURMQ#jEPURjMQEPPURMQ@x(PEPURdžMAxF0P`"PVh SzE}t džURU؉ؙ}؉щME)ȉE܋};EvE܉Eܸ};EvE܉}tG<MA,UhE䉆EEE)ىM_0jSjGHPUrL5A" }tMA,U}jMMQEPt}UB|E PMQEPF4@w@F@7edAtX'mt4wmdn =Fgd\f?5hV&h@,(P&H F(@F8@F0F,@ F4jh tPؗfF jh P輗P$V= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt U,WVS] E@EUB C %s: couldn't map interrupt (%d) %s: couldn't establish interrupt at %s %s UWVS] }7G Es0C4EPjhG PVX t hD!萤EC8SPVthk!kS ǃfǃ?ǃ?fǃGƿH!u!]ƿP!u !CƿX!u !'ƿ`!1t !u!Rh!EPsC,2BPEPh^!ǣC, C(C CPE PMQS迒e[^_ÐUVSMU p@ lAp@BDB0tr0p4 B0B4z0u Pap@ӡ AAte[^%s: can't malloc ecb ahbecbU WVSu=p@ lAp@t*S0t C4B4 C4S4C0{jjhÃtIhS? %ځ ЉC<|NHS8= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt at %s %s: interrupting at %s U,WVS] uEV UFCF!f\V3t11Cs@M 1881<f<CsEAs9E|EE xtt@1Ct@M 11fCtEAt9E|[^_ÐUWVSEPUjP1EuthE@EFu F*ÐVS[u^jVZu] _uuuEe[^_ÐULWVSM u}U!tLUHto>'#V]SE0*jS@PB@OV]SKxPjSPPB@_uP‹EBpqUb0u#j VU P'BU@?1jV`P B@o Euu / tg  $tk_tFAs@A8AsffF fSV'>#At@AAtffCVC$ЈCQr)Ѝ\xArCFV ЉCFV ЉC FCFCQr)Ѝ\xArCF ЉCC CFCmQu)ЍXAuCVF ‰SVF ‰S FV ЉCVFQv)ЍAvCVF F F ‰SVF F F ‰S V F  F  F ‰SVF F F dQv)ЍAvCVF F F ‰SS CVF F F ‰S1e[^_Ð%s: card %d violates PnP spec; byte %d %s: Maximum tag size exceeded, card %d %s: No current device for tag, card %d Too many tag errorsResource timeout%s: %s, card %d U,WVSuDžDžDžhPojjhhPJ1VK~8tFH~8uVP VHFPËU :\0Yt2t-u W@PFPh0R!eDžtPGxV~8tFH~8uVPVHVH8FPÄVo~8tƋFH~8uVP VH0FPV-~8tЋFH~8uVPFPff 1Ӊ9}[V~8tFH~8uVP VHFPG;|fv-E @PFPhpR!f@D"B@rBPh{!L=^{!B PB PB PBPBPBPBPQh|{!=0EԨuTD"<:_32_u/B r  suB=A9rh{!<@t1E{!EF EFEUjh~!EPWpEԨu+E{!EF EFEjh~!EPW;e[^_ pciinfo %pUSA;C؉C$}!~!\~!h~!t~!~!~!C AH"yQ QAQ  AQ yuYC @NC @BC QA6C APh}!B;{vC?s [;h{! ;]%s at %s function 0x%xUUE trP2h~!:ÐUWVSE@=@t:1Mu/ډU=wh5 #uƃu1WEjjjjhV0#UP躢 jjjWVh@ rԋEM fAUMEAQe[^_ÐU}u1ÐU}u1ÐUÐUÐUÐUÐUÐUÐU WVSUM }u]t:uCH"t}t.t mtWe5 #ft%0AtArAu (j PSVWV5QASVW-e[^_ÐUS]@t4 t&%=u9Yt9u܃t1[apmpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateNo pending eventsNo APM presentunknown error code?UE+tjtStVtcitT tw t` tc=tm`t^t=tekt!f!^!VЁ!N!F0!>p!6!.!&!!!"!1!apm0: APM %s: %s (%d) US]E @PPPSh'!n5h@B!D?]ÐUÐUjj"jjFUjjjjUVS]u !=QAu =$?At=AC$?A @QA(AA)щM5EPjAPSw 肝EPjF@Pvw i UF9u N))ЉEjjjjv R0#0P|jjjjvu0#8P]jjjjvu0#@P> 2@t jjj=E Pj]SkSjh S uSU R Sh!jjh!j E P~M Qu"E P@?ADžD"8$PIRƅ1@9} B9|yPCPWCPCP]Sh! tSha!"BfvtSh}!fytSh!AjjBPu‰t>AVAPRȃ P!fGy0AB $PB PBPSh!0y t$Sjjq KSh![ h!!K!=t>A0A jjh}t>Au EP]hAh0AP]SptQ؃Ph0!j5t>A肋t>A0A1DShӛ!1050AEPhp!j}WGt>A[^_pcibios_get_statusUWVSAfO.r0E߉ΉUh!EPEPua}PCI uSEUEME]E U E ۉE8E$01e[^_pcibios_get_intr_routingUWVSM EfUfM}G% % GEPjQ1۾AfN.r0ރhQ!PMQuEfU Ef01e[^_pcibios0service not presentfunction not supportedbad vendor IDdevice not foundbad register numberset failedbuffer too small%s: %s - unknown return code 0x%x %s: %s - %s USEM] !tPt[tAt7qt8ftD t2Pt8t8>1S!=1!5H!-V!%g!{!! SQRh! PQRhӡ!7؋]%s: PCI Exclusive IRQs: %dUSf=AtKEPh!1ۃAsSh!C~݃h!!]ÐUWVS1;}  WEPEE9EjEPWEPÃjSEPƒ ffPPƃj SEPE | tFt EE1;u}IVEPWEPaÃjSEPƒ ftftSEPEЃF;u|EE9E"G;} e[^_Æ4!q!.!p!$!EX!E !!90!US]P!yt#f;uQ9u yu1[ÐUUAt 9t @u1ÐUWVS] ۋU Mt|?t:EPV5$SAЃu5|?URu5$SA@Ѓujjj…u1z12M MDfB =|?tEBEB rB At9}BABAJAЍe[^_ÐUWVS=t>Au731ɋ50A9}%1ې;;EuB;E tӃA9|1[^_UVSu1ɻt1tA@҃~E [^ÐUSM] t"1t  @҃~1[Ðpciintr_link_init: no PIR table UWVS=t>AuhЦ!AAAEE;0A}qE]t>A11Dt3PjuWSyL3P f9t!fP G~EEE;0A|1e[^_ÐUVS1At;{u+EPC PVuECC[u1ue[^ÐUVS1AtNKt  1EPC PƒuECCM ֋[uAt4{u$CPf#C PtC[u1e[^Ðpciintr_link_route: route of PIRQ 0x%02x -> IRQ %d failed U WVSu1fA{uKtl`|?ss5$SA@Ѓu|?js5$SA@Ѓtssh!" Kf [xe[^_ÐU WVS}1۾u|?jS5$SA@ЃC~1e[^_ÐUhL!5SAu1UWVSEPEPEPE PEPjE PEP}ju V FUE}uEvuEU EtFUM1[^_l!!! !!US]uSuu umt  !1]ÐUU MBvBv @1ÐU WVSU] }Cv 6ރVr r0)} 1e[^_ÐU WVS} uGww r DSEp p‰)! VSEp pY1e[^_!(!x!!! U WVSu]}uWSu V t &t!jDSV PjDSV1e[^_ÐUU JvE1ÐUVSE] uv +jTp p !u1e[^ÐU WVSu} w}}wwUsjjTv vSǃ]SE PVhU !!U ƒ RjTv vSE PV-uU9Ut 1e[^_ÐUWVS}u EE1ېEPSW9uu:jTw w‹!EsEEC~EPVWhu}tMU; te[^_ÐUWVSu} 1ۃEPSV9}u>jTv v!}uPjTv voC~EPWVuEPWVuE9Et1e[^_Vadem VG469Vadem VG468Cirrus PD672XCirrus PD6710Intel 82365SL rev 2Intel 82365SL rev 1Intel 82365SL rev 0UnknownpcicUEt=t0u%=u1UVS]jjSCЃjSC % =u2jSC u t jSC =t  =t%=t 1jjSCЃjj7SCЃj:SC  @Pj:SCЃjSC t.~j:SC %Pj:SCЉe[^Ð%s controller %d: <%s> has sockets A and B A only B only UWVSu1ۉdždž!dž\Q @w-"Q @w.Q tu B@v41?Q tuBttސh6!kSQu@Ћ]pcmcia at %s controller 0 socket 0 controller 0 socket 1 controller 1 socket 0 controller 1 socket 1USEU XtRh!NC@t+ tS=t)=t2@h !Ah ! 1h7!!hN!h6!S]ÐUWVSEEEÃ1EtSEìǬNyՃ}e[^_ÐUWVS}5p@ tAp@EEE8t SVìEMyՃ`"`"PGdP茺5p@֡ AAtLe[^_ÐU WVS]jSC п!ǃt^jSC о !ƃ u{ t jSC *{ uSjS^ƒS e[^_Ðpcic_queue_event: can't allocate eventUS]jjjLVuh!:E Ap@ Ap@p@ҡ AAtmK􍃤P]Ðpcic_attach_card: already attachedUS]Cth!ZK]ÐUUBt$Bu US]@(t P5jjSCЃjjSCЋ]ÐUVS] 3}tFxtOFdP۸AS PSu`"`"PFdPȷe[^ÐUWVSE0E Em } Mx1Ҹ )9wE#^H9uUEP} WEPv4v0_uHڋNLM!FHF0MEAEAE A Qy1EB +E9ve[^_ÐUEU R PHÐUWVSU MD4Ee1ۃt}uE(E %P)?EP‹BЃMu P?EP‹BЃ],M %P?EP‹BЃM P?EP‹BЃ]0 %P?MQAЃ?}u @P?EP‹BЃjMQA  ?PjEP‹BЍe[^_Ðpcic_chip_mem_map memt is bogusU WVSu1ɋF$u 1 F$AwV$rϸ ‰V$ubE 8U9C0t h!MYE%U)EUT\1(T1,E)؉D10E D14WV1e[^_Ðpcic_chip_mem_unmap: window out of rangeUVSu] v h!$jVF Љ)ً?!ƒRjVFи!F$e[^ÐUWVSEU E0F8Et"UEPjMQREP\VFXt}Ef;NP9sCЉVT9v9r2);Er)EPEPjjEPEPRQUR X0t f;uf;u@7EEPEPjjMQEPFTFPPvPURWt"EMEAEAUQ EA1e[^_ÐUSE HP @tRQSZRQSY]U WVSu vEe]|UP4@?MQAЃUDPD?MQAЃ}U:H%PH?MQAЃU:H%PL?MQAЃj]SC ЋT?!‹M X?RjSCЃjSC  P?RjSCЍe[^_pcic_chip_io_map iot is bogusU WVSuEx}U1ɋFxu 1 FxAwVxr˸ ‰VxuJEMU9B8th![|0|U0U 0SV41e[^_Ðpcic_chip_io_unmap: window out of rangeUVSu] v h!HjVF ЍۋP?!ƒRjVFи!Fxe[^ÐUVSu1ېjVF Ѓ uh%aC'~Սe[^ÐUVS]jjSCЃh` {uj/SC %Pj/SCЃ jPjSCЃh`hjSCЃjjSCЃj `j@jSCЃh Nh`S jjSCЃƃjSC %u PjSC1C$t VSF~1Cxt VSF~e[^ÐUEjjP@Ѓh_ÐUME tytQAyuQBQA琐A@ÐUSME ]tyu QA QAtyu QBAX[UWVSu^V|yEPjjRSOP \hu džh@EPjh\vP t U 1tEuUBU@(E@Ptt֋E@uUBU$E@PtGtڋEuUBU$E@PvtGtڋEuUBE@PFtGjuSShuvStdž1e[^_: can't map i/o space : can't map mem space %s: irq %d, %s: no irq, polling enabled UWVSu ]CE{CEEPjs|WJN th&! EPjh\EPN th=!\FLh HFHEF@FD?~8EFW+0jVà tYh !V'F`uAFPh!huEPN uv".UB8u$UBu hO"7u:h["(~UrPhn"UrPh"гVh"迳1Et>th"蛳]4h"G<uăh"cUPPVh"EE E U2EEPh"EPB $""("8"H"T"`"l"x""""""h"h"h"h"wh&"kh4"_h?"ShM"Gh|";h"/h"#h"h" Rh" Urr h"EX3U2EPh"˱Ct thE"hQ" hZ"蓱C4Phl"聱{ tVshz"h1;{ }<sS1HP"<t"P41h"+G;{ |ƃ{8tnh"1;{8}W1CD4"<t"RK@S<HP"<t"P4h"躰 G;{8|CTtPh"虰h"艰Cth"sCth"]Cth"GCth"1Cth"C th"C@th "{}h"ٯCth"ïCth("譯Cth3"藯Cth="聯h"q[XURU&EftPEPh\")e[^_ÐUWVSE EUw*w;,!w =MyAh tXjPR؅u]Chǀ Ch $CClE@Uzy]Khzu׋W WWUB BR]Kh}uW WWUB BRA111ɐ}uG WWUB BRЁ}GhuGhD0qCAA=~UzuMqhZu׋W WWUB BRȅu]S SS}G GW fEphUZuыQ QQ}G GWȅuEP PPUB BR fMy]CltxtCl}luojjjdqUBljdPMQlAl@Al@AlXXAl@Ah$AlAhyl$EHlUzuӋS SS}G GWAEHxuP PPUB BRЉЃ@EЃ<@EEE9HMyluyjjjdO]CljdPSlCl@Cl@ClxxCl@Ch$ClChSl$Cl@]Kl}uW WWUB BRAMAl@ 1;us[][l][ }uG WWUB BR ؋MA F;ur]Cl@1;ust]d}l}GEUzuB }WWUB dBR EMAdCF;ur}?}]{drExexuP PPUB BREu܁e܀@?u؋MAd;0tXjjj\"E}wdE@XUBl@MBlMXHE؋}t-zd(EuEuUEPd}MyuQ QQ]C CSE}G$G} G@tMI t]Kt}OEpUzuB M]SS}G EGWEuԃeuЃeũeuȃe`uąE9ME@EuUB ]}WWUB EBRE1ېs?}u}W UWWUB EBRE|C~E9M^}tgMyuA ]QQ}G EGWEtEtEtE}UE9PZxuA QQ]C ECSE}G$ωG t G@tEH UJ@}uG MWW]C ECSEA}G vUBhfE9EDžh0 t~w t.0h\M]{uC }SSUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSUB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSUB EBR ȋM] Ew @t4 #h\MExu‹B ]}WWUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSUB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSUB EBR ȋM] E}hD8hEU;W E]C CC}"E}9Gr uG MWW]C ECSE}G%?G} @G@tMI t]K}_uG MWW}G EGWȅuUB ]}WWUB EBR ȋMfA4E]fC4}u E}9GF } UB8_uG MWW}G EGWȅuUB ]}WWUB EBR MAtPPC]u74>C ]uSM9u}t E$E$$E}*T1e[^_Ð: unexpected I/O space configuration : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d%s: can't match ethernet vendor code no irq U,WVSu EEEEUBBXtlC u{ t"hx4"?u:CC u/MQB H0Pj j sB p4AЃ t[Xuuh4"虃 RjjQPU th4"MSEp衸Ur th4"bdžPSjjjMqԻ th5"Ђ PSjjjEp蜻 th-5"蘂jhI5"{EE}* U?ÐMQf=t?f; uf=tf;D tMGt[?tRPUB Zu6?MA YuEP?M9tE}tCEx|"EPUrVEt.EPVE$$E}* }+uFPhX5">8}t2MAU8uA8BuA8BtE t닆 u "TzB H0EPEPVjhjB p4AЃ t=CPh?"z}UU슃1UU7}tҋMU }tʋMUD 1B H0uB p4A ЃB H0VB p4AЉe[^_UVS]1?f9u!Df9CuS?9u  Fv1[^: can't alloc i/o space : function enable failed : can't map i/o space port 0x%lx/%d: unable to detect chip! : couldn't establish interrupt U WVSu ExL_tY{8uG{ uAE8Wu{t0EPB H04Pj ssB p4AЃ t[Xuuh@"w4F@8FDSW@W蟭 th@"wHP4P@jjEp~ th@"zw@<h A"[wvDv@՗ uhA"9wIVhtjEp%Puh4A"whTA"vVژe[^_MODEM XJ2288MEGAHERTZUWVSEE@xtW1ҋHtIA=t"w =t)*=t=uIXuu WE111F)?tMA4R)Nt΃tEt1e[^_%s: UVS]U 5p@ tAp@ttNq膫CPhC"u Shj蓯hC"|u$(z 5p@֡ AAt-1e[^: can't allocate i/o space : function enable failed : can't map i/o space port 0x%lx/%d, couldn't establish interruptU WVSu 1UBUBXtE{ u7EPB H0Pjs1uCPB p4AЃ t+[Xuu룐uhD"t F4SUrXV thD"sdžPPjC tPEp聬 thD"}sphD"_sF|džxG"džC<u5Ƈu"E(S(SE+t؊UtԈKtԊECuSS KtCuSESZSUtCZuSESSUtK}u}ZtƇLJ$<P$P0jjv th>P"gXǃ<h\P"f ~!0tP,hkP"fKlSp$Ct(CxK|K0C4s`s\C\Cƃ 5@D蘞DjSƃ=p@ס AAte[^_wiUUBxuf:Vt1: function enable failed : can't alloc i/o space : can't map io space : address %sWaveLAN/IEEE nodeIBSS%s: couldn't establish interrupt U,WVS} E@E@EU艗PRMQb thkW"EUB P0tSj@j@jMA p4BЃ thW"EPSj@jjEP t0hW"21fK4fNELJtxtfB2tf@4W fEfEEPWj jSEP譪SPhW"I`w0,jGDPWUR聪0fF4džp"džz"džH~"FDdž2j 0SjShW"(j PSjShW"j pSjShW"fLJfLJfLJ$fLJ"+ fLJ&fLJ  fLJ(fLJ,fLJ.dfEfE]SW$ Ef*fEOfESW EjTPVV jjVGXPrWh|~" Wh8]"jMq讘pt!hX"^WwWj"yEPhW"k^}~#UB P0MA p4BЃ}~$UB P0tPMA p4BЃ}~ EP'e[^_ÐUVS]s0B H0B p4AЃB H0tSB p4AЃVV1e[^%s:UVS]M S05p@ pAp@t t_CPhJ\"5] Sh8]"j#phX" ]S?fB2B4@t S p蔘 5p@֡ AAt1e[^U WVS]C0E@4ult?f@4tf@2121f鐋4f뾐21ft狃f@2uN0fI4pfF4f^4fzp0tf@4pߐt$SKtf@4t(PS;tf@4"f4f4f4f4 f2 f@"sf@4; uPSC}&SEf@4t,PS+f@4 tf@4 f@2 Et Pe[^_Ð%s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) U\WVS}0Eu  f U@ EjDEPjEPUR E{5p@ xAp@pAuj5"hà ËpA5p@֡ AAtetYfCp@ xAp@fAp@Ћ AAt+CC CfCCjjLÃ5p@ xAp@=DAujjDAS t!+4A @ |AC DA5p@֡ AAt耻C t#CKC(C$C,C0Cs{Ef= tf=@t f=`E=~#EPEPEPhd`"WC CjVEPGjFPEP5jF PEP#C PCPjDUREP0PEPvEPEPEPhd`"V&S SPsj.UREP1 tSGL-GHG(t SPjSSVW e[^_ÐUE0f@2f`4E t@T@PÐUVSu^0`"+`"PP]'C5uhjVe[^ÐUWVS]C0Euf PjEPjPS!f}unUfwe1H9}=אu8f @8f=vAH9|Nj84<UBXe[^_ÐUWVSMu ]fXf01u0f @0ǃt[u'f$4ȉf"@t׋f@4tFFot+1,fMf"<[^_%s: init failed US]jjStCPhf"}Su21ff@2u4f f@4fEfEfEEPS]U WVS]u FPj!Suoj8jFPSu\u 8f @89~ru8f @8F9tAffV~1)u8f @8fOAH9|1e[^_ÐU WVS]u j8jFPSt+8f,8Ff3tӋfB8tˋFfB8~1,u8OfOfB8AH9|̓FPh!Su1e[^_%s: invalid data path: %x U WVSM] }E6t 8tD8PAPhh"Pf$f*tۋftӋf<1ېufut C~́t1<e[^_ÐU WVSu]j8uu VtB1ɉ-u8f @8UfJA)9|1e[^_ÐU WVS]}j6EPU RS}t:&64f6xVf1ɉ9u6EUJUfUJfB6A)9|wf@64sf@6xVj6EPE PS%u 6f @6f=4u6f @6f=xV1e[^_Ð%s: failed to allocate %d bytes on NIC U WVS]} Wj SAtWCPhk"M 1ɐu0f @0u A~сu!<4ft苃f@4u"f @"ЋEj6jRS+t=1ɉ(u61f f@6A)9|1e[^_ÐU|WVSE]0jduV輱fEfE1C5t'VEPjdEP膱WUޅts}jWSĖEt#st}jCPS%t‹UR@fEEPEPx[^_U WVS}u W0F= a=b$=o===T==/== O= Mu=ty=\=9=">R0`"jBDP^SOjPSFfFf&Ff Ff"Ff$Ff(Ff*j 0j Pj pS3jSFP茔 PFf,@Ff.0F!FjDPV:We[^_ÐU,WVSu H"p@ xAp@E8t+p@ AAteURVG0PUR|Ã~p@2i w(1i  i tDi Ki ttw}i -|i UJ4Uxu&WEPRU WEPB=E9P<P<EP4%@f=@u7u.fDžfDžfDžPW_@f@u8t/fDžfDžfDžPWW@t W UB411i uPURPURÃ4WR1ۃhVEpnÃbf=u(jTPPDfDž+kf=uN2PB0tjDV蕫-jDVPVW~hEpV{2PB0ÃhVEpfÃu^f=tLf=u"PPW Ã,VWÃuVWp@ AAt胩؍[^_Ð%s: tx buffer allocation failed %s: mgmt. buffer allocation failed UWVS]C0Džp@ xAp@A4@t SSfEfE fEEPS`fEfE(fEEPS9fEfEfEEPSfEfEփ"fE؃EPSfEfE΄&fEЃEPSfEfE$fEȃEPSfEfE ,fEEPSvfEfE .fEEPSOp ǰփj&EP!fufE IfM эAPEP R<QSPǰփj&dP苧fdfDžfIfhэAPjPR蚌QSfDž\fDž^*f`\PS0ǰփj&4P趦f4fDž6If8эAP:PRŋQSEfEfEjuEPP莋VS fDž,fDž. f0,PSfDž$fDž&f($PSfǃ#fǃPS|@5t8fDžfDžfDž 72 ffDžfDžfDž PSS'j PS7Vh:StCPhdt"? Vh:StCPht"?f@2 p@ AAtHA4 @fA4Shc"V`"+`"PV[^_%s: xmit failed U\WVSE8@5FUu ǂFEjDUURr EVUR ff=t'ff=tff=5tff݆jEPEPjEP]SjjEPURXjEPSIFfEfE fEfEFffEUB fESFPjVjDEPjURW$FPSjDEPAFfE荟SvjVjDURjEPW$FPSj.URW~ UB(t VPVEPh W5 tGPhz"?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzUEP #  %cU WVSuEà t(t9 ttwtG t gt^h"9E}th"9NM똃}th"s9NMuu }G;} }h"D9LSh".9}F0e[^_UE@@#Eg@@ܺ@ vT2ÐU WVS}uW?‰W9sGG@)9rFSE PDP GPW E PW@C?9r11ۃ)VE PDPe[^_UWVS}] jCPuVC?7w 8x)ƒRh?S jVS tjSW[jXjSre[^_ÐU\WVSEpxP Uj@u EEP!#E Uxj!! UċEVEE ]U!ڋE! Uȍ:p $}#U! U̍2ν!#E UЍ|!! UԋE*ƇGEE ]U!ڋE! U؍:F0}#U! U܍2F!#E Uؘi!! UEDEE ]U!ڋE! U荼:[}#U! U썴2\!#E U"k!! UEqEE ]U!ڋEEUE! U:Cy}#Uщ! U2!I#E!} EEčb%!! E؋U@@UE ]U!! U썼:QZ^&}!ډ#E U2Ƕ#UE! Uԍ]/!! UESDEE ]U!! U:}!ډ#E UЍ2#UE! U䍜!!! UE7ÉEE ]U!! U̍: }!ډ#E U2ZE#UE! U!! UȋEEE ]U!! U܍:og}!ډ#E U2L*13EEԍB911EUqUE ]E11E썼8"am}3E1E0 813EEčD꾤11EЋUKUE ]E11E܍8`K}3E1E荴0p13EE~(11EU'UE ]E11E̍80}3E1E؍013EE䍜911EUUE ]E11E8|}3E1Eȍ0eVE 1ED") 1E܋U*CUE ] E1E8#} 3EEԍ09E 1EY[e 1E̋U UE ] E1E荼8}} 3EEč0]E 1EO~o 1EU,UE ] E1E؍8C} 3EE0NE 1EЍ~S 1EU5:UE ] E1Eȍ8*} 3EE䍴0ӆEpxUP j@jEP/e[^_ÐUVSu] M19s 2B9r[^ÐUS]M U19s @9r[UWVSu} EU11Ӊȉ[^_UEPEURPEU RPf EUUjEURPEU RP< UVS]u UM9rw 9r9v 1[^UWVSEU M])Ή)9vIω[^_USM] ډ[UVSEU ىˉ؅tHƉ؉[^U,WVSEU |EUE؃ډEUE]u} ۃހu}uuSEPEUhSEPwщ‹E9ErE})E}+})9s)؀uEƉӉ΃}t)EUEU}t؃ڍe[^_ÐUWVSEU %uu 19r)E)E)9s)uщ }tӉ)‰9vI)Ӊ‰9sLӉ‰9sL9sAMUEU[^_UWVSEU M]}ƉރEƉE}ʉڃـuʉكEPQRWVXEU}t؃ڍe[^_UWVSuEU EUv#?wFU1EE't!U )] ‰UmEU[^_UWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_UWVSu} EU Ӊȉ[^_U WVSEU M]}ƉރEƉE}ȉ؃ڀuȉڃjRPWV}t؃ڍe[^_UVS]u UM9| 9r9v 1[^UWVSuEU EUv#}?w FUU}'t!U )] ‰U}EU[^_UWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_UWVSu} EU!!Ӊȉ[^_UWVSM] EU4 9sAω[^_UWVS}u ]uN)‰AGF8t.B<w`v zw B<w @vZw 8utKu1[^_D$fD$ffD$fD$ffW|$L$ D$uA_W|$L$ D$tA_L$tVWt$|$T$18uIu_^UVSuUt$M ACuJtCJuJu[^USM] Uu)C)‰EC8EuA}tJu1[W|$1эA_L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuXD$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_WS|$ D$L$W~$ĉ Љڃ)ӉكX[_D$t@1WV|$ t$1L$u L$t@^_WV|$ t$L$uL$u1^_ù))GV)^_W|$D$ L$t uG_Ð1_UUE 9vUUE 9sUUE 9vUUE 9sUUE 9~UUE 9}UUE 9~UUE 9}UU|WVS]u UM u1 ?1MԉM؃}Ur9wu9v}tMq11}EEЍE܉Ẻ]ԉufEEfGEfGEfGufwUԉM؋UEfPE؋MfAEfAufqEfM}u{EXG1fEG ‰1fEG ‰1G ‰1}t E@UE ‰U؉ ‰UEUfzjEM)MfuMftuuUExEUfBMy+EM̍ AMEu^w Eہv}~,EPEEPW!UREHPEЃP EMIfMʋuvfuȉ}}}E@Mqf;Uu E3 ]ʉ1EĉӐUUĉ 9vMEÁv1ۋMM~@u4NuUMuNU))؉ËEf؃EM}ɋU)؉ft@M1ۋMM~+E4HUMQfM}݋MfUċuEfpEEEEM9M}t|}tHMMu9~2EGMDG)ˉ ‹ufwME9EЋUfWEU ЉEEU ЉEԋEԋU؋MQEU ЉEEU ЉEԋEԋU؍x[^_UWVS}u1;] }#_D_) f_C;] |_f_[^_UE EEEuEPu.UU EBEEuEPud'(TfX @`04@ p@     P @ @` @ @ }tpkf`ZVQLF;4    AK&#"! 789:;*+-.JFDG,W/0XIRSTU'(HV EBO # #"," # #"," !#$!#","8!#P!#","d!#|!#","!#!#","!#!#","!#"#",""#,"#","@"#X"#",""#"#"N" -#-#""!T.#l.#""!X3#p3#""!??"l"$?0?"l"$??"L"??"".f?"""4,f?|"""4Ho?`o?""4to?"""4to?"""4?"""7o?"""4l?""":o?o?""4 ?$?""48?P?""4d?|?""4ȕ??""4? ?""4 ?"""48?"""4?"""4?ถ?""4̖?"""4t?"""7??""4h??""4?ଗ?"".??""AP?h?""AP?h?4""A|?H"P""A̘??""A̘??4""A?T?l""A?T?""A?"""A?"""A?"ܣ""A(?X?""A(?X?""At??0""A?"""A?"""I?"""A?"""I?""":ԙ?"""A?च?""AX??h""AX??L""AX??""Aؠ??""A ?8?Ģ""A ?8?""KP?"""Ah??"".??""I?"""I?,?""AT?T?"":??"":??"":?""":@?X?"":p??"":??"".?(?""L`?L?""L??""A??ؤ""A??""A??""4t?`?"x"M?H"""7?T?""7??""7??""7PvATD4  h!!jjh2Xj j eYN`` |h@h>` |h@ h>>J`@xN@`MpN`j]Nj\S jjS]R1R T V P >t |> ePXe @ee>Xbx eep@  e exx 4 @ i j yjj6lQjIj]jjIj]j&n7 72    2 2 2 jVyeXfxf f2 @fh6lxeXfePfeHf f2 VyeXf f2 fe@j"jR.q xe@PQ`j\Zp(j4\eTAj4\eTAjj26lJie.A x ny7nj"eA@j> |n yj\jd4\ *y j4\4\lFi6^i6i6i6Lyj]jeYR>a jj]e,AjeXe@j\ 6Ryj4\j4\TijjzeYe @j\eXfd d2 [d( dldy rydxa 2 ddpi6le.AyjzDj\eA@jzj\jrXeBj\jz4\jj4\eTA6iCji j yj &j*i2 jj j &e]Qj"jrXj"jh6le\=dzdrdsd sd\sj"eA" y hj"j& j0jjzjl 110jj\e(Bjjyjj@=j5jeV\j 6i 6l1jj\0e\p08jj\88j5ji1i0jjj8Bb @z5Bz5ji5&  Fj Nj Hz5B\jj j j8p8zrb8jedJ38(d 91 jjz njj1j9j\jj j &e]jp]zY0e\j9r:t (j z (z5&  jeZR1R T V 8P 6y6l.y je.AeAeZj"eAjߓ& j&zzzzzjד& jj eV\ j10eJj1j&5j&21eC1jj\j j e\=j&j& k {kǓ& 8keAeV\D eA=4eHcjkn"{aj"jV*{W.{Wejk@ee L{e e\=Tc# e\=TcLCeLcejC@je e\=s@j4jheAdj\dkdsdsjvsdsdrsj"e\RqejCeAzk{jj]{qj"j@Rc jj]>t |ePXeA k7[eAe]eOj\R\Oj"@e]eA 6r{8F1X1`1j8j\jj\j\erC6lerCdd7nje\Rs@6{ez\eCe\=d dRj\et\7c{@ 6letXr{@ j\erC|e]eDe]1j"erC=eh j"eD | lz=>de  l@e@ef,t@e,|e,\jjjj  6|e  :| j"eAe&  Nl D|LlJ|LlǓ& 8Plj 6Tl!j"e Rbd7jnDRjnDrt elfd j@6|Z\etStS ft e ~ j] jjRE?tj?Z\et@6l l jejEj]j j|j4jEj]jj j j&e] ejEj]jjjEj]jj j j&e1 |j e2 &eE7j\S j" | lz  lllllll =d(Ud(eE.d(fd(lSl jl l$ejAj ] 5,}0jj(ee:Ejj1 4}j8ej PpDP x! )# )%))$)& )'@@{)&t)()# )%)$)T^&`H@?@77THIS is A memory TEST patternDlF  ##$PX8TFPNRRCEST@NMxГCLH0PLH0RE@RRCEST@SL8RRCEST@ERlCEST@ 08ษପപ̰ง|" "}P"|"|"༱"ıP"̱""4"4P"|"""<P"@"H""TP"|""|"|P"|""\"PP"""ฉ"LP"x"0}""""P"|","|"|"|"|"|>A<"" "`P"<"<"x"P"̱""4"|P"""d" P"@"<"`"<P"<"<"<"<P"<"<"<"<P"<""ฉ"LP"x""D"""lP""<"<"<""|"A"" " P"X"X"$"P"̱""4"P"x"""`P"@"X""XP"X"X"X"XP"X"X"X"XP"X""ฉ"LP"x""X"""إP"<"X"X"X""|"LA "@  tCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2000 OpenBSD. All rights reserved. http://www.OpenBSD.org Anative| " `!sdd^     Q`d^_cd^P O @\ l ,n ܂ d^t7AG:88X  0   eijJOd^7d^l8d^ J8N>$?N(O L` h @|xPd^d^d^"(d^d^Xidid^`l m nd^d^ pi 9d<79 d^И"d^d^d^d^ d^w x@ l  d^x?d^d^ pd^ d^d^d^Nd^ d^ d^d^ādGd^ l  ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  < |p 4|d`|. .. " "P""""P"""p"`P""" "!"!"!"`!P"#"$"%"+P"0"1"1":P"""":P":"8;";"<";"=P"P=P";"h!"l@ " 20123456789abcdef^^#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@KLا@B " ഑ @,"",2 " "0$L "x-H " Dlut{mHwwt4 "x79x:; "@9x:;8 "9x:;\ "(9x:;  "x79x:;`7" "4 d}E#(D<8Q @X,2(@AAA==(A* d@8@8 @@@@@@@@@$?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@""""L+T++d,L+" "P"h,P"7","-"P-P"."."\0"P" ""p4"|4P"@"4"T "4P"4" 5"9"PDP"H"dI"HJ"|OP"""L"OP"P"H"lP"Q"8P"TP"U"t""lP"""" "@0#" "`P"<"<"x"RP"."."\0"RP"R""d" P"@"<"T "<P"<"<"<"<P"<"<"<"<P"<""L"OP"P""D"Q"8P"lP"""<"<P"<""" "@#" " P"X"X"$"TP"."."\0"SP"S"""`P"@"X"T "XP"X"X"X"XP"X"X"X"XP"X""L"OP"P""X"Q"8P"إP"<""X"XP"X""" "h@(# ... ...##H # L+8T++༬LฯXo +" "ЄP""വ"0"P-P"`"శ" "PP"ਘ""p4"|4"4""4P"""\"HP""D"d~"P""o""OP"P"l"lP"Q"8P"TP"`"X" ["|d"\r"q" DA0#" "`P"<"<"x"RP"`"శ" "RP"R""d" "<""<P"<"<"<"<P"<"<"<"<P"<"o""OP"P""D"Q"8P"lP""<"<"|d""q"x>A#" " P"X"X"$"TP"`"శ" "SP"S"""`"X""XP"X"X"X"XP"X"X"X"XP"X"o""OP"P""X"Q"8P"إP"<"X"X"|d""q"@#Xp @88 P | T   @)\P # #l #8`l,x8 # NKHEBAA=AAAAAAAAA:AAA0?N8?Hl.#B-#VX":d8f_in|mLLlLL 0 h \ XXXXX Lx !%p)L7XXXXXLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLXXXXXXXXXXXXXXXEElFTGDEPELLLLLXXXXX0ppqdqqqdrLHRRS|SSL:(:4:4: =L<d8fddiLL,LLLLXXXXXXX-LXXXXXXXLറԱLԳLLL4`-L 0 4 \ LLXXXXXLLXXXXXLL  d    - L t  LL !(4)p)LLLLXXLXXLLXXLLXLLLXXXXXLLXXXLXLLXXLLXLLL !ܓ!LLਔ!L!LLLLLLLLAXBBD|ELLLXXLLXLLLLLLLLLLXXXLXLLXXLXXLLXXLLXLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLXXXLXLXLXXXLXLXLXXXXXLXLXXXXXXX-LXXXXXLLXXXXXLXLXXXXXLLXXXXXLXXLLLLLLLXXXLXLLLoowyzLxLXXLLXLXLEE FHFTGLL!!LL4!LLXXXLXLXXXXLLLLLLLLLLLXXXXXLXLXXXXXLXLXXXXXLLXXLLXLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLXXLLXLXLXXXXXLXLXXXXXLXLXXLXXLLLXXXXXLXLXXXXXXX-LC @ P h 0 A :741.+(%"  LQ[`in_cksum: mp == NULLi386i386ʏ> 8 > 2 > , > &       L H  D a V P a  > & & , H q\P;P$ Ph      R ? / , , , , ) ) $                      x k f  b b b x tpmie a@]YUPLLG C@?:60,(#AF[6[&[ [ZZZZZZZZqZdZLZ:Z ZZZY|d~~|hЄ~~`|Pԇ~~H|XX~~L|~~x|~~|~~|l~~d|$~~ؗ|ء`~~СŰະరरvfZL?/#<,฿0cRQH7Qc&Q QQ~Qud`WFQW5QW$QWWQWQQQQQpQgVQg@;2VQ2!QQzsn@eTO@zsn@eTO@F5Q$Q !QQQQQQQQQtQcQZQIQ8Q'Q QWQQQQQQveQvTQvCQv2Qv(Q@vQ@QHQ@Q@@QsQbQQQH7Q&!  QQQQQwfawPKw:5, Q  QQQzgQ_UQP@Q:3Q/%Q Q QQQQQ Q QuQp`Q[QQL \x\   ve T K?K3K"EEEEK\t4&WEVrdrootWEVh  08:  <  :#,w6o/mnt8:<@`bT 08:  <  :#,w<@`bTU : 6o pD@d  ?M!4A ::9:9&vA:x1:'):') 2 A:x1::p k x\jA:x1:I:I A:x1:x1:x1 kA:x1:x1:x1 w3A:x1:x1:x1 A:x1:x1:x1vA:x1: I: IT#C:x1:x1:x1Q{A:x1:x1:b2:A:x1:=6:=6զA:x1::!)A:x1:x1:x1WQA:x1:b2:b2l A:x1:9z:9zjA:b2:b2:b2IbC:b2:b2:b2A:b2:b2:b2@6:n7:`!:6  -m:w:w:w">!:-1:-1:-1~!:-1:-1:Kw!:::zد!:J]:J]:J]`o͂!:J]:J]:wu!:::5!:w:w:w !:w:w:'x!:':':'Vaa!:::$!:;X:;X:;XK!:;X:;X:;X4!:::)>8!:::h 24z[!:h :h :! |!: : : q;Bu!: : : l)Bu!:X :X : ͖Bu!:X :X : m%Bu!: : : A܂Bu!: : : %_Bu!:N:N: eBu!:N:N:+Bu!::: !:I:I:v- !:::v-!:::v-6 !:::v-Ӽ!:::v-x1:a:::|a:9z:9z:'77!:9z:9z: Z!:9z:9z: R;Ua::::}hXa:f:f:Ea:f:f:0m _!:C:C: Y!:C:C: z!::: Vha:*u:*u:Gm-=a:*u:*u:GՏ!: : :G/!:G:G:G/xa:9:9:G0PPa:t:t:G0F a:t:t:G0La:t:t:G0v1a:e:e:G0>a:(:(:G0na:(:(:G0gva:/ :/ :G0 va:/ :/ :G0wa:*#:*#:G0 ׺a:[$:[$:G0 ‚a:[$:[$:G0 Ūa:[$:[$:G0 +8a:s$:s$:G0 ߙa:c':c':G0a: ): ):G0!: ): ):G0/M!: ): ):G0I!:'):'):G0 !:D-:D-:G0:w!:D-:D-:G0t !:}.:}.:G0:W!:}.:}.:G0!:}.:}.:G0!:}.:}.:G0[U!:}.:}.:G0 ۼ!:q/:q/:G0 $G!:q/:q/:G0 zD!:q/:q/:G0 Wп!:q/:q/:G0  $*!:/:/:G0"!:/:/:G0ʡa:G0:G0:R 5*B)a:50:50:R 5>Ma:50:50:R 5 a:50:50:R 5a:50:50:R 5D9a:50:50:R 5zHa:x1:x1:R 5a=>a:x1:x1:R 5+۴a:x1:x1:R 5zIa:x1:x1:R 5t~";a:b2:b2:R 5Fa:b2:b2:R 5ȱDa:b2:b2:R 53 a:b2:b2:R 5a:b2:b2:R 5Va:2:2:R 5t1!:2:2:R 53? !:2:2:R 5ze!:2:2:R 5KS)!:B3:B3:R 5w!:B3:B3:R 5 䭍!:B3:B3:R 5|:!:B3:B3:R 52!:B3:B3:R 5LM!:%3:%3:R 5Po$!:%3:%3:R 5!:%3:%3:R 5a!:%3:%3:R 5 !:%3:%3:R 57r!:s4:s4:R 5b֎!:s4:s4:R 5hy!:s4:s4:R 5 Ua:5:5:, 21a:5:5:,!qa:5:5:,"ja:5:5:,#m&ka:=6:=6:,$ a:=6:=6:,%A$a:=6:=6:,&yea:=6:=6:,'c5a:=6:=6:,(Wa:6:6:,)na:6:6:,*ka:6:6:,+ a:6:6:,,La:n7:n7:,-'9a:n7:n7:,.Xa:n7:n7:,/k!:n7:n7:, !:n7:n7:,!_^!:C8:C8:,"/!:C8:C8:,#r!:C8:C8:,$@- !:C8:C8:,%N!:ٟ8:ٟ8:,&=!:p89:p89:,'i!:i::i::,( ]L!:3;:3;:,)[!:::,*݇Gz!:::,+QG!:Zb:Zb:,,!:::,-.!:::,.)w!:::,/,a:::h 0!$4[a:::h 1rZ{a:J]:J]:h 2ǐa:J]:J]:h 35iYa:J]:J]:h 4a:J]:J]:h 5Ya:J]:J]:h 6ta:::h 7B.a:::h 8gfa:::h 9/}xa:::h :\Pa:w:w:h ; Kqa:w:w:h <>`a:w:w:h =B$a:w:w:h >$a:w:w:h ?i)!:':':h 0%1!:':':h 1f!:':':h 2q!:::h 33!:::h 42Ԉ!:::h 5Rhf!:::h 6}!:::h 7+-!:;X:;X:h 8>!:;X:;X:h 9fU!:;X:;X:h :{7Q!:;X:;X:h ; -[2!:::h <!:::h =<(դ!:::h >QG!:::h ?j!:! :! :! ׺@a: : :ͪa: : : ha: : :=Da: : :}a:X :X :`ݓa:X :X :Ca:X :X :ϱa:X :X :yna:X :X :!_a: : :  7a: : : 1Nia: : : a: : : Qp7a: : : AqSa: : :a: : :N!: : :  !: : : i|K!:N:N: M_RE!:N:N:  H!:N:N: T!:N:N: ݭ!::: A!::: ڢ!::: Qc^!::: \!::: j7:!:I:I: lHW!:I:I: ؾͮ!:I:I: !:I:I: =f!::: za:v:v:*uoqa:v:v:*ur#a: I: I:*ua: I: I:*ȕa: I: I:*uFa: I: I:*u{ӎa:::*u[Oa:::*uva:::*u[f ya:::*ubk a:9z:9z:*uvfVa:9z:9z:*u>/6a:9z:9z:*uoa:9z:9z:*u') a:9z:9z:*uQa:::*u5n!:::*u d!:::*u T!:::*u ~ܶA!:f:f:*u n`!:f:f:*u cp!:f:f:*u (!:f:f:*u mU/q!:f:f:*u 'G!:C:C:*u Fr!:C:C:*u h!:C:C:*u !:C:C:*u t!:::*u L"Z!:::*u k!:::*u !:::*u JD a: : :" Qa: : :"!Lt_a: : :""M1i%a:W:W:"#/Ya:W:W:"$ӂ a:W:W:"%[ a:W:W:"&k1Ua:>:>:"'!a:::"(Xa:::")u6a:p:p:"*/%a:::"+ݶ]|a:9:9:",a:9:9:"-Əa:t:t:".= a:t:t:"/k!: k: k:" q_!:::"! tU!:8:8:"" #ˢ!:4:4:"# Q!:/ :/ :"$ Z2:!:U :U :"% X8!:U :U :"& b!:`!:`!:"' !:`!:`!:"( lB!:`!:`!:") 3!:`!:`!:"* !:!:!:"+ K!:!:!:", A!:!:!:"- r#]!:!:!:". Z!:":":"/ d{a:*#:*#:L-0#a:*#:*#:L-1ϼUQa:F#:F#:L-25a:F#:F#:L-37a:F#:F#:L-4[a:F#:F#:L-5ua:[$:[$:L-6}a:[$:[$:L-7jÎa:[$:[$:L-8衃a:[$:[$:L-9+Ba:[$:[$:L-:FC'!a:s$:s$:L-;,~a:s$:s$:L-<˔#a:s$:s$:L-= a:s$:s$:L->h̀ma: %: %:L-?>!: %: %:L-0 uS!: %: %:L-1 …!: %: %:L-2 ˟M!:%&:%&:L-3 c!:%&:%&:L-4 !:%&:%&:L-5 z!:%&:%&:L-6 !:6&:6&:L-7 q!:6&:6&:L-8 |!:6&:6&:L-9 !:V':V':L-: X.!:c':c':L-; 5%!:c':c':L-< G9!:(:(:L-= N!:,:,:L-> !:L-:L-:L-? wa:D-:D-:B39Ia:}.:}.:B3"Xa:}.:}.:B3S,a:}.:}.:B32!:}.:}.:B3|!:b2:b2:B3!:2:2:B32&!:B3:B3:B3oa:%3:%3:92]a:%3:%3:9_a:s4:s4:9Ma:C8:C8:9[!:ٟ8:ٟ8:9ꆓ!:p89:p89:9fF !:p89:p89:9B!:p89:p89:9ga:-1:-1:g 7a:::x}!:Zb:Zb:P!:Zb:Zb:AXa:::,lKa:::,pu!:::,2!:::,2#a:::J]Ua:::J]C!:::J]'i!:::J]'G*m:w:: cm::;X:;X H p4:! : : n IbV: :+S :+S X o IT:+S : : ` x ¡:X : :    ( PN6K: : : 0 h $Q:N:N:N/tmp/disktab.shadowB:::/tmp/fstab.shadowxs':::/tmp/resolv.conf.shadowXu :I:I:I/tmp/hosts"]m: I::8 @ TD:9z::H ӔM ::f:fP g: ,:C:C:CX ` 5:*u: :th p x M 8 :W::t i dѨS::9:9 p}]!µj* <%!DO?"3PGx1"V=wrӼ51a{tvY1d{Ѣ_.@k/x %zX3Km7%OY2tK O6e6"IMGap-{fHΡ{3epgNGJi+-"b%%c;' DI&, l&#qo}?lgjBU[8<9wN`}q7F? '{')&$u5 /98_{(撝A`+#x4zʚ82y-p6o ... . ..chown disklabeldhclientqfdiskfsckfsck_ffsqhaltrebootifconfigqinitmknodmount mount_cd9660 mount_ffs mount_msdos mount_kernfs mount_ext2fsnewfs mount_mfspingrestorerouteumountjDdhclient-script ... . .. binmdeclsbinlshare . ..egrepfgrepgrep ftpgzipgunzipgzcatlessmore rshPsed . .. installbootbiosbootE_ mbr`boot1  . .. . .. bin dev etc mntmnt2l kernl sbinl tmp usr varl.profilecm install.mdninstalloupgradep install.sub . ..miscl . ..ktermcap . .. tmpdb ... ...H ..., where is one of: %sU WVShhhlE<=<tW>ӋE؃OEhh"]6hh>uhhjQinstallbootfgrepegrepgrepgunzipgziprestorershumountsttysleepsedroutermhaltrebootping-shshkshcpiotarpaxnewfsmvmount_ext2fsmount_kernfsmount_msdosmount_ffsmount_cd9660mountmknodmkdirlslnmorelessinitifconfigfdiskftpfsckfsck_ffseddhclientdisklabeldfddcpchownchgrpchmodcatUuu uUbenstuvusage: cat [-benstuv] [-] [file ...] stdoutU WVS}] dG hj) l$DDDDDDDDDDDDDD $84  ( 8 n4 `, T( $ >jhL1 (( hh jNhSWY Ã= u-=8 u$=4 u=, u=$ u =( t SL ShL]th"j50 :Nstdin-r%sU WVS] u;tZƿt7h Pƃu#3h 50 ,u V*t V\;ue[^_%6d UWVS}EE P  uv=, tM}u: TxL L hLj )E=4 tI= u@EEP=4 t)EURhhLX@E uZ=8 9 TT};d|L$L$hLj$i =$  TT};d|L^L^hLj^q TT};d|LILIhLjI=( ? TT};d|LMLMhLjMe TT};d|L-L-hLj-ӡD  TT};d|L^L^hLj^)?tك@ TT} ;d| tLʈ4hLQ: TT} ;d| tLڈLhLSt2ދGPWЅ}WWG @t$5 h '0 g X@th"je[^_U WVS]p ;t]ƿt7jjP辠ƃ}(3h 0 45 V29t VE;we[^_bufferUlWVS=Z= EPW+t5 h jE=s PO< uGhe"j1S PWeD}h"j)ƅũ5 5 EPhDÃ}5 h J0 e[^_Uuu uHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readU\WVSu g> h#j, 8zo H zg @ zm D zfƒ< EM̉MEEEE1EEUUMMEE`C0L$$%@&@&@&%@&@&@&%@&%@&@&@&@&@& &@&@&@&@&@&@&@&@&@&@&@&@&@&% &&@&@&@&@&@&@& &@&@& & & & &@& & &EwE1jE1^ETEHE<=D u T:-u<B9u4zu.I %{h#VURP Ã4)E}EE}t1}th#jGRtE}teM=< U<weP/!jMQRtXƒ=P/!tuh#jE8tuh#jQUEQEPURMQ tuh#jQUE=D <wmP/!jEPSlƒ} P/!"=P/!tSh$jE8tSh$jPUESoEXSh$jP=H tKj:6K5uj.685t@P<Eȃ6E6EȃjURVN7ǃu jj1MMC4H $( )))4))X)h)))h))))}ujSW2>=D sPsh$? ]=D SMsMPsh$  *=< =D }=< tC}t uCUuu uHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sUWVS]4 hD-jU \ Dž4Dž8Dž<.E0@,*x$0////T////x///////////////////////////////////Dž<Dž4Dž8Dž8Dž4Dž<Dž4Dž8Dž<e\ Yt h CFP3h t  ` d OhE-E PSIF Y)ËU U =d tJ=\ thd-jH<u8u 4th-j^H=\ t<t8tZp jT%l l PTKE װэA =vRh-jGRh00эQ0(=0uƂ0.(((,U 0Ph0ǃu=P/!t'h0h-jE%f=@~u=d u=\ t)8u <t,RE 0藐,RE 0輐H%f=@u=\ u =d t  1VPU RP8US]j/Su.xu$H9r/t9r/t H9r8/u@]%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_readU|WVSh 8uu+EujjEUB4 t5Gt u:Ep\PUrh2MEph2} Ufz2uJ} t:rƉuE@)E21t uE UB$EuUrz$+},>/t {/t/C-0=~Vh0h3WVS )(EPh0:uEH<UB<9Uu]A9EuUEph0hD3EUB<@%f=@ jREPo1A%f=@t5E%f=@u'Urh0h3kE1A%%=@tI=H= %\=`=FSEP*>=\ u?=d u6Urh3jEPUR0E t8A %Ph0Ћ}Ah0h-jE%f=@tP/!h0h-jt=` tjEpFPVЅ}W> tuȃytYtMQr.1jhUBPhh0Èƃu!h0ht8MQ1hhL EPn-Ã~5ShL V-9uuƃh0ht88}Urht8u MQ-V-=` tVEPttUB tkp 9B uaEPVu3EM9AuBAl !%PVLth0ht8\EP,V, th0ht8&x[^_readlink: %sunlink: %ssymlink: %sUVSuhSv+uvh;P} t&h0gth0h;!h0SjItSh;a=` tv<1[^mkfifo: %sUS]} t$h0'gth0h;'CPh0RJth0hp<=` u1jS]mknod: %sUS]} t$h0fth0h;*sCPh0Ith0h=2=` u1jS)]utimes: %schown: %schflags: %sU WVS]} EfcL CL MbCC)‰QC T C$C$)‰X Qh0Gth0h=^Etss WIuEss h0It+=P/!th0h=EfctCPWUIu5CPh0Ith0h=EP/!tsDWIu?sDh0\It(=P/!-u{Dth0h=HEEe[^_lchown: %sUEpp h0Gt%=P/!th0hn?1Ð cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-fip] src target%s %s Uh?h@hD@hj*Uuu u1qAEmAFhAHbAF\ADF@@XA\FUAFQAFNAF IAF@@DAFskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qdU VS u5| j| uhtAj5j=P%Ãu5| hAjg5C;u5| hAjF5| EhEjj h@EPb4 ƒ uuhAj5 #B tuhAj4 J SBЃ| t. t$tthA1tFuhAjg4= uhBjL4Ot|Llt\!t0t O& |Lh4Bj3= uhBj3K= t =uhcBj3 1ҋB5CRPVSl щ¸ @97u9 w-1RPVS? щ¸,@9 u"9,vBCRPhBj)3e[^ÐUUE 02'ÐUu ÐUug UuO u jÐUu#Uuu ÐUE ÐUuuÐUE$ÐUu,0ÐUu  ÐSH SMHFH TBH U?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxUS] S,h bjhE%f= tf=`u EP3 oEPR;uu]=T/tD>u3hfKD7DP7uEDP3hfįǨE3hf软;ELEuE9E}*‰߰эA;E~EèJuރ} E }tEPEPV EPEPVjU WVSjEP 19}51ۃEPEP=u ]CTèF9|1e[^_ÐUVSuu@=D.Ã;tj3Vt؃;u=D%e[^empty type listU WVS]tuhBkjk pB>Cp=CWVS5t*WVSWtWVSt 1e[^_ df: %qd: %s U WVS]u}jE URPSWVS 9t<P/!t,QPE URPhnuhyr1e[^_Ðusage: df [-hiklnP] [-t type] [file | file_system ...] Uhvh rjffsU WVS}h hTjh u t =Tt GG|G 555 wd+|jjdRP ))؉G GGG G$E P<u`vjZPGTP9jZE PP$jhavGDPYGS1e[^_lfsU WVS} ]h hTjh u tT=Tbt hChC)dC )xCd+  dQSx9v‰S)C}C|CxCC C$WuwjZPCTPjZWPjhwCDPCS1e[^_ext2fsUWVSuhhTjhuL tf=Su =v llj~ lF|1EhX)ڋ tT1E}D1MDEáX)؉F `F+\FTFdFF F$U RjuyjZPFTPgjZM QPRjhyFDPFS1e[^_Uuu uRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABELUWVS Dž`1{hl\,8$}}}|}}}}}}}}}}}|}}}}}}}}8}}}}}}}}}}}|`}l}x}}}}}}}}}}}}}}|}}}}>*h/!>h/!@~ =LtGDžhL=LtrGL=LtRGDžhL ><~=LtGLg=LtFLK5h/!A4~9(~1=LtFLL~ >Fhh{U RMQJ )EU U =>t4~=Lu L=Lu L}~%=4~t<~ > t=LtFM >h0~j=L%PR d}50~h}{jՂdP H~LH)$,t(؀}taEdR Ãu jdQS|&}tEdPÃu jV50~dRSJi}tDdQvÃu jO=(~tShLEShL S-=Ev`D=>t}uhP~jE pdRhP~h$^Ãh{M q[ uE ph}{j SPV,nSh$^dRK=L~JWhmddQ*h{j蠀EvtChP~1}uU BPM qdPhP~h$^ É߾P~eS;dRÃu j\e}uhP~jE pdRhP~h$^}Éߋ\eSF; uSh$^dP``Runknown disk type: %s/usr/mdec/%s%sU WVS}]W ƃuWh>jO e=>u@Ct98/tPhTh_h 6蔆Ph 6"> 6=@~u?Ct88/tPhTh_h :KPh :ڂ@~ :CCC C$} tjE PCPue[^_ÐDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: lseekreadioctl DIOCSDINFOwriting label to block %qd (0x%qx) writeioctl DIOCWDINFOUWVS]=D~tHhK5>h85>h%h@S:WEVǃWEVfǃS@f =4~V H~tGQB[<vu8QIB B B c(`dh諚hLV BHJȅ}Rƃ tGtBGPWЅ}h tuăytYt jhDž`Džd=>uj`dRPURb}hleE PUR^;th`ߍle=L~u7ShfdEPU}P/!tth=>t8`dd} RPRPh =L~j`dQRMQU}hDžhhPhmdEP}h{NU RMQ;u0=L~uA8~t85$~PEP;$~thDžh=L~uihPhmdUR}Jh{血;=L~u/ShgdMQ}h e1H[^_Ð%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskUUP/!t5tLt7t@Rh`讎>Rh螎.Rh 莎Rh`~Rh}{膎can't read master boot record# using MBR partition %d: type %02X off %d (0x%x) size %d (0x%x) warning, DOS partition table with no valid OpenBSD partitionU WVS]jjjSt|hhl/S=wh jufj1fEfk1f Ej@hl/h*1l//9~1l/ 1A A A t y{F~1l/ 1A A A t y{F~1l/ 1A A A t yH{F~f}U#x/A A A RA A A Rt/A A A RA A A Rh#x/A A A RA A A Rt/A A A RA A A Rhx/A A A RA A A Rt/A A A RA A A RhVh@hCYl/UhWl/=1l/ 1A A A uF~1e[^_Ðreading label from block %qd, offset %qd disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOU WVS=4~11H~tbK S A A A t>SB[<vu/K[A A A ùƉ׃=>t;} RPRPhŏ jWVURE| h h$^EP`=50~h}{jQp$`=$`WEVu/WEVu#fw)S,4fu0hߏۇD~$^|wC;WEVu0WEVu$fwS3fʏ|vPh}{o1= >t'hsd UR}hj`o=<~t/P~ShrdAEPl}Vh+j*oP~ShedAUR=}'h=jn-$^Ph 軆؍e[^_%s%sboot%sboot%sNONEbootstraps: xxboot = %s, bootxx = %sBootstrap doesn't leave room for disk labelUWVSE x(u@(ǀ UUM I(M}1e=>=>tEE=@~P5Hj/5>qu >AU”UHAHtDtݡHH=>uiVhThے5Htj5H }>ruFH>VhThےPt=> H=@~uiVhTh5Htj5H蒖 }>ruFH@~VhThPRt=@~ H=>t%@~uP5>h8j5>M-Ã}5>h}{j/lU r(MQS }5>h}{jkSoj5@~,à }5@~h}{jkU B(ы)REPS}5@~h}{jkSME9s9th@j A;MrEe[^_\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:U WVSiE xtPjhnURPE xtPjhnURPEPhrU fzwB4HhU BPhEPwP U r(hEP`PU r,hEPIPU r0hÖEP2PU r8hʖEPPU r4hіEPPU fzHtBHPShؖEPOg{U fzJtBJPShEPOg{U fzLtBLPShEPOg{U fzNtBNPShEPpOg{U BPtPShEPNOg{U BTtPShEP,O1] \u ƔtPhURNG~1E f>aUhiEPN6]ShURN vShEPNF t5<wF 4Sh%URF PSh-EPXNF t6u1F FP]Sh<UR,NvShDEPN GU 9!EPj URe[^_ÐUU Lf|PKt %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %dUWVSu} MEEEuELDBE  $M':؋1҉EUG(mEUCmEUG(mʉEUm؋1҉EUmG8EUmCEUmG8EUme؋1҉EU$؋1҉EU؋1҉EU@m1w(1҉EUmCEUm  ɋaEu%؃sQRQEaPhVK 2ɃURA$PR$PEaPhVjK0{ wC 4hϚ C Ph՚V9KC t t!Chg{C SPRhٚCPC SPRhVJ hg{hVJ}t(UM)PhVJW8C1Ph V}JC1w8t&FPVЅ};F| *7Vj*&FHNȅ};F|  Vj jCW8D1HPhVIC1w8t-FPVЅ};F| *Vj*!jFHNȅ};F| )Vj)iFPVЅ|  Vj i؍e[^_# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: offsetsize# %*.*s %*.*s fstype [fsize bsize cpg] U WVS}50~hWLGE fxwB4Hh U BPhWGE Pjh WFE Pjh,WFh9WFE @Xth@WFU BXthKWFE @XthPWFGPWЅ|  Wj fE p(hYWNFU r,hlW:FE p0hW&FU r8hWFE p4hWEU rCPSЅ}W tuȃntBNt=t4h{h0Ãh0h}{qh0X[^_sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/shUWVSE4E7EEh:蚸ÃuA߰ҿ0эP=ƃuhMp1h0ShdVO`ujjjj贽jj訽 =P/!#u7j} [Dž|uAEPho$TjhjpV E FV]쐃jSWXUЃuR蠅 ӐũjjjjjjԼ}%e[^_ US]h S À;t1]ÐUS]h S4 Ã;tCh S À;t1]# line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sU,WVSDžDžE ǀ ǀ  hQ*tP j:RٯuQh R:1t u Džz&hQYu DžzHs.tRPY rԃQ1vPRhjM fA Dž8R! 1t u du Du $QPhit :CM AXn  uu1ۃF 87 R‹E \CQ  8 ~ Ph$P uIHv%Rh2hM fǁ U fw u Džg{OujQE P責* TujPE P}Z uQRBƒ~tQPRhgM A({uIP!RQPhg0U B,1uIQz!PRQhgU B8uIQ!PRQhgpU B0q uIQ!PRQhgU B4uIQZ!PRQhgU B<«uQQ!PRQhgPU fBHJƫ uQQ!PRQhgU fBJѫ uQQ*}!PRQhgU fBLz۫ uQQ}!PRQhgU fBN uIQZ}!PRQhgU BPuIQ}!PRQhgPU BTQ<yPM 9r-vPRh @M fM u PvRQ })PRh`bu%Qh@bfPR })QPhbFu F Rs)tQPVPt;r؋Dt+R^ FDžv(QPh6aDžF F tRQF uPh@hRSQ 1vF :uPh@ RQ^F uPh@RQ 1vF uPh@]RGQfF ;HE fX&RQh9_EPhRM Q%[^_sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dUWVS}E(ujh',ujh0ujhĺ[4ujh׺[EfHujh[8u G,G0G8<u G8G4G<ujho[E1w(th@R[ujhm6[E1w(th[fvjPhZ1faE;uCtPEPh ZG<9CvEPh`ZEC;G unable to get default partition tableThis option is not valid when run without the -F flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.yWrite the modified label to disk?Write new label?unable to write labelRecalculated free space.Name of the file to save label into.Filenamecannot open %sNothing to undo!Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) UWVSDueDž4}t[jj4t2jj0tjji,uhj EPhDQT5@Phh(Qݴ u: TxL LhLj 5<ƅDqƅEh(Pп ƃshj贿 Ãp $4hh(0< p]X؅uPTShle󥍽lDe󥃽4t/0P,QV4P0QV S8P4QDP! Dl1t ule󥃽4,P0QVkle󥍽lDe8PDV 3l1t (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ le󥍽lDeS8PDVl1t ,le󥍽lDeDVhrdAE P8u8QV5mhHleCle󥍽lDe󥃽4t/0P,QuT4P0Q_T S8P4QDPDl1t ule󥃽4,P0QsTCle󥍽lDe8PDVR'l1t dle󥍽lDeSEP@/4t0Q4PPNh[=L~t hE4tMQEP4QDPOuDuh裡 _DQ5$^E P+thCA'}De=6%6tRhWle󥍽lDe8PDPbPh0+H{[^_ÐNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. UWVS]E8uhh/Tt\p| t~ jph-M  PhPhm 1EtF+8utaƅ1jphh ShhÃorMt%tRhh 돐wU9| AfU9| AfCCC USMQ Cu C C CC fCCVMQM0C C UR'1@ Džu|tS9rL9s)щ K jEPVUR]O;jMQEPt,FaPh0CS 0VEPGUubVu URVuK=6tL{ uFVMQPu(VEP!RuVURmSt 8M)C;6wjQEP%t UR[^_ÐThe letter of the partition to name, a - p.partition to nameCommand aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. UVSuEu2jhh<juhhNQ+S|9|`Ph?A u9u Shp'<v< t< u(24hhRu VkTe[^The letter of the partition to modify, a - p.partition to modifyWarning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizeUWVS}Eu5jhh uhhN)#q8U8U8U8E| 9|`Ph{ u;uQhph&VW>Q@C t< uUt t EUQtK< tGEt< u<M9v*PPRhhUC  )ЋMVW_HjEPVWOJu;u jURWthPM ECE딐Vu WQuM=6t_C <tuTVWKu(VW9Mu{ u,VWNtEECECEC .C;6wjMQW0t W e[^_ÐThe letter of the partition to delete, a - p, or '*'.partition to deleteYou may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. U WVSu}Eu2jhh&& uhhN &W8*u_1fBt.t < t BtBBBC9|Z|9|`Ph#0u%0uRhphh{uhhP5%\0; 6s%; 5r0t t 0tǂ@@@ } tU tPzE e[^_device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: offsetsize# %*.*s %*.*s fstype [fsize bsize cpg] UWVS}]u50~h9G4h9GPjh9GPjh9w(h9w,h9w0h9w8ht9w4h&d9wruFhV 31tPV@lu\]UBfHfou x hx h4hb whLhg CvMfAEfXhLj YURhh<ƃthVt4VttCvVh0 hLhPg 4hb whLhg2Cv T-L L.e[^_ÐThe start of the OpenBSD portion of the disk.Starting sectorThe size of the OpenBSD portion of the disk ('*' for the entire disk).Size ('*' for entire disk)UVSujjv<55hPh~jV t>V<9sЉːjj)R56)‰PhhjVC uhhN&V<)9wى 65u Ve[^UWVSEPupƃu3l55l56p5x5t5Ext5l5@p5E1E9}|El56UUfUM{9})PD;Ps:ED@p5P;UsEUp5EE9|Eǀp5ǀl5VZl5e[^_Ð Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. U WVS5Ex<=65H~VB[<v VNB B B 5^ V C C C  6} tU ;BruqFPEPh&hSG|r ш h5jjQ6hu ǃ u ~1ۃth1.uPM4\5BaPPh&W C 5uWQ1h[^_ÐStarting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. U WVSu} { uPjCPPh(hwWV+ uhhN[uhhd똋59s PRh(69rPRh)h}aC1e[^_Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors U WVS}E Up9} u$FU;B<u0;ƿA<utƿD<ul?8-uRzhG<j`ÃuEU 4h[<hl<%1jEU 4C P? 4;CLD4;EM9Mf=6u/h<h<u f6D @f66fHffp?h?k?p?f???L;jNr = @'4;u'jh<j.j|4j,Ð=Dt{Lu;jh<Si.CP@tPh<Sm/S%4u=DPq4;tCP@Su4AT w1e[^_ÐUsage: dhclient [-1] [-c] [-p ] [interface]Uh?ÐU5@cÐU WVS]SPt@0t SpcBCP0SgSPB@B,{PLSP?B0SPB4CP@8Se[^_ÐU WVS]CP0SSPB@B,{PLCP@SP?B0SPB4Sne[^_ARPCHECKcheck_U WVS]ShTAfzShQXzECPp tl>}uRv,hBAS,VhKAS-S1u u#VS~ S VE$uCP@}uCP@SEu\CPUPCP@ ?.PCPPB@ȉBCPPB 'ȉB CP@Sh{PLCP@SP?B0SPB4EPSSPB@B,URP#Se[^_DHCPACK in wrong transaction.DHCPACK in wrong state.DHCPACK from %spacket_to_lease failed.U WVSEX(SP@9B,thBdBt!ttthCe:u!Ph/C$EP ƒuh?CCPPSh|WwCP@<‹CP@PCPP t‹CP@PBBBCPH t‹CP@P !Q4Ѕ}Ɖq CP@?PCP@PCP@P SZe[^_REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.U WVS]CPP@8B,CPpS#SPBp,BttDuD EERS(CP txtRh ES)CPphES(CP@tPh<S(S-CPt P SPBCP@ShFCPptKP?R)‰P 1x PhECP@ Hp.e[^_ÐU WVS]CP0S&SPB@B,SPuBCP@zLSP?B0SPB4CP@SLe[^_U1ÐU1ÐUBOOTREPLY from %s rejected.U WVSU8B(@P,tasuu0t&uPhMGuEP"e[^_DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.UWVSUBt8 ttE(JEHE`EEũUREuh?C-cMuuN0UBP@8MA,PhJR#"uVhKAEP.#UR'EeMQPZ0N;u)uBUMAPPFztE?9~EuEPPBu r8uU?);E}M7uVLEPhI8URh J{$MQhTASJnuVhQoe[^_Ðdhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for filename.Bogus server name %sUWVSh46ÃuhL11 E}u47tZ@PS8U/47Mt8P7T4MEPSB(E}~CSMjPREt ugUx,t\jABlj{$uhMM1,C$@@s$F,us$hMbEt uwUxltlhlj{(u9hMMQhM h\M[S1E0l C(ƀ؍e[^_DHCPNAK in wrong transaction.DHCPNAK in wrong state.DHCPNAK from %sDHCPNAK with no active lease. U WVSMY(SP@9B,thOBt!ttthOvq@PhOCP0uhP5P[CPSh|WjCP@Se[^_No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ldsend_discover/send_packet: %mU WVSuVPB0=?)Nj;~V!zVPB8tB81ۋFPx8u11tF PhQFPP8SFP@8Ph,Q"FPp8hBQV:V!uVPz4uB4%VËNPQ4Ue1uA4ЉA4FP9P4~SRVËNPEU}1q4UQ4VPz4uB4NP?Q4A09~)@A4 FPfxD FPf@DFPp4?fP5?1yPF Ph\Qjh?5L;FPCP@?J‹CPP@CPf@DCPf@FCP@HCP@LCP@PCP@TS KPXC RPQi [^_ÐUWVS]ƅ1{PCP@?SPB,B@CPf@DCPf@FSPBwHE M qPR1BHCP@LCP@PCP@TS KPXC RPQ[^_UlWVSu] ƅ1~PFP@?VPB,B@FPf@DFPf@FFP@HFP@LFP@PFP@TV NPXF RPQ[^_U\WVSuƅ1~PFP@?wC‹FPP@FPf@DFPf@FVPHE M qPRIFP@LFP@PFP@TV NPXF RPQ[^_UVSuF$t PMF(t P:1ې|04tt08C~܃Ve[^wcan't create /var/db/dhclient.leases: %mUVS6t Pbhf5<6uhf54;t=FPX tSVuFPt PV6uŋ5,;t>FPX tSVjuFPt PVN6uŃ56e[^lease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } U WVS] C0+=6u/hf5<6uhfhg56~C0thg56~E Phg56~s2Phg56~@C(tPhh56w~{$ts(h%h56X~C,tPh:h567~11D4t-jjPt8WbP4uhJh56}0G~CPƒ2rrr B@PBlPrh\h56}4C Pƒ2rrr B@PBlPrhh56u}4CP襌ƒ2rrr B@PBlPrhh568}8hi56%}56Ke[^_Ðscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s=%sU WVSuэy1Cx<t4WV4 ux<=u҅tPmM|B9|3B2|P5xxuh\kxDҋ} эPr¡xuhkLE PVhkҋ} эPx46e[^_ÐUS1ۡx8t"4mxC<uߋ]Ðscript_init: no memory for environment initializationinterfacemediumreasonUVS]u|dhOxuh\m.xtC PhmtFPhmu hme[^%sip_address%snetwork_number%sbroadcast_address%sfilename%sserver_nameprepend optionno space to %s %sappend option%s%s%sexpiry%dULWVSE Ph?nh$S4uٞPS}WRt.rtKgED8NUBPL*ډv4uhnf$StWUBP4}t>8vӉv$4uhnhnC$RUt8P+MAP>4tP AL,UD4tL8 DžtcPP} Whnh$S1(jjPRQĒPS0} Whnh$V0Ephnh$S0SV[^_Can't fork script: %mscript_go: exec: %mgot wrong pidUWVSEt@P  6j/S賑 ƒ@u؉E}G ƅ}hVs"u 5xWS+ hls EPJ t.9t hsUЃt tt e[^_Ðoption %s name is larger than static buffer.UWS];сv h|t>1ҋ8t$<-u Ƃ_B<uݸe[_Can't fork daemon: %mU=0;t T=uIH芏 }hut j? 2Can't create %s: %mCan't fdopen %s: %m%ld UShh5@L}5@huJhfPFÃu5@huPhuSrS]ÐInvalid IP address in option: %sBogus name option: %sunknown dhcp option value 0x%xUVSUu jjt4t8VȎà O$v<{z<{zzzzzzzzz{<{<{{z<{<{<{<{<{<{<{<{<{<{<{z<{<{<{<{<{<{<{<{<{<{<{{zz<{zz<{<{z<{<{<{<{<{{<{<{<{<{<{<{<{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{<{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{D{<{Su0Sh\vS?uSh}v1Vhvte[^ÐUSM.AtYA.tH.t .tuBv2Bv*BЃ v"1+BvBv BЃ v-uމЉڅu[ÐUVS]1'FC<.t< vu"< uC; tEPSQ t1e[^/sbin/dhclient-scriptrCan't open %s: %mno memory for client state.no memory for client config.UWVS58A 16<66 6,6x6 66,|56666666666666 6h? .h?.hB|58@Ãu58hD|TSuV+Cth jSՐSVBE4;sPu4h CPuhV|ٽ{PCPuI}u7h0Euhr|蓽} CPUf=| e[^_ÐCorrupt lease file - possible data loss!US5<;?hB|5<ȵà tESEPOAt-=ujS ԃh~苽S]not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.UWVSu} ]VEEPz@I)$( HHHHHHHHHHHHH$HHHHHHHHHHHHHHHHHHHHHHHHHPHXtHHHHHHHHhH,Ĥ؂HHHHH< PV4$SV"P SVP SVP SVP jPVjtGPVsShsh V1PVP1@PV$: ." PVV# th?SVejjVPSVAhVVEP=;thԻVe[^_Ðexpecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataU WVS]S}W<ww1S}W<jjuE P% F;ESWT<ƒ:uSW;ƒ:tE E~u@SW;Uװэq;M~ h0QRE P&4h h h̃S1e[^_expected option name.%s: expected option name.%s: too many options.expecting semicolon.UWVS1EPEEP:=~=t =tuhZ1۾Cu6ut4E Gt1EPEP1:,a;u 7hpuh h迸EPo1e[^_Ðexpecting interface name (in quotes).expecting left brace.unterminated interface declaration.UWVS}W`VY9=t hi`Ã{Pu SCPuu ScLDWV8{t(h҆裷WVJh苷;WV*9tރ}tCPSWѐWV8H[^_ÐInsufficient memory to record interface %sU WVSu4;tVC Puup,;tVC PQuLj`jÃuVh,K1jVC Pm} ,;,;؍e[^_no memory for state on %s UW}h GPuG PhƲP1}no memory for config for %s UWVuh0‹FPFPuF PhdQFP1FPu e^_no memory for lease. unterminated lease declaration.UWVSEPuVC6{th҆URh4Ãuh艱1 U C0$ЈC0EEPV;6#}tEPSURẽMQV5EuS,xPu P} uE@PXUBP@ EE}tHMA;Cu΃{u1t U RPMB EP} tUBP@ BPX mUUBPtU?9B|J;Ku+r{uRI+h S!MAP@ EPPB E@Pe[^_expecting lease declaration.U WVSu] V}W 4:$DTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTx$4TTlTTTT؍K0VW3=thu‹ECPVGjC,PV) V' C(V C$VCvV C fVCVC4PVCEh,V VEP2;thŰVx e[^_Ðexpecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.overflowoption data buffer %sexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.U<WVSDžDžEPV/Ã~t tu+h^;(UR QǃuhӪWtURV/à .MQV /EPV.à ~t tu*h,虭;cUR=RjWh?u(WhKWMQ`;jp誤u-9u Wh_ WPhW3p 2$hhhhhh hhphhhhhhܔhhhhdhhhhhhhhhhhhhhhhhhphhhhhhܔ+P*PMQ}WP,Ãװы\C=/QRPBDžXPEP Ӂ/RQPEPP,Ãt,hޏ跪;UR[pj jSMQP+ÃujjSB}WPY+ÃPjjSbكEPP +Ã~t tu+h誩;tURNchQrth 7ru ƅShrthqu ƅhPPh,wMQFtAu ,;trh腨EPMhoUR7hhȏRMQhhȏ6}W1S‹A } TA |uhl衤P SPM tG M [^_Expecting media options.no memory for string list entry.U WVSU t6Ã;t<;u0h—EP1 ,URuV(=u}эAPǃuhhuGP>mt;U :EPV'}g;thMURe[^_expecting IP address.no memory for reject list!U,WVSuVEPuhإUR{jÃuh1l{U ,,MQEP&,q;th[EP e[^_U WVS}1W]S&}utLWSE&Nt<%{uF;ut uWS&WEP &ue[^_semicolon expected.US]SEP%;u h{S.1]filename must be a stringno memory for string %s.UWS]SEPT%=th SV}Qǃuuh菠uWhjSt1e[_Ðexpecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.UWVSEEEP]S#=~=t =t,u'=t hЛ臢EP71"}Q(ƃuh uVhEPVuEMEPS#.uEPS(#. EPƃuhP芞E\0}t_E@EEװэA)ÃPRSpE0EPEE9tK.}ue[^_ÐUE jj j.PPuu1Ðexpecting a network hardware typehardware address too longexpecting semicolon.UWVS}u WEEP!=t =$t 'hP_WEjjj:EPjWà tj}vShhr!EFVPSRS8WEP!;thʟW}e[^_Expecting numeric lease timeUVSu] VEP =thjV+j j uSffVe[^Ðcan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.UWVSE EEEuWMtNE…}PEu/h0šhldƐ}tvEP}WrÃ;]tLU:1}t{tMQWÃh[臝;tlEP/^URWMQEPÃJt.}ut hEP17t(URMQuV[E}ƃS}Q蔼ÃuhvuSOcURS:pE EEM;}EE}P'EuhРUUE})ƋMU EXURMQ0VnE})ƃE0:UR.]uEe[^_Bogus number: %s.Bogus number: %s: digit %d not in base %d -value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d U WVS]}M E19-uEAud90uWAW0uQ HEWVà /t)hp贕;W[WVÃt)ht;Wu EWVtà t'hϧ&;dWVuy E܃WV(à :t*hݔ;W WVÃt)h蜔;WCu E؃WVà :t*hQ;WWV^Ãt!h;tRWGui EEEWV à ;t h迓Wr1]SҍC} 1U~ ]u܋}؉}ȋ}ԉ}̅t, ,ȍD@Ɖ)‹Eȍ)Ѝ&ȍD@Ɖ)‹}ȍ)ЋU̍e[^_attempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %mU$S=thLhttR tXSjjI}}h謎EjEPjh5} }h̬su h5ht]Ðattempt to use ICMP protocol before initialization.icmp_echorequest %s: %mU4S]=uh̭EEfECEEEfEfEf]؃jj]S],P,fEփjEPjjS5*|à }uPh7u 1]icmp_echoreply: %mU WVS}DžPEPjhVw{ }hϮ軍L/vFP쉕(u4_ t-EDžRV獵Ӎ[^_Can't create addrlist socketrealloc: %mioctl: SIOCGIFCONF: %mCan't get interface flags for %s: %mdiscover_interfacesrecord interfaceInsufficient memory to %s %sno space to remember ifp.same subnetinterfaces match theMultiple %s %s: %s %smultiple shared networksInterface %s matches %ssame shared network%s: not foundNo subnet declaration for %s (%s).fallbackfallback-netU|WVSjjjYyE}h辊1ۉuVS臮Ãuh葊EEXPh$iUR;uh^U)Ѓw뗐=4;t}t }t}u EE}uEE9UuMqFt<v}|8}E jV]S T Shi EP }ShЯ袉Equ }c4;U M M}tVE P6uphj`EuVh h$jVE POS 4;}EGLGXG\GT=4;F<u6VBMA ABJ] DQPSն<yFEЋVUԋFE؋FE܁U}HuIFEPdÃuh7FEPVS]UZHEԉBEUEԃjPR5 uu3Ã0C uEC Cu0;Et(E PC PhQh]hrr [UBt"9thЃ PhFMYC u }{ 0;Et(E PC Phh]hr E;E}14;U"M M}GLt }u$GLEPHt@LuSUBL;EtЃ PhͰ誆u4;4;M,;}=,;uBEЋJMԋBE؋BE܉xu-}uQPE Ph4 Uzt MAX1{u CEԉC[u}WWI EE4;Ut)MQh\q0ȃ P}?}uڃEP讱jhh6O 6h6E#h6h|56hx[^_US4;tScSR uh6X ]ÐNo interfaces to select on - exiting.select: %mUWVSEEENjEEENjE󫐐x?tFS?9&x?s CСƐ)‰UE@EEu1Et?t4C t&x\u Sу C;E~Eu̓}uh0躃EPMQEPuVE@PZrÃh?uhVvt?tCCt(C tx\u{t SCЃ=uureceive_packet failed on %s: %sInterface %s appears to no longer be validULWVSEX uVEPhhSEă u_5P/!!uPs VhBCXSvt {Tt{{X~uVh0C\T}tL=4AtCEU̍EjPR(VuEPEPhS4AЍe[^_ÐUWVS]xt8E@E uz-t@C0 C(@C0{0u1e[^_ÐCan't allocate timeout structure!U WVSu }x?t,9su9{ tًt9su9{ uu"x?uEtË+ߐj辣Ãu hк蠀s{ ECx?tU9P~x?*#9tC9Bу9ue[^_ÐUS]E 1ɋx?ыt,9Zu9B utx?t [Ðcan't allocate protocol struct for %sUSj跢Ãuuh0E CECEC t?t?]ÐU WVS}1t?t-9u t t?P轢؅uԍe[^_ioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mU\WVSu E@0E}1jV]SH Shi EPj }Vhjc EAfAUBT} jV]SH Sh6i(EP }3=P/!tVhj UBT.MAT UtE% uu1e[^_UEH;ԑБX;$?|8;$|$| ÐUUBHJȅ}R蟹 = uOX;=$uX;|?X;|?$ԑБX;W`uh|t1ă\u뾃"uuh|e[^_Ðnumeric token larger than internal bufferU WVSEEE P|}uxu Eq|O؋ TDu-t _tt D|#TuDt +|DDuU RPR FYuh{e[^_Ðtoken larger than internal bufferU WVSMu  ѡDDu CwBV$|-tƃ_tѡDuVQQ uhzWPne[^_ppendllowliasbandonedackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringidser-classse-host-decl-namesnknown-clientsendor-classU WVSu} > DB $|,HH8\DH4HH,h^S#@u F0 hS@u 6 hS?u =hS??h ^S?u @hS~?u 7hS^?u 9kh%S>?u "Kh9^S?u (h>S>u hDS>u *hUS>Ihd^S>u ChjSv>u 8jhnS>u5~u :[huFP+>?7j hSP>~ u  h^ S=u hS=!h^S=u hSv=u hSV=j4bh^S3=u @hS=&h>^S<u hS<u %hS<'h^S<u hSj<u whSJ<^HVh^S'<u A4h S<1hFP;h^S;u jh)S;h-^S;u ;h/S^;r<jh2^S;;u BHh<S;u 'hCS:#hN^S:u hTS:&hh^S:u GhoSr:~hu^SO:u \hzS.:u +;hS:u ,hS9u .hS9u 2hS9u 3hS9u >hSn9Jzh^SK9u DXhS*9u 7h>S 9u hS8u hS8u hS8u hS8u hSj8u /whSJ8u )WhS*8u 07hS 8Eh^S7u h S7u -hS7$h^S7u hSb7urh(SF7u(Vh;S*7uB5=hJFP 7u#h>FP6ue[^_UÐU/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mUt 6>u>G HP9tv ؗu Vؗ@G HrH0QkXÃtu6ރ>t 6>u>!WG HrH05ؗVe[^_Uuu 5ԗXUu u5ؗWU,WVSECP48ttECU;P}bECMEuuEP t} uUECM;H|g1e[^_ÐNo shared network for network %s (%s)multiple subnetsAddress range %s to %s, netmask %s spans %s!Address range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.UWVSE0@EuOu0$,P]S$, u08,PShZ0=ܗu Sܗ=u S=u Ruuu08uuVy*$}}u08lupuV8*uu+\u+Pu܉`V#( p+PẺ\P#( ⋅l׉h+P]Sr#$hS\P`RhiY u0$hu*0u*Pu܉`V"( p*PẺ\P"( ⋅l׉*P]S"$S ⋅h׉c* P\P`Rh8sX 狵l狵p)E(狵luo)E0u9~4E狵l狵p4)E0hauu})}E@|PUEugud)Pu܉\Vh!( 狅p7)P]SA!,S\WhxDW|ҍPjMQӅu~u}~E|9E]DždEEPu08u0$uV'dU|uC0C(C,u0sl}{p,}4t ǃ ǃCEU0BLxLjjEP, ƃuu PhV W>QydMD`u6hU6d}t7`UBCZtXSdutCP5)NÔdEE@9EvE&}tu08s󥋵tV%$u08sA&x(u0$狵tI&0tzu9x|o}9xd}t Ux+EC`MD`CdDdjSRBhaS|S ]H[^_U,WVS̗tcs$EEs8uP#uK%0tu1e[^_U,WVSEXtds$EEs8u PL#u$0t [u1e[^_Ðsubnet %s/%d conflicts with subnet %s/%dU}t#V߰эAPS5@!V߰эAPS5@e[^_ÐUuu }tPB%s: can't allocate new groupU WVSu VEÃuVhEGߋu؍e[^_Can't rewrite lease databaseCan't commit leases to new database: %mUVS5ЗtK^t<{uu{8u t SRuhFuŋ6uQu hFe[^Subnet %s netmask %sLast Lease:U WVSЗ̗tRs$Phz-H( s8Ph H0[uEXtS;uhGMq EEXe[^_%02xU WVS}t} u'ddBfABAH1;u }5UPhkS߰э\ :CF;u |Ce[^_ Lease %s%D %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s U,WVSuhPhF$E(P Ph j ]Sy ShSFE,P Ph j S{y Sh %FE0P Ph j SPy Sh)E EvPUBuPBtP>Ph4E(MAhKtPRhREe[^_packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %sU WVS}whenDCPCPCPPhND0C PCPsh4Ds PhD(s PhDs PhCs PhCC!PC PCPCPCPCPh$CClPhWC,SheC  t@11ېD;8t'jjt;4PV P4]hvLC0F~Ńh0Ce[^_%03x: %02xU\WVS} 1E19}ku0tEP\BVhEP'uD+ CUPhD+P F9|EPAe[^_hash bucket %d:U WVS}te1Zu<3tGWhA3t/CtPssAuGE;8|e[^_cScU WVS]{41t C eCPPS{ tBt8thlPStj@,PSe[^_ÐOption %s length %d overflows input buffer.Can't allocate storage for option %s.Can't expand storage for option %s.UWVSE EUUE8M9vEu EQURUMD ;Ev&Rh?E@ 0U8U<u\E@Paƃuh=EMQPVkE0UD4M4E4EEU@P`ƃuhXu=M4E4VkMEMQPRikEU0M4`E4MULME8t U9MA e[^_ULWVS]t=t3P>)*v*}t@ƅ5ƅ6ƅ3ƅ8t6t,C=,v(SRPZjC 5.h-P=j.u]tRVPPu~tFyUt@PQU  9RQRPi9}M Ƅ)E ƀ4ƀFz9~ U Ƃ M ƁE WRP!iDžtk):u lSPVh؃80@.0@~!} l 󥃭tP9}B)ËU ,SPRch؃?U l@?~[^_ÐU,WVS1ljDž;uEM<RwM@}$t"8tuDž DžDžUL2tA;u9MOE\QPSf>UD)UULWRQf)t0tq=~;u};E~M(!;u };E ~ U (ʈD>;E E9%[^_Ðpretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array %ld%d%xtruefalseUnexpected format code %cULWVS1EEE,] }vEPh8/6E }tE,EE؍UUMˋEԈ MĊ¿ƒ3=$8hllllllXllXllllll`llll lllllllllhllhlllllXllllll`@M؋EUEnMExDFEE:OUMtD E4/'F!EPhg5Eԋ}EċUԊU˄t$}SEPhx$5;u~ MQVh5 Y}u!;u}E)Ph(4}u EE܃}~(E;E})EURhX4}}EEM9M1;uU6@$                 L               p                 4 |     }t E"EЃSURh ߰ыUЍL MЃ}t"EЋM#SffP PEP 0S{Ph|URSKPh|MQ8  SkPhEPS?PhUR  ~PChMQ bPChEP JPChUR 2CtRMQ* Ph2}аыUЍL MЍF;E} }:t EЉ;u_E@;E} MϋUЈ EЉEԋM91,e[^_U WVS]EPu V^1 󫉵EuEM,SO tt t S< S_;[^_UWVS]EE ;E uE19}D*"D*$D*B;U|ߍu[^_U,WVSE4ffE]߉]]u UJD*$tL}8>vE}uDN|<9tE}u$IyD.D*D.D*JNy}E[^_UWVS]E ;E t E$19}ƊD*$ D*D*B9|E Eߍu[^_U(EE19}D* "D* D*B;U|ED(ffUWVM;Muu } 1^_.%s%dU WVS,}u߾ f1;u}>D. P t Ph S$ ߰э\ F;u|Ÿ,e[^_UEffÐUEffÐUEfÐUEfUUE ffUUE ffUUE ffÐUUE ffattempted to reinitialize sysconf protocolunable to create sysconf socket: %m/var/run/sysconfcan't connect to sysconf socket: %msysconfU|WVS]=D;th:,D;jjj?}hP,E}t󥤍u}эQURV5?}U=luh{,l5?WD;Sh?C؋]enter_dns_hostCan't allocate space for new host.U WVSuh j#Ãt%h Qh#uh'V3\ CCC C؍e[^_tree_constNo memory for constant data tree node.UVSu h#ÃthV"Cuh&VusTs؍e[^tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.U WVSu} u u>?hnGFP!Ãuh|%vvSSFwwPShnv!hnw!^GFhnW?%4hn!Ãu hE%s{؍e[^_tree_limitUVS]u ;u 9s~s#h!tXp1e[^tree_evaluateUWVS]ECEECPEEP}WuVC E;ECbh=P: Eu1HEEEsEPWVQth=Pf EECECe[^_Bad node id in tree: %d.U WVS}tM ttStjwEPE PEPwEPE PEP9rnwEPE PEPZwwEPE PEPj5_EwEPE PEPPƋEh #e[^_%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookupUWVS}G9? wN7辒 EuxT/!t*tXt/t>K7h":7h"&7h>"7h\"?<1UB8t F<uEX 9w }MhSqƃu_ u/?$ =Ht"h<h萫h  CjM.UWuhtE PhthhtC hth<$7 P# =Ht3tװэAPRj*jh<j)1}ÐUWuhtE Phthht5C hth<$7 P'# =Ht3tװэAPRjq)jh<j`)1}ÐUWuhtE PhthhtB hth<$7 P" =Ht3tװэAPRj(jh<j(1}U WVSu ]1Ҁ>tjtRPCP ߰э\ F뮐FC륐<%uFC딐e[^_%s line %d: %s%s^^ UWuhtEht5T;5H;h;?hhtMdE 0Phthht6A hth<$7 P(! 58;h<$7 P ! =T;P$4+P;PhJ?$7 P =HtװэAPRj&'jh<j'8;װэAPRj&jh<j&P;HPh4j&jhN?j&| 1}attempted to reinitialize dns protocoltcpdomainunable to create dns socket: %mdnsU=@;th@@;h@h@ t@f6 f65jjj |?uhAt jhF5|?h AzÐU WVS]u Ɉ SPVRF(@e[^_ÐUS]t&tDPD]ÐU WVS}] utЉ$?D8t<SPRV'0.D0PDPWDe[^_in-addrarpaUWVSEfCD. tF> u+]~19uNuN9BABAB fA 1]=pAthjj5A }'ja 9PLf15AJA xA|ApA5ASjMQ"@ |9t7xA|Aj 9Nf16_xA|AGW W#E xA|AFe[^_ÐUS]5A‹XSAA]invalid addressUMC19tCCt@9t Cut3Cu+9aPaP9BABAB A UVSu(8 69~oA 9(966B69|C6696@6 6956e9|$9~V6@6 695696C6~C1Ґ B@9|6 6 (8u)48t j;c48t jd6e[^/tmp/ed.XXXXXXXXXXw+cannot open temp fileU WVS\ATAjhRh6 h6Qà t+hRS$Au:t Sh6 9Rf1e[^_cannot close temp fileUWVAtRPV'}+h6莶 9Rf9Ah6iPpAxA|A1e^_ÐUAtP&h6P uUS1ۃjhHAh_% ^} jCCC@BC~]ÐUWVSu M]@B66: 69UN~BNE[^_UVS<787xC|Cjv P 1ۃ A 3C~e[^U879<7|<7uhpC87=87~<7pC<7ÐUS]=<7u!u jhpC87<7=87|<7pCڈ<7]ÐUS]=<7u"SjhpC87<7=87|S5<7hpCr} 1]Enter key: UWShU? ǃ?u14W]S1 SECe[_ÐUEu5P/!N Ph9耯 ÐUU EЃ6/$V|WWWWWWWX X8XXXXXXXXPXdXxXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXdXxXXXX1J?/%   } ~s l ~_ X ~K D ~7 0~#~bad hex digit in keybad binary digit in keyUWVSu >0|FtKj3P9uhXC<3t~C~1ۉA$‹u3C~AtJj3PuhX<C<3t~?C?~1ۉs}; ;Iy~AjVEP=[^_des_setkeyU WVS=AuF11۸M~ѐ07tC@~t E ʀM~EP t hZ$e[^_des_cipherU WVSu] uX1ۿxC03C~1҅tPjVV th8[xCFGe)؍3PhARw^1ۃxC03C~1҅tPjVV th8[BEPjjV3 e[^_Ðdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileUWVSuE PjjV蒺 ǃE]FCjjVV th8[G1ۺxCА 0 3C~ExCEBE P* Ãu~vh@\9M QS -~h\} h\e[^_invalid pattern delimiterU WVSA t u9]fWYEt꡸A8u@A5AƋ=A;=ArV?Ãt=TAtj jvSjjjSEPjM %;EuVGNG6;=A~1e[^_ p unexpected end-of-file& no previous commandout of memoryUWVSE}um5A^tOjEPEu>9^fސ9^E^n@PA|}U RPPoQ|f É]څ~ hC| uQVu5hC^u15hC^u}( |7M<jEP EUB79(8=}V5|7Tu}j 9^^9BABAB fA (8=(8R48t jT48/jT 57|7 (8u,48t jS48t jTE@PEP5|7|7UM A9t5|;!|2~PAPPpO|A8u1e[^_USPA@lA9(8P5LAutj~ 9^^9BABAB fA (8=(8u)48t jR48t jSVlALA (8u)48t j^R48t j!uhLdFP^ hLdVNP& Åu)Vܤ 9NdfE PSǃ} y>!uS |5S/}$Vk 9ed,Wd=08u}dPhނA+E e[^_newline inserted newline appended UWVS] S1E\AETAU;AЉU\ATA= 8tCA(85A`uA (848t jN48jO?t~UAPPj_dƃu: (848t jWN48taj5OU (8u,48t j!N48t jN]EPÃ} }t&}t }t}thhe 0=\At'}t=TAu!}uhhe谢 =TAt=\At }uE}u \A}u U\AE TA= 8tUE)‰UEe[^_out of memorycannot read input fileU WVSE$ sdAuF9(8}S5Aru{j hh9B9B9B f9 (8=(8&48t j7L48jMdAA (8u,48t jK48t jLAMuu TA= 8tEPJUBHJȅ}R U8MA `UdA9(8=}S5Au{j襟 9hh9BABAB fA (8=(848t jJ48jKdAA (8u,48t j~J48t j\K uAU ERMA @t'jɞ 9hfL}tAU E\AAM=TAt=\At tHEe[^_wcannot open output filecannot close output fileU WVSuE8!uhWk@PU u MQGP Åu(EP̝ 9YkVEPSǃ} M9!uS |:S}(EPT 9qk󥤸4Wd=08u}dPh{}t+uF1e[^_ÐU WVSu VE= 8t}ta;u\Wt:_;5Au=TAt =\Au CSPEP]} 4]?Fu= 8tEP#UE)‰UEe[^_cannot write fileU WVS]u }Ota= 8tSPFa|r 9Drf%A1$f;]t ];t hChCA؍e[^_%ld \  \abfnrtv\U WVS]} 1EtuhUtD  EF;5|9~hLhZt{ B<^w6\t1 TT;d u TT};d|L\LhLj\u F;t,Ph]t t-]tfti%P0 TT} ;d| tLLhLR $8%P0 TT} ;d| tLLhLR讒 $%P0 TT} ;d| tLLhLRf C TT} ;d| tLLhLR C TxL LhLj 1e[^_@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-fileU|WVSEEU U 1M߰эQ~ |r5,8bst pt .xt%h/!XA<080 8$U25H9hojhpwMQEP uUU)Et+8-u$08}~ 뭐EMj <8uUEPjuE%f=t2jjjj?щƒ t<8hL j<j thPjdhjRjjFhj7h@C à t9hhuw{ 9ywyw9BABfA88}M8tYP<tIjE0J} =<8tkU8!tph2hD8t B9N}tJhhw M8u9w󥤃=<8uj}#=$8th9hwhxmXAthLPJ hL A…|=A=08uhhw 9Ǿwf=<8u2P5Aw=$8twPhlj %Aj1hC| t$9wf%DAaÅ|.:Å|#SAPP4Ãt" tej!Ahhw΍ 9Ǿwf=<8P=<8u#h95Aw=$8t%wh9w=$8twPhbkjxhhw/ =<8h95Aw=$8twPh kj \UCAAAAA<;uA…|%CAAAA<,t<;tC~Ct9At AA1unumber out of rangeinvalid addressU WVS5AADt%: t ABABDtz uᡸAǐSUY$~88AJ AB ABABDtz uᡸA DtHj hAP輮 =t=u =P/!"-t^u)D-t^uNFHj hAPD ƃt O=P/!"B9 ~2A.5A/%P6Pƃ|A9BAPA@PA0ƃRt4AC;uAA A5AJ9uI|95A},9~~9BABAB A 1ɡADe[^_invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown commandUWVS11EA Dt%: t ABABDtz uᡸA8GAp$,llllllllllllllllllllllDlllllllllllllllllllllllllllęlllllllllllllllllllllllllllllld̈4Ԍtlpl($Hl1ɐA=CADÅ1ɐA (8^48t j 48;jm ,t5AGZAPPj'"ǃu> (848t j 48j 94A (848t j 48cj Qe[^_ UWVSEE @1;AR3EEP$ƃ ;u?V転ǃHEF 48t j p9|MfE PMQ} EHA(85p9OtAPPju4 (8u48t j48tjw 뇐A (8u)48t j[48t j9 1e[^_ÐUWVSAB1;AƋAK19]t9Uu(8t(V諣ǃS蠣ơAA VSjt)1UBU;APEPj{u< (8u)48t jy48t jWV EU;A}SÃEPURТƃSŢà >pUB8BGZA9E}A)‰EEA=DAtW6舴A (8u)48t j48t jf1e[^_UWVS]5A E AA)ЍpEA9 9)Ѝp)ىM(8WÃt7S}t EXVAPPjEu9 (8u)48t j48t jtpA (8u,48t jS48t j1?N-uEA@PРǃ1e[^_ÐU WVS} (8WEPju< (8u)48t j48t jG1;AR@ƃEHEP.à =DAtV313^AH+})AEAA (8u)48t j48t j1e[^_U WVSuu09~~9BABAB A gE @1;ARWǃVLà 9t5StUR5AVFsP|9u1e[^_invalid mark characterUWVM ѡDu9رf!|A< uAE 1^_UWVMѡDt4T@9رfe^_ÐUVSu1ۋ At-19Au ǂAACt~ܣA[^ÐUS]j,tCS AQ CA5jV 9--9BABAB fA 1]ÐUUE 9t x\uHPR%1U WVS]1x9=(8W5t9;utjU 9--9BABAB fA (8=(8u)48t j48t j1v=x9t9 (8u.48t j48tjC t9F<\uC t~ޡt9ƀt9e[^_ÐUE=(8tH 48 P?ÐUE=(8tH 48 Ped.hupHOMEU WVS=88u jDMI!48APjh2hh轫ƃtqэyA=VA PiÃtAVS6P |;/t /D;hS)x 5Ajh2S莵 jue[^_ÐU=88u jSMI!48jh@Ck UVS5P/!MI!48]Shht@j^|)f}v EP9Cfv C|95P/!e[^..UWVE=,8t@8!t"ƿtj/P荦 t9f1e^_invalid pattern delimiterno previous patternout of memoryUWVA< u9 f%< tJ AR t8u'=:9:Pƃ:t=L9uP Oj:u6jQ 9NN9BABAB fA \L9jV5:] u :3h'h95:P 5::1e^_unbalanced brackets ([])trailing backslash (\)U WVS]5AG<[t<\t4 FF9t< u+AS:9(8=}W5:iuzjP 9NN9BABAB fA (8=(8P48t j/48-j =:: (8u,48t j48t jS5A5:ܯ:5A=TAu%:.9иfj jS5:\e[^_UU:^uB:]uB:]tJ< tD<[u2J.t :t=u u1B:]u9uB<]t< u1:]unumber out of rangeU WVSuE A utAu A< uz8uBAA A<wNj hARJs U =t=u==P/!"u49(E gu BA1e[^_no previous substitutionout of memoryU WVS1AEAA8%uCU8Pu;@A=A{9$cNJA\AU8I9VA9(8=}S5Au2jL ==9BGBGB fG AAA (8u,48t j48t jAAAF< uA:<\uTAAAF u8=DAu/c w…t~ hC| uAM8VA9(8=}S5A贡uqj[K 9==9BABAB fA (8=(8u)48t j~48t j\1PAA (8u)48t j>48t j5tAAAe[^_no matchUWVSAEAPAEA)‰9EAPAPcURU RPEPƃ 31APPqeA(8SˎÃu> (8948t j'48jt5A貐GZAPPj ǃu> (848t j48j94 (8u,48t jq48t jOEAEAA)‰9EtA}u0E u)99BABA!E tU RAPP|1e[^_infinite substitution loop UWVS] DžDžDž1Sƃ=TAtj jsVI[j SjVEP DtE ,j RjVMQ }t9Ew `A9(8=}S5ASjF =9A9E9If9 (8=(8W48t j484j%`AA (8u,48t j48t j=TAtjj (V舐AWVP螦UrW QV  E(`A9(8=}S5AujE =9A9E9If9 (8=(848t j48j`AA (8u,48t j^48t j<=TAtjj WV!AWVP7(ƀ>)T`A9(8=}S5A菚utj6D 9==9BABAB fA (8=(848t jU48t{j3o`AA (8u,48t j48t j~5( ,u'Ut9Ofa=TAtjj WV蠍AWVP趣AjftD1[^_ÐUWVS}AE=tAU<&M 1Y];)`A9(8=}S5A輘u=jcB =9A9E9If9`AA (8u,48t jz48t jXMA;u A]FG;u|<\EU<0<9;EM 4DE)`A9(8=}S5A蚗u;jAA =9A9E9If9`AA (8u,48t jZ48t j8MA;uA]FG;u|`Aw9(8}S5A踖u=j_@ =9A9E9If9`AA (8u,48t jv48t jTAMMAM+A;tAW`A9(8=}S5Aӕutjz? 9==9BABAB fA (8=(8u)48t j48t j{G`AA (8u)48t jZ48t j8Ae[^_out of memoryU h;l;9p;|!dl;@PQǔtb h;p;@Uu胅p;h;@Lu dp;h;@Lp;^j > 99BABAB fA q5h;迓h;l;1nothing to undoU,WVSAEAE=t;t =x;u199BABAB A =p;t AjW(8=p;O  h;t1t ~x5APAAA@BXQBQPCQAAABAPAQA@BQAQABO1Ob=p;}WO9U~l5h;ECECEGU)RDCDCEEDEDUBO9=DAtݕt;AEt;x;AEx; (8u)48t j48t j1e[^_ÐU WVSJp; h;@<u.D8t9t VV 9u p;=p;up;At;Ax;e[^_Uuu uQ+lost+foundU WVSFPF<9s0Ct {tPP$‰S BCZ9rЃj.$Åt4HGCKtHGA<uՐCuˋ[ ȍe[^_wrong type to dirscan %d UWVSEx0t@0PhnUz$uIZr؉% t1؉y ؉  MAQ GUBS4PMqt"ÉU)ZrMA QxWPS荙=PGu SCCSEX(PUBЉtY=PGu=Eu SCCSPUrƋMA F)WSP F$G u3URS@MAuyt[^_DIRECTORY CORRUPTEDUWVSu GVP4URvNjV F~;UWRVum>)hVZEEPvNj^ _fCCCC}tGF FVF~V UE9]_CMN C)F^W;MF~RVu~N ʅ})E)EMN Uщ)N^>u1>hV*EEPvPNj]_UfS}tG؍e[^_ÐU WVS}] W Ѕ}%)¹)ы;pFCfs9t{PGuCC$uSUSUSUSU9|DO9 hb蟀tC[ G@0M)AQ G@0 )Ah Gp8S臍1[^_ÐUWVSE@Pu E;=PGt;EUV P E Gp4Mq(à {t EP{CU GB49Es+;}E G@4C9ErCEf@}u(lFMAfBjQHGU<vMQ 1gEPUR\HGMMHG<ulFMQMfHUfPMQw Ef@Ee[^_US]E 9tPF fHSi]UWVS}_ pFt5`CuK)M 9vK`)0 9w#[^_ÐUFt`u u蛀FDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS UWVSME 8tU B$AQ ] CS%f=`t2f= t,f=ux G(Y 9wu;Aw uXyhuR<u vlp)AQ h,: XF 3} GH0AEUSQRP t}]؉\9@5 Gtu>E#8t3@DNL!!ڊNT tu F F8U BM y0tAPP|SGShWh{u] snG؍u) GB0AA h,9 XF 0M Ay0u QA ] S,y;\ G@8u F GH0I]u)։lpdh\Džx|`t.U BlpSQxSR)t^u ~0uOl ptAFPP`Pه`RhiVh8zD G@tÉd㉅TXdXhXTXdh)lpxx8[^_ÐPARTIALLY TRUNCATED INODE I=%uU<WVSEx0uPP҃uEDžMqqt  Gp0]s{M  GB0} ~]BtÉ} ㉅Ou GKtƉ׋ϋlj9}wub9uv]UrM])HX h,6 XF W cEUEUEUSQRP~ UzQt9}|C49sK>t8Mqh,W WEP tB9rQ5TFzC9tBMA} uQEURPU RMQtUcuEx0u@E Et8UBPPWƃWh\Rh+v)EU9Rb[^_blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d U WVS}E9U U95 GÉӋF!FЉV9}UF9E=\GtRWh3  GB!Z BPURh EF`G=hFt G P2 $G=EtN=$GtE16h C!CSKdRS5TF(hF G;s,|jcc5EIZ5HG;Z5lF-Z =hF= FuhC =XFth* "8XPh uMXtBDžDžDžPRhhMɀ t&= Fuh < 1[^_phase 1, inode %d/%dU GP,P5Ch`u u7 ÐULWVS1ۋ GȍỦU;Y,}tA!AЉyu1qC]9}1}FE)F9|ҋ]ȋ G;Y,|JH4ʉЙ<19}2}F)ø E F9|Ћ}1 EE1FE1C?x1>1C];},=CvEPWFG G;|֋]ȡ G;X,|?e[^_ÐPARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%uU,WVSEPfEfef}s(F0u!sXF u fuC C tHURh@4h_X u"MQWÉ߾F HG}EF G@0s{ K 9wu"9Cv=\GWVhe= FuIf}uAhsWu,URá G@4CC fI= GO0ACS ΉWVRP+^ EUu GESK UM}#=\GQEURPhf}`tf} uFf}?=ES CKu ;{hEB$)ĉR GHdC(PW5XGf_th1=\Gt$C8SK QRWMQh EPWÍC(sWP]Ch G(U{ E9wu;Sw }u@{hu:CS ƃ ~ ~~MAtO +C(t=\GAPhJG ~1~JE@tE}G2CXt&=\GPh G~ʃSTElFCMfJf{[jQƒu5h <1h*  U u'h3 h4 &0}zEEf}@u9C C uHGUHGM}WSHGUEfm M} =Et3{t-W=CCpfCCCtfCCCEU BRS G@4 M A$A$9ChPsh}Wh@ '0= Fthm  h{ StzEPËU B$Ch$\MQh /HG}h_jS u(HGW(É߾F e[^_BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.UWVSEExpWREWh]sCC ~]sh.= Fth gh* CRLh3 h4 Z-E@E}tjWt E;}G5E3)r F3G}uN)Wh]sCC ~Ish-= Fh* PQu]h3 h4 k,jMu=h8-h* Q uh3 h4 ",~y`Gu `G F  F`G_]uN9t9xtӐ9t 9xu9u 9xt `GE@$}uZEe[^_phase 1b, inode %d/%dU GP,P5ChXu u? ÐUu3BMQ$1;pFvh3q=PGtouxu\zuPh1]s}@hCX>{o HG Ӊ΃-$$$P&%%$$Ex$hSph=Uz$<3u = FPSMq蒯h}=ǃ 37ƃHG%f=@u lFFfJSxMy$APPV_J33SFJ ShVh= Fth  h<ǃEx$~ @B=PGtUKE9t;h3Ep4EChC<ulFf PRPh% u  [^_UEU @$I$)phase 3, directory %d/%dU5F5Ch0'u uo| ÐUWVS?L'FPFL9CCQUsHGt <M<EDžtE<u?E;xF4sqÃE{StHG<u U;xF~̓sW蝱GCClFf BHG蒦M; PF,?e[^_phase 4, inode %d/%dU5F5Ch(u u{ UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%dUʅ}J(xU t (@`х}J)ʸLF8;s8uL8;F88(BF|Í(yU tDT (@T8F|֋ы8șPщЙ(~U t (@XٍXf8$8y8Éم}K(Rl)øLL(s$}G(xU t  (@`}G$)8+K8!jVRS:8B8,Nj09,T8$([h(RlBDž11(;Np}ltAt8$9~1ɉtBDžG(;~p|t8$9~(B$EBEB EBE8KpPދ^l#Pعt?h,TP7t$(BBCB CB$C $G=Et%8(S4V4U t  4\(xU t Ɓ (v\@tzh,EP6tb4zU t  4R\(yU t  (@\@SPRF.E(4HuQ4~U tT 4T(xU tƃT (vTDh,EP 6tvHR(Q4S-{U t ڃT 4RT(~U tT (@TDWPRN-EP8;B,?8Lu |>ÐUt>ÐUx>ÐUE Puhګ j0-%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. US]u=|>t5t>h >j uu : tF=|>t=h>< =|>t$585t>h> jm,]ÐUE PujYÐUE Puj=%s (%s)US]5P/! PSh ?]ÐUE Pujj+UpVS]j/S ƃt8EPS |$E%f= u~ruFPFPA ؍e[^/rUVSuj/V ÃtAVhC /h?hC CPhC C1e[^/Can't stat root Can't stat %s %s is not a character device U,WVSu1x>EPh5@ }!h5@`h7@ @PS趁 }SShH@ H%f=`u[T9Eux>SÃPSS |%f= uYShW@b Df= uuSÿBPMQh^ 1\]1҉߉YEXUZ4H MJ8}GB$N0F,F81v(}G|D1}D1Nj}GGȃ~EPUH#tJɉJ}HW|Uؙ}8Lșϋ}OEȉș}O$ș}EDG,GdE~1BMQdF(tFe[^_ioctl (GCINFO): %s %s: can't read disk label US]hChedAu Y}2u1/5P/! Ph7aCShKa)C]bad file type 0%o UU%%=`t>!= t5 =t,3=@t '=t =t =u =\GtPha~ 1ÐINTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] U WVS= Fthlbub ؃hb u*=Gu =TF}EPhb跽 =(Fu t'=GtURhb艽 EPhbc hL GPWЅ}W  G ul t0FPVЅ}W  uŀytYtnt NYhb y.Y%1e[^_cannot allocate buffer pool U WVSFLG Gp0 uh8dOEEEE0F4F0F GЙy0ǃ1=h8dCC0F0FX0FCCCF9},j à Gp0 tu~5=Lut5TTh~h~KtTjju aÃQ;uv=<=PE 405=0tE 40E =utR21ɋE ;u =TuQRE 4G|=0stB|PZp==LuTTh~h~tTi1 󫍝Sjh E 4軽 u u'E 4h~ܗ S =7E 0p=0t7/=utRp119u =TuPR7G|=0stB|Po=u>=Lut5TTh~h~tTt ?P F;uPj [^_r+wUhju u|wULU PUtRju uKÐusage: %s remote-file [ local-file ] local: %sRETRUWVSDžDž}uEU BBDž}h{E PEPt(}h{E PURt}~E 0h\5(s*d (E HPP'uPn1M A=trQ:t'DuB:tDt:uCQt&5DtDCBAuE xtD=0tE ph,‹E P=utE pN.‹E P}PE p,= }u;}E ph 04LUPU3u,jE ptl9 | DžXR1ҋE 9Hu 9HtRuE pph;zLUPU 9t PI [^_UVSjF(sBHJȅ|  Rj  5(s =tl=LutcT5,T,5h~\tT5,jh辚 T5,jh藚 remote-filesusage: %s remote-files mgetUWVS}FhIE PEPu*E 0hV5(s` PnE hhj h趙 K>u5=(VE 0!=teFtL =CʋDt TO@u=0t P(=ut P*j19u =TuRhVPhYw =u>=Lut5TThnh~tTj5su ,ƃWjZ [^_onoffU帞}tand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: %s UVS,st+5lnhzuRhlj5(su[ 5(shۉI} =suQjה=,st5lnh5(s"[ 5(sh!| j蓔578tR5Ph\5(sZ 5tnPh5(sZ hhƒcu?hsw u=Pnu2=pnt5(sh\%q E ph'Pu (usage: %s local-directory Local directory now %s getcwd: %sU WVSUu  BBFt'6hN5(sN Pn~FPuPnv }"vh PnThSL tShi5(sM vh, PnF9t P [^_usage: %s remote-file DELE %sU}h{E PEPӸt}~&E 0h5(sZM PnE ph=NmdeleteUS}ChIE PEP^u'E 0hV5(sL PnE hhj9 Eh ;uy=tmSE 0qtXShdM=u>=Lut5TTh)h~%tTjju ;ÃZEPjl ]from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %sU}hE PEP϶t(}hE PEP譶t}~$E 0h5(s4K Pn.E phLuE phK-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:UWVSE] @C@Ch~&3h|5(sQJ Pn31t EuECEƿht"CPuPnCEƿht;8|t6CPһtsh藺u Pn,jjhssEPqa5(s蓪 C;Et P E9Et EPt e[^_Ðusage: %s remote-files local-file U WV}hIE PEP1t"}Dh{E PEPu(E 0h<5(sH PnWMU DEEDuht2E8|t*EPltuh1tE hhj EhS  zuEwEajjEPE 4uh_ =u>=Lut55TTE 0h~臸t5TG=t EH9rEPj E;Et Pv e^_SHELL/bin/shsh-c%sTry again laterUWVSjjp ǃjjb ƃ lc ÅzS C~jj* jj h1u u Dž7j/Pc Ãuƅ-hCSP譻 E޺?1t tƅ+=t65(sPg 5(sj l 5(s }~)j5@hBWPY jWPpY WhEv Pnj1 ~P 9uWj Vj uhHSv Pn Pn[^_usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. U`WS1}hqE PEP諯Ev)E 0h|5(s1D PnE phE}h֬ ‹E PEE phDuu}T5(she 5(sҤ hjO]Sg ډװшD E X EE p hʣ\Dt5(shң$e )u}uE p hʣD,se[_PWDPWD command not recognized, trying XPWD. XPWDUSpnpnhZCu,=Pnu 5(sh|Ud h`Cpn]Local directory %s getcwdUShS@ tSh5(sA h#/s Pndirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sU}hE PEP裬t}~&E 0h5(s*A Pn[E ph Bu>=Pnu2=pnt5(shb E phARMD %sRMD command not recognized, trying XRMD. XRMD %sU}hE PEP裫t}~&E 0h5(s*@ Pn[E ph Au>=Pnu2=pnt5(sha E ph@command line to sendusage: %s line-to-send U}@hE PEPǪu$E 0h5(sT? Pnu uhhzarguments to SITE commandSITEU}@h-E PEPGu$E 0h5(s> Pnu uhGÐU WVSu huW E~oэQ7)PE4:Pij EэQC9}w~ Ƅ* BvEPhE> j At[^_modefile-nameusage: %s mode file-name SITE CHMOD %s %sU}hE PEPϨt(}hE PEP譨t}~$E 0h5(s4= PnE pph>SITE UMASKSITE UMASK %sUSE pnpnp[}uPP=pn]SITE IDLESITE IDLE %sUSE pnpnp}uPj=pn]HELPHELP %sUSE pnpnp }uP=pn]ÐU=,stjj9jpu=,stjjj藾 QUITU=,stSh<8t P 8,s@U=su (uusage: %s [password] Account:UUE ~#0h5(s ; Pn,u@h&ˣ Phʣ;Uj =su j:t=,sthn hnj tjhds commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. U WVS}EhE PEP<u)E 0h5(s9 PnE pbEu/5(shx[ 5(s貚 UPn}u5(sh#Ex u35(sh6([ 5(sb Pn2hdgr tPn hji Ãjmr Uz tQ=,suH5(shۉZ 5(sۙ j-rSj PnhOh ƃ~)װ)QPRs E PEHPUB Ѓ=,st hn hnjqSjm e[^_Case mappingUh{hu uPnCarriage Return strippingUhh\u uyPnNtrans off. UVS]u u)05(sh(Y 0PnY0P0УPnjvh n腬 nu jvhZ e[^UWVSdH1=tGt~M9tc11Ҋ nEtBE:Eu9}/$B nt8Eu9} CuCA9udH[^_Nmap off. mapoutusage: %s [mapin mapout] USEu-u5(sh3W uPnh>E PEPt}~)E 0hE5(s5 PnuPnj 5@t Ã=stC; t@j SM Ãh5@hԎ腪 C; thShg ]nmap: unbalanced brackets. U|WVS]ԎE1M@~E8tt>to<$t<\uBF8tA]~0~2FF8t&ωE\(ܐCt8Vu\(F:t1t;tC>tF;t>uu;t EUdLdL=%1[t3$\~FF$ulVDt\F>0uU:&BC:u <|)T)܍};9BC;9u,]\uFn$u_VDtOF>0uU:tIBC:u; <|)t'T)܍};9tBC;9u t FCt<,t<]v>u5(shz^T Nt" >\u~tFFt<]u>u뽐F<,<]tlNVDtPF>0uU:tEBC:u6 <|)t"T)܍};9tBC;9u CF>=dLtdLEx[^_Passive modeU1=pntƶPhtnu u]PnStore uniqueUhh0su u-PnReceive uniqueUh2hsu uPnCDUPCDUP command not recognized, trying XCUP. XCUPUhf1u8=Pnu,=pnt5(sh|]R he1u (Ðrestart: offset not specified. restart: invalid offset. Restarting at %qd. Execute get, put orappend to initiate transfer UVS}t5(shQ kj EPE p|c LUPUutE8t5(sh<>Q VSh\5(s>/ LU5PUe[^SYSTUh50ÐLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. U WVS=(uu5(sh\ }hE PEP t}~ E 0h5(s- =Tt5(shXO jE p(usPŢ (uƂsuHsTuN5(shN PnNNs(uPn0Ds@s(us4TtrBHJȅ}R蟼 ]؈< u!(u;48b~WFTuFPVЅ}V/  tuăt6FHNȅ}V  t띐 u5(sh<M Pne[^_filenameusage: %s filename %s %qd UVS}hE PEP蹖t}~$E 0h5(s@+ PnBjE p̝ÉփutVSE phͼ5(s* Pne[^%s %sU}hE PEPt}~&E 0h5(s* PnNjE p脞Et)EP8 PF PE phu5(sL* EPnSTAT %sSTATUE p&}~P+ÐLocal file "%s" is newer than remote file "%s". US] hjSutssh\5(s) ]PAGERmoreCan't allocate memory for $PAGER|%sUWVS}hE PEP茔t}~'E 0h5(s) Pn'E PUPuPnh̾诡 Ãt;uҾ߰эAP^ ƃuhܾj ShVuI LU$U=pnpn$LUPUjjhE pVh@$VR LUPUU$=pnE @9Et P e[^_?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. UWVSDž0Dž,}.hhE PEP衐uE 0hsbDž4s 44;(u}j SE p质 uы4; (uu+E ph5(s$ Pnh8(P>B 4$$$s;ssDt CDu;$t\CC DtC1 |BCDuKE9|kE tVxA E |:{iuFDž,C0;U}3E 4VAA E 0<эtF;t C;2v4s0 vǃu5(sh$E =Pnu$5(shE Pn t.=,su%5(shD Pn=pnt&5(shD 5(sj 8 4s05ԖG Ѓ=4t:t4(sBHJȅ};B| RjB (Ph? yuԖE4sE $4s9t C9,t00;U?[^_unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 Requesting %s Can't allocate memory.:GET /%s HTTP/1.0 Host: [%s]%s%s GET /%s HTTP/1.0 Host: %s%s%s Writing HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sUWVSuDžEDž11EP; uhj jh R= u jh Pb= u Mjh Q.= u  Rhjj t$vj/P $t8u-URhg$$t $8u URhT2t $QA  t 8u URh } M Q2: uhjZ jhP; u 9jhQ; tE PhQ t 9uE Ph $B/j/QQ $t8t $Lj$RG E܋E܃u$QhL XPEP u\n`n\n`n $tBhh P }) Rh&tK   ZDžh$n\S t% Pj^ hjI ܖƉjݐ ,ܖ ),Ã,t',RSQX  uȃ=$tk=؅ub<(sBHJȅ};B| #Rj#a9 ס9 u;5ܖv5(sz hSEP ,=$=؅ =ܖ9 u:;ܖv2(sBHJȅ};B| #Rj#8 (sBHJȅ|  Rj a8 5(s y ,th?I j8[u-j]P4 tPt:u@ j:P4 ÃtC=t, R$QSPht5(s0 }1EE߅u=s4VEPWRVq u2;=su*jPhj 8SM VMQSPq t$RP< PhfE4jjjhSvv5 Sh5(sD v vvoX E܋E܃ u DžnvvEPX |+jj SjjvvB5 1u95=P/!tEP菕 EDžv(4 E܃}QhF GtK=pntE PURh5(sB $QhhP =pntEPh5(s j:R Q 3 Ãuhj6 j%Sɉ tuPtPS$Ph4hP S薋 FuPtPR$QhthP ߰I,QSEP ;,shE 1CE9s%jSEPے O< t< uEj V薈 Ã)CjhS tShƅ+ +CE9s.jSEPC < t< uŀ+ uEC;f|PcujhS2 uπ;trj S踇 0Gj 0PS"Y \n`n`n=\n08\n`n $tAhh Q@ }( Ph&C ZDžh$nJ t%fPj Mhj ܖƉjy , ܖ ),Ã,t',PSR uȃ=$tk=؅ub<(sBHJȅ};B| #Rj#0 ס9 u;5ܖv5(sq hSEP蔏 ,=$=؅ =ܖ9 u:;ܖv2(sBHJȅ};B| #Rj#)0 (sBHJȅ|  Rj / 5(sp ,th@ Bj袆\nu =`nt<9ܖu `n9t'=pn5(sh0 =pnt5(shQ0 Pj\ EP蠎 Z 9tP tRԅ  Q… 1hA Ph4? . Rh4? QhTT? E܃tEP tP6  R$ [^_ http fetch aborted. Uj 5(sh/ 5(sn jh$nF file fetch aborted. Uj贑5(sh-/ 5(sgn jh$nF ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetULWVSEhnpE t!=,st jjHE@+hD7ja hd7j R h<詄 hF薄 Dž DžDž1DžEU 4) uhTjϛ jhPF+ tjhR)+ u.EPRPjhR* t,EPRPZKj/W ƃj@W Ãj:W~ tct_9s[t9sSP{tzttxuEU 4hzt(j:W Ãt.t*C9s1j:P~ ƃd?[t1Ft+>t&j/V& t @1=t+RVSWPRh5(s3 hdPW趍 WhdP& =,stjj=8E}Et;t]E ut  uEPRl u,st#u>PRWpu Wh9 E@jjHEEEEPjB=(Dž1=<tUt>thVM t*8thPL t Džt8>t3u/EuEEPj蜷=(t :uDž=pnt&PuPh5(s  t*RVhhSd EEEu t.TTE EPj补T&}tUUEEPR PnQ)ƒt E@Re} E@Eu&E;E}j:EU 4{ T=,stt jj[^_:/US]jhS% t@jhS% t)jhS% thSc" t1]unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockoptUlWVSDžn,u1}EEEE썅PMQE PMQx^ Ãƅu uj1u 'uju /ujPh$j P# t PMQPEP] ÃtGuM QEPh44 S+) PMQhMh4 Pn>xthphEPhdQvx cRlndQxt7jjjhSww" ShT5(s w wwD ƃ}DžbzwwVEE Ã} =P/!t߅t]t1jjjhSwwy! ShiO3 DžVŁ }2Qh3 Pnz wwh,uy Gy DžPhsV+D } h2 PnE=-uu7DžjPjjVcC }hC2 hV hV׏ 8 = tuh1 7=pnt5lnh5(s j~9 t Po 8t PZ PnODžjPhhVnB }=t hE1 ln V 1[^_ÐUj0(sBHJȅ|  Rj  5(s` DU=HUtjh\s8 ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUITU WVS}DU=5(sh u jWho u5(sh ?jWh @ u5(shV VW5(s (sBHJȅ|  Rj  5(sL_ =8u h8+/ Pn1hj]| Íu VW58D 58h[ 58^ ^Pƃ=DUtt jӃSj{ e[^_%c%c%c421 Service not available, remote server has closed connection. %s:U,WVSDžDžDžDžԒhj { DžPnDž15 B Ãl5  ÃSh';5  ÃShhh58 $58\ FuN}\J=pnt!5(sh8k 5(s\ Pn6 pn~~5uu~p=̎ug=hnt*t u u5lnhy5(s (sBHJȅ} ;B| t RS.  ӡDtPnDCУPnu/Pnw Džu Džd~"uӡDt Džu- t)tDždu(u Džu-ut PnuE9sG5 跋 à Mpn~Q5uH=̎u?(sBHJȅ|  RS 5(suZ u6)ÁvSQhnn ƃnt&Pn;t1t Pj)w =Pnt uG=DUt"tt jы,Pjv Pn1[^_UE EE@Pjjuj l: Ð send aborted waiting for remote to finish abort. Uj|DU5(shxi 5(sX jhr0 sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutUWVSEUXDžܖ\n`n؅=pntK}tE} tU :-tRh5(sl }tMQh5(sL =st]SE PUR3 9ntjPLDžDžDž|DžDžxhr"/ =tj=u@U|P\u @UtQjs |t|Sj s tPjs ؅Pn hjs h!jls u 1t  u'Dž=؅؅M 9|jj s |h] CS= u3Sh% Sjr |Pj r h=؅u ؅Dž2hM Q@ uF] Sh!% PjLr Rj8r Pn/ DždzEPAPX |E%f=tZ] Sh(5(s[ Pjq Rjq 􋍐Q. Pn EЋUԣ\n`nt^Sjmq Pj\q |t|Rj ?q Pn ؅Thr+ LU PU1u?tuDnuj5LUQ> 0|,'|"jLUPURPBPq }SM Qh# LUPU؅0􋅐Pe5LUhItLUPULUPUDžxR}MQ]ShV+Pjo Rjyo ؅ |t|Sj Po F􋅐P~MQhtsSj o Pjn ؅ |t|Qj n 􋝐SxQ(jBgjj rn | nv1P/!ܖ)~VSBPn ǃڃ=$=؅t =`nE9fE9uE;ܖwTE(sBHJȅ};B| #Rj#e EUډEU덃5(sP hSBPm ƃ=$=؅t =`n =ܖ9 u9;ܖv1(sBHJȅ};B| #Rj# (sBXZ؅|  Rj Y 5(sO }E Ph W xE9uE;ܖE(sBHJȅ};B| #Rj# 5(sN EUډEU=$t#=؅t =`n}E9]C @CPSЅ};C| Sj + ܖBHJȅ};C|< t RV ܖ􋝐Sb~ ƃ=$=؅t =`nE9E9uCE;ܖwE3(sBHJȅ};B| #Rj#5 (sBXZ؅|  Rj 5(sL @ @tU Rh A @t-=P/! th\ ܖjrb؅t􋅐P҃􋍌Q| jSjWi PjFi |t|Rj )i =ܖjiQjh Sjh ؅ |t|Rj h =uPn@U|Pi @Ut􋍌Q{ jPntt􋝐S҃ u=ܖt jhX[^_Ð receive aborted waiting for remote to finish abort. UjmDU5(sh 5(sJ jhr\" receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUWVSE tDžpDžlDždEUXܖE\n`n؅| ԅxuEEtf=pnt]}tWtt.}u t>-ttPh5(s }tURh5(s =st#EtMQtVEPI$xDžhDž`Dž\1=\u EEhr =tjv=u@U|Pf @U`t`Rjd dtdQjtd |5؅xԅPnh0j=d `h!j(d d }u*tt:|jtQv( j/tVZ áP/!t/ t*Vhd `Pjc tj;ttttP' ǃt/}5tQh `Vjc dP|=suh=P/! uRhtR肄 }7tQh `Vjb dP=s=P/! tR&tuf`Qjab dV=st;tP&tu`Rjb dQ}Eu=ntGjjt69ntjPtjuVU\n`n,t4`Pja dRja Pn hrC ` Et,LU PUt5LUhIm }t?MQuVhVt?`Pj` dR[ MQh[! hl }tuDžpLԅt:|umjj Y` \htCSb* p u ShW=؅u ؅ԅDžh2EMQtV- puVh DžhdzEPpBPoF |}uEdR9EvUhRt P/X uW hRu!h  dR6ẸdRE%f=t=؅u ؅ԅjWnsjaLU PUt*jLUPURPpBP.` 1P/!1VhRPpBP^ u =P/! t)9|ʅؙܖ=$=؅t =`nE9gE9uE;ܖwUE쐐(sBHJȅ};B| #Rj# EUډEU댃5(sB@ 5dR5hRlFP0^ Ã=$=؅t =`n =ܖ9 u9;ܖv1(sBHJȅ};B| #Rj# (sBpr|  Rj 5(sT? }-=P/! thG ܖ9}tPtRh LU PURjjpQ) |S5LU~&pPuo t+ uCC9|܃jjpR) tQhf |5؅xԅhpRh 0E@E$E9uE;ܖE(sBpr};B| #Rj# 5(s= EUډEU=$t#=؅t =`n}E9]ܖlPn à uEtPpB @BHJȅ};B|p pPj  tQtZ MpBHJȅ}p;F| tpRS ܖlQNm ÃPEt-EPh5(s 5(sh =$=؅t =`nE9E9uCE;ܖwE3(sBpr};B| #Rj# (sBHJȅ|  Rj 5(s; lF @t-=P/! thk ܖp@ @ttRh4 j'Q| ؅x5ԅhtpPh҃`QjX dVjX \t\Pj W lR]k jo E u=ܖt jX=ԅhdzjMQLEj EUEBRtV kEP P PVh85(s B|؅xԅ\t\Qj V jjV =u4Pn`VjV dPjV lRUPn@U|PW @UhtptpQhփltlPi  u=ܖt jV`RjU dQjU H[^_Ðuse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dUWVSDžlEDžh=su&sf=tf=uh8 =tn sX\`sjj sP ‰@U}Ihb 5@US @UtnTncdnt-jEPjhR= }ha  stH==nDžhvhPË Pngfff)ƒu#t5(sh7 n=t5(sh DžhrDžhvhQË Pngfff)ƒu#t5(sh txDžhhRÃtN=Tnt15@U#Q @UtnTn5(shh; h= st5(sh8 Pngfff)ƒut5(shxuEPVUEPEPEPRhhԒw t5(sh>1` s sUE E E ffsfEfV ffs,h Pngfff)ƒut5(sh| stuEPVEPUEPEPEPR|PxPhhԒPv 0 t5(sh xu|u}t5(sh81\ s sUE E E ffsfEfV ffsuEPVEPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPR|PxPhXhԒ0u `t5(shxu|u}t5(sh81X s ssUE E E ffsUE E E ffQUE E E ffQUE E E ffQ fEfV ffs hvE Pngfff)ƒut5(shltwPUdEPvPuPVhhԒ]s utF8uF8uF8t5(sh ; s,u󥋕dBffs$=P/!t=Tnhg sPh s5@U | ss=t fs@Ut P1K jj sP ‰@U}hbr m=u+jEPjhRY }h sPh s5@U } hndnt2jEPjh5@U }ha DžppPh s5@U1 }h yj5@Ui }hl = st t!==n= sujjjj.uV sPh s tYsfPVShÃn=t5(shA  st tIssPsPBPBPBPsPhà ssPsPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPsPjjhqÃ`u"=uDžllt = su3EjEPjj5@U= } h 115@UG @Ult 8[^_acceptU0VSusE=tnEPEP5@Ug Ã}+h  5@UG @U1_5@UF @U}u1EjEPjjS= }h V5@UU e[^USP/! u=ܖt jFP/!]ÐUjJDUUWVS]DUh!jD Et%=s[ElRs#=slRE[s,sU,slnthPCPI; ƃCM ln ,u,uu 󥍻s󥿄su <U< 8@@8DDnHHnLL0sPP0ssTTsXX0\\0jh n`P9 ƃpE`Ph n jhqP9 ƃEqPh uMuhhԎPy9 ƃEPhԎ hhPC9 ƃ EPhJ EPjB =DUtDUjUҍe[^_UjG(sBHJȅ|  Rj 5(sX$ 8sDUjh\s{ STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortU HUu1t t=su j%uu=st ju=uuEu{E PMQhVt#j;=t jj=8st PnEPj=sP=EuvM QEPhVtYj=t jQjp=8st PnMQj<= =t j=sP=t~}1 XU܉ك j R**}h%t =8st Pn j+j! =st j{jn=8st PnEPj:< e[^_resetU0WS]1󫐡 Pу jSRǃ}!h* PnM tjVe[_runique: can't find unique file name. UWVS}j/W EE1tj9t t P ƃt/}1Wh 15(sh8+e 1Wh|e |eэAƀ|e.}e}0uC<.uC1CKu9E}dtEC<9uE0Ejh|e ƃ}|ee[^_ÐLost control connection for abort.%cABOR U,WVS=8u/h, =8st Pnc xhhhhV5 jjV8@PT th%M hh,58 58 1 Pу  }tEPу j Wg*}h% =8st PnV }t5UBthVMAPb9 j-u=Pn(u jj[^_ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... U,WVSEU 2 DžDžs.s.h.H1 u .<T utnTnԅpn؅4snh.0 ƒ.utnTnп.utnTnbп.u@п.utnTnRh.& 58. u h./ t8u /=t$8uh / hO/X/ 1ۃt9T/t&Y/tֿ_/uP Lut pn(sLZP IA+4؅%B5$2344444444444444\44444444444444444344344343444344D44h44444Tntn  dn<T؅ uh/!ƿu/(stnTnoh/!sa h/!DtQFL ̎9hw/jED spnpn hb/RQtA ƒ)4s\c …tR̖ u Pd t BrPr j6h`lj61 71ެt;VPR0P05 hn t j5 hD7j0 hd7j 0 8AADž P@P=̎t@=,su7(u5(sh/ 5̎9 =,st̎hn t#hD7j/ hd7j / VUjl5jhn} USP/!jE5=,stl8t*j@P!N 58B 8 @U|&jPM 5@UT0 @U ,sj=,st=8t*j@PM 585B 8 ,shnjP/!]ftp> Ue8sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. UW}(sBHJȅ| }Rj hA< ui=ua5(shv8 BHJȅ}R>  kua=Ԗ4s0aǃu5(sh84u5(sh8 t"=,su5(sh8B l,4s05ԖG Ѓ=4t7t1(sBHJȅ};B| RjU  =uw=Lut%5(sP 5(s hhh|F ujjqװу"hD7j+ hd7j + }ÐUWVS}u1yE1ELOLOtDB8u9t?AB8t9u);E~ E];EuFu E [^_ÐUSnHuxn4s@Ԗ Ԗ!ÃS54s u݋]!$UVS1ۋ n5Hu!t$uOxnt t0>xnAn<9!<xn @ t  uAxnt txnxn @ tI tC t>"uA\uAt(@A͐t"uA뾐@A吅t@Hu nt3xntt xnxn@1[^Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s U WVSu^ Ã~==stv=Ph=5(s! LOT9s9t=st t PSa TLO9rʃSE,jS jE E Sbǃu Sh=uSh=5(s|  w7j h=5(sZ Ne[^_Ðusage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file U8PPPPh,?h jQ+ macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sU|WVSDžh!@- Ãu1߰эA=vj?v PSh0@6 ȃSh&@S h>@Sm |iu=P/!tSh@@ 뀃hS# }ƅj.S DžC@t tDžR _hiUR (hi5ln  j.5ln ÃtIPS u2ln)RhiP u+lnij.UR ÃPS@ +]ShiURh mi`@ t bU u&i߰Q U hiPN( E 0tD@ t-P|i@P | ? ]U:Qi߰Q UhP|i@P[ | ?+E8i߰Q USPS =s5|i4 t t tރt u5(sh,A(uss1 CF+5|i)4 ѡDt̃g t$5|i3 @ u߃2(uu)sTu3(uSs(uhDs@s(usTtA5|i^3  < u {tCTuʁTu+5(shAhihA& t: t5*_hl@ h@R5|i2 a5(shLA5(shAi hl@ h@ 5|iQ2 x[^_ÐUS|i@ `5|i"2 ƒBv܃ t׃,t҃i"u?\u5|i1 ƒC5|i1 ƒt`"uYii\u5|i1 ƒC5|iw1 ƒt t t t,u=iu 1 u5(sh,LT 5pne[^_anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initU|WVSDžDžDž} u6PEPE PEP4}Pn1} t }=1C󫪍@{ E u% P u E PE hV! u hPh SvR ]E P E P ƅum P t0tVEPhPMQh'P5(s腖 EhjO]SG/ ߰шD }uu ] } ku h3P/ul}uh;P EuhEPu;uhMP hVP辖u)uYtOPhVP蕖t9h^P =Džt=sug,s11@;(u}HlPsuݡqPuPfA4s05ԖXox[^_sorry, arguments too long. (%s) U WVS֍^v5(shS^ QuhS5(sT ƃ h)PW - uэ\ ~C uƀCԖM;ȋE4sE ȍe[^_TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.U WVSu=u@=<umVP$ V=<u7=mu5mmPmPu m=V#hT ƒuTװэYA |/t A=w %=vj?3 PhT 1RWP |/t;/CTT+B+B+B f+ WwM }WhT 눃P pn}tpn pn$$} t=sP~UjjP6WhUӨ U>uۋ PnQ)ƒt}t Un} t=sPpn$hUS VSK =Vu0}u5(sh,U NUlU>5Vhhi( u5V! Vj hi …ti[^_%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! UVS]u =T=,VShX5(sǎ 5(s hhP|' u 1DPfnt fat5Sfpt fyt`BT5(shX+ =,ShX5(s h,Y5(s ([^%s: not foundU@WS]=<t`}1 }Wjh 3 u}u3hoZ轾 W 1E0跫 W e[_SIZE %sU WVS=pn=u pnuh[ uPj hn) ƒtjBj EPR É֋E8tNDu?3} t,=u#5(shn莮 5(sj & =pn؉e[^_MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. ULWVSpn5Pn=u=pnuh[njnnDu GDtGDujh[W) u!h[5(sS  G2G0EPEPEPEPEPEPh)\hn.2 }1 EЉEԋẺE؋EȉE܋EĉEEHEMMEEPߤ ǃu)} u =thnhF\5(s袊 :}5} t,=u#5(shnb 5(sj  pnu5Pne[^_ÐUS=Vu s) V1ۃEPhwt@j tV9E؉؋]ÐUSP/!u =؅u jP/!] KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETA.AULWVS}u>jhn+c nnmmLUPUmnjPb =؅1`n$ܖ LU PU \ntPЉȉ \n`nSQRP* d}1ۃd~dSh^hVC $u~wQ뉕)h^+Qh^QhG_Ѹ)PэDPB Dž  uv v܃^B<: u P:PSQhQ_Ѹ)PэDPA m)‰mS)‰ЉA}A@Bn9u`;mvRmmmn~nAnDžn)‰nY)É؉B}B@BۅݝB5_܅ݕ}\ٽff f٭۝٭ųʉ )tRh]_ hb_Ѹ)PэDP&@ ݅ٽff f٭۝٭ųʉ )+)<Sы )Phf_ء u5=ܖt,ܝt`n9u;\nv ht_~?h_Ѹ)PэDP> \n`n+LUPU-ܖܵ߭ܥٽff f٭۝٭ųډ )tQh]_ hb_Ѹ)PэDP= ųډ )+)É<ؙSы )Ph_װѸ)PװэD P<= װэAPR(s@P }u!hd^j j E}uP?UWVS=pnu }j]SZ nU)‰||n[)É؉B}|B@B|EB5gEܖEUmE@t}fMf fMm}EUm1ۅ u =vYgtWgQEUmt g g$$5X[g=ܖu=u^PܖRPhlgjdUxR۽`: 0ۭ`}^O=ܖBE0 `n"ܖptLU5PUpt9u ;\n߭p\n`n)EUm}fUf fUm]]mų  )щ))ƻ<WӍ)PQhgxѸe)PxыxD PN9 ؃UװэAPR}u (s@P H[^_ÐU,WVSEEEP9Us,MM<эY;]~]E9UrփEe$u}ƅuUBH1EE9EE9uMMMEE萋UMvhnj$ GhBnWV )ƍ<t E |t[j tLt6t-|t$P|PډX hnj} 1EPpPthnjM upRP jxPP Ã}h'ojϏ lRjjSS. tPjjjjlRpP tttRpPtjjjjtRpP1X[^_Abort program without saving current changesabortQuit edit of current MBR, saving current changesquitExit edit of current MBR, without saving changesexitWrite loaded MBR to diskwritePrint loaded MBR partition tableprintSelect extended partition table entry MBRselectUpdate machine code in loaded MBRupdateFlag given table entry as bootableflagEdit given table entryeditEdit current drive statsdiskRe-initialize loaded MBR (to defaults)reinitShow entire OpenBSD man page for fdiskmanualCommand help listhelp ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR?MBR is unchanged U WVS]} WS hLus h vVt7j3ƃSW SjjVWVJ h+v 1[^_Enter 'help' for information fdisk:%c%d> ?Invalid command '%s'. Try 'help'. Writing current MBR to disk. Aborting changes to current MBR. UWVS]uDDž(VjE0 WEURP R  P RVSEURPWUR $hv躨 (,5D =Pt*Phvu hL P,tDž$=Vt3V1ېR4誌 ;t $<u׋vu Dž$$RVuPh w踧 PRČ EPU RPURPVЃ t,t'u PP=Ptxufh0w- jU2 PR PEURP R  P, hlwǦ D1[^_Offset: %d UWVSjE0%DžDžURc RÉVSR WRPVSREP(Rh(z WL Dž 1ҹ<t<uu$Iyσ6􋕘Rh[^_eof UlWVSuhjd]S uhp{j7 ߰шD ht{S` <ht{W 8Cj WFP ht{S+ <jdWFP 1e[^_%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) '%s' is not a valid number. '%d' is out of range. U|WVSu]EE}} uWEPVEPh!|WEPVEPh5| }thI| hjdS8 uhp{j ߰шD }t}?u E`] } uPEPS诱 NjE9u}8tShW|U ~9|;}~Wht|9 9;}x[^_%s [n] U WVSuh} hL BHJȉׅ}WL à tCtHFPVЅ}W  tuȃtuhp{jW 1ytYue[^_ÐUEff@ ÐUUE fBUU B B B UUE BBB%s%s is not a character device or a regular fileUpVSujju VÃ}Vh$j EPS }Vh$j E%f= tf=tVhDjā ؍e[^ÐUu# DIOCGDINFOUVS1ۃju>ƃ|qj ÃlPhedAV }h0 S# 1ۃ #CCC VL؍X[^sysctl(machdep.chr2blk)sysctlUVSjuÃEPS SDžpDžtExDžljjlVhPjpS[ }hih hDžpDžtDžx|Džl jjVEPjS |*j 4 ËEMKUS‰C hԀ苗 1X[^ÐUVS]u 3C3Cts 1(tC 򐐐{ uCtC { uٸe[^Disk: %s geometry: %d/%d/%d [%d sectors] geometry: US]3h C tp pp0hɝ hł距 1]UME ƀƀƀ8ƀ\fǀ`Uƀ]ǀ@ǀ<ǀDQ JLQ RJHQ RPj<PQÐU WVS] {u nEUCS UMKE PE PfE Pf`1u ƾWSEURPUMQRVMQ $G~Սe[^_ÐU WVS} unEE PTUPE PM`PE P]u ƾVURRPUBR RPS] $OyՍe[^_Signatures: 0x%X,0x%X UVS]`Ph7f jj 1 SV $F~e[^ÐU WVS}] u jVSW 9u9uhuW =u1e[^_U WVS}] u jVSWI 9u19u-huW) =ujhsd W 1e[^_BBT (Bad Blocks Table)BBT DOS 3.3+ SecondaryDOS 3.3+ SecBeOS for IntelBeOS/i386 Concurrent CPM or C.DOS or CTOSCPM/C.DOS/C*BSDI BSD/386 swapBSDI swap BSDI BSD/386 filesystemBSDI filesy*NetBSDNetBSD NEXTSTEPNEXTSTEP OpenBSDOpenBSD FreeBSDFreeBSD Phoenix NoteBIOS save-to-diskNotebookSaveAmoeba bad block tableAmoeba BBT Amoeba filesystemAmoeba file*Linux filesystemLinux files*Linux swapLinux swap Minix 1.4b ... 1.5.10Minix (new) Minix 1.1 ... 1.4aMinix (old) PCIXPCIX Novell Netware 3.xxNetware 3.xxNovell Netware 2.xxNetware 2.xxISC, System V/386, GNU HURD or MachISC, HURD, *SpeedSpeed GBGB OntrackOntrack CP/M or Microport SysV/ATCP/M or SysVDMDM QNX 4.2 TertiaryQNX 4.2 Ter QNX 4.2 SecondaryQNX 4.2 Sec QNX 4.2 PrimaryQNX 4.2 Pri VENIX 286VENIX 286 Plan 9Plan 9 Compaq DiagnosticsCompaq Diag.OPUSOPUS Extended DOS LBA-mappedExtended LBAPrimary DOS w/ 16-bit FAT, CHS-mappedPrimary Win95 w/ 32-bit FAT LBA-mappedWin95 FAT32LPrimary Win95 w/ 32-bit FATWin95 FAT-32OS/2 Boot Manager or OPUSOS/2 BootmgrAIX boot partition or CoherentAIX/CoherentAIX filesystemAIX fs OS/2 HPFS, QNX-2 or Advanced UNIXHPFS/QNX/AUXPrimary 'big' DOS (> 32MB)DOS > 32MB Extended DOSPrimary DOS with 16 bit FATDOS FAT-16 XENIX /usr filesystemXENIX /usr XENIX / filesystemXENIX / Primary DOS with 12 bit FATDOS FAT-12 unusedunused Choose from the following Partition id values: %02X %s %02X %s %02X %s %02X %s U WVShƓ EPW|WW|WVVhԌ{ E* 5wW|Wh hG  E}|e[^_ÐUVSu1ɻ|WW1Ґ94u A5vZ[^ÐU WVS] U B CC$??J%S Ћu F N!CF C$?ƒ?V%S ЉFtuuuS`M ACPLu Fu$VuCe[^_ÐUE8'x?!xx x? x~1ÐCylinder values are modified to fit in CHS. Warning CHS values out of bounds only saving LBA values U@VSu]E܋NMF=‰UF EMF=‰UVuFEPt3E܉EFEFEF EFEFh运 F!<t<u EUE UEԉU؃VgtTF CCV?F%ˆCFCF!CF CV?F%ˆCFC7F CCCCF!CCCChD F+EPSvCP e[^Ð Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ------------------------------------------------------------------------- %c%1d: %.2X %4d %3d %3d - %5d %3d %3d [%10d - %10d] %s US] u*h襎 hD蘎 h苎 IC!PSPssss ss3sC!Pu { u*Ph@ ]ÐStart of partition #%d after end!U WVSE} @ HP_\_WO tw9~uh茆 _)Fwe[^_ÐOnly LBA values are valid in starting cylinder for partition #%d. Only LBA values are valid in ending cylinder for partition #%d. UWVSE@ PUXE @EU BpE)EE}EE)EE@E~URhD背 E xUUP)މ}ËU)Fu~EPh1 U zZ EBe[^_In memory copy is initialized to: Offset: %d Use 'write' to update disk. U WVS} uSuHVjjjjSWu(VWhĔ~ EPhm VhW [^_Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsUS] Sh t}jhjC 0jht‹C jhjC pjhO‹C Pjj?jC pjhŕ,‹C PS BBB ]ÐInvalid argument: %s Invalid partition number. Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeUWVSMQDuAPhAP Ãvh詈 WۋEjjWShhjG!Pjh G! 9tW!u 1 Sh( h$<U B IMPJU@EjQjwjhEƒ ;WtWjMQj7jh\]ƒ ;tjEPjwjho3ƒ ;WtWjURjwjhƒ ;WtWjMQjw jhƒ ;W tW jEPjwjhƒ ;WtWSWU RSWM QjU B p jwjh]ƒ ;WtWM A @ )ЋW9}9vƒjRjwjhΗƒ ;WtWSWE PVe[^_ÐPartition %d is not an extended partition. Loop to offset 0! Not selected. Selected extended partition %d New MBR at offset %d. UVSMuQDuAPhAP4 00<t<t RhT=ZuZt9Rh$ ShD ZRPؙRPuu h迄 e[^ÐUVSu]u Sh艄 Ve[^Writing MBR at offset %d. U WVS] uVhh8 j3ǃSEPSRPW/WV [^_ÐUÐUj4 U1 %s %s UVSE;t"1t343h蜃  <3ue[^Machine code updated. UWV}unhXC e^_Partition %d marked active. UVSMuQDuAPhAP Ãvhɂ A1ɍ9u Ƅ0$A~Sh膂 e[^/usr/bin/lessPAGERwU WVSbjj N ƃhp t8tÃhvSG Ãt,SjZװэAPR S͓ Vj e[^_Uuu uݣ٣ԣΣǣdидDypf[TܶMGA6+p% 7L0̯Pޢh֢Тɢâ @xT4,,̮صinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0clearsasrcsadstsagiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastnwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup Xi i@ti ixldi i@i i@t8i i@tXi0itĞisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRUlWVSEE}GME E лƉuE лƉuEEлƉtƉuELлƉt"ƉuEELUл&Ɖu)LME }FjE 0jRhtԶ ME U܉Uuu}~_E}=pE$Ut%u 6P uދ}=pME pEB}}t#}~EuVjj jhth }ujhjZ plhj" (tP} 7 u;u*Tt!~{ uh)jx HK C=u.U Bu3hDjC PME L=u9u VtFu3h[j PRуEE P} 7у[ \ME }W=}u=}ujhu)}t% t*1_A=EܡE࡜E䡠E衤E졨E𡬞EEj"EPjj5ˀ hxo =tEEEEġEȡE̡EСEԃj"URjj5K } hx+o h==xtRjhtuv2 vv5" }"=P/!1u =}hn =}t@jht}w ײ w w5Ǽ }hwn j US]}9t?t5μ jjS* } }}]socketSIOCGIFFLAGSSIOCGIFMETRICUS]5}l}hjU Shi P }hm xCtShi 5諻 }h[m PCPSh~i 5l } C1]getifaddrs%s: no such interface UWVSEEEP thjT Eu}tjvEP Yjvht蠰 F xuT1H1jvSY V KPRQ詼 F xu9FESjEEvMQ F xu } u}txpt#F PC}G9uHjCЃ9}G=t&F PC9u jCЃ$;u܉}F xuE6{u }u#hthh9 jz e[^_UT}u xpRu@ Ðerror in parsing address string: %ssource and destination address families do not matchSIOCSIFPHYADDRaddress family not supportedUWS}1p@E䍅$P]Sju迒 tP+^ Ph(j PSju 莒 tP] Ph(j $P @@8Bthhjg Bt j@]Sr jhtS& $BPEPrJj BPEPr.j ShFi@5޶ hjx(S jhtS蟬 $BP8Pri BPTPri ShFix5Q }hhg $ [_invalid SAmissing SPIinvalid security protocolbad SPIbad security protocolSIOCSENCDSTSASIOCSENCSRCSASIOCSENCCLEARSAULWVSj4]S譌 jhtSS j/E P ƃuhֱjC F>/uhj( j/V轪 ǃuhֱj G?uhj EPjjE P軏 tP'[ Ph(j UȋBPEPrg uh j]SV ffE܋Eĉڅt t vEPhj;  ÉXe[^_Ð " @@ `IEEE802.11FDDItokenTokenRingetherEthernet####$$$$%%w%s%m&c&]'S'M(C(=)3)-*#*++ ,,,---..//0011CCDDEwErFgFacUcQdFdBee=951-)$DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect  @@@@@@``adhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexUľxtU;u@xuUVSE,yt6Áƃt %9u9uAyu׸d[^unknown %s media subtype: %sUVSu] SVh,uSVPhj轳 e[^strdup,unknown %s media option: %sU WVS1u 6A ƃuh/j2< %s U<WVSDžYƅƅh Sw jhtSȕ jjjzb }Gi DžHi P Gi DžHi ރVP5s ~~u W j!jjhSFPW? ~u DžVP5 |/~u W~ j!jjhSFPW> SPPhW [^_Ð `@no networkinsertedno ringactiveno carrier%s: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTflags metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: U %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sU VSj=}=P/!+hj1 jhth ECECEC Es Ph4P ,jhth賍 hh%i 5蟗 ޅ}:=P/!1th>DI CCC C8tE𣬡EFEFEF hh"i 5 }:=P/!1u!FFF hMH jhth輌 v Ph\O 08ffPhdO tE𣬡EFEFEF hh#i 5G }<=P/!1u#FFF hrG jhth FtP PhN TxL LhLj 6 e[^ÐUpxt ju@}ÐUUBf=uB f%BB B inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0%sinfty vltime U<WVS}j=}=P/!+Ohj. _SCj!jjhVGPS3 0t YShL t1HjhtP萉 Ph"i 5f }7=P/!1th E 1ƅƅPj!jjhSPQ2 0t YShK 1HjhtS計 Sh%i 5脒 }=P/!1t3h+D !jPPh@K 1HjhtS ShIi 5 }=P/!1tshC athJ thJ thJ thoJ tPhOJ =}71HjhtS 󥍵ShQi 5 } =P/!1h+B ~u j Ãh@I Ft*9|)P,IPhK hNWI hTJI t)9|)PIPhK hN I hH [^_UhTaSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%dU WSj=}=P/!+$hj) 1jhtS Sh!i 5 }PP/!1t/u1}@@@ hs@ jhth蔄 EEEEPBf%PBf%PGPGf%Ph(*G thh"i 5 }==P/!1u$CCC hM? jhth訃 ߃u}GPGf%PhN|F tt't#CPCf%PhXLF  TxL LhLj . e[_ ns %s UWSj^=}=P/!+hj& 1jhtS賂 Sh!i 5裌 }PP/!1t/u1}6@@@ h> jhth4  s ss~ PhE 0thh"i 5 }:=P/!1u!CCC hMs= jhth蔁 s ss Ph\vD 0 TxL LhLj 1, e[_ÐUE } ipx %s SNAP%7 frame %s UuSRh SRh> F? TT};d|L<LhLj FBJTЅ};d|L>LhLj>A% e[^_ÐUS]E }tBBPSjI tShGj ]ÐU WVS}u }j jWK =vWhGj˔ tCt=ujhCP肆 @CC CCS~ B)e[^_UWVSu 119}E8uA9} }<9t9uG1D}9tCJt!rtrJu E<uA9|[^_ÐAppleTalk does not use netmasks%u.%u%s: illegal addressUVSuC} uh(jP EPEPhHVɩ uEt=wEt=vVhNj EffCECe[^%hu-%hu%s: illegal net range: %u-%uUS]fE{fE{EPEPhS+ uEftUftf9vEPEPShjg fffffh]12%s: illegal phaseUWVEƿu d-ƿu dPhj e^_Ð atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeUS]=dudf=fuCfhffdPhf%Pff%PCPCf%Ph(8 ffKff9whfff9shhj蚐 dChfC ]ÐAttempt to set XNS netmask will be ineffectual U VSu }CEuP ECECEC u hh7 e[^ÐAttempt to set IPX netmask will be ineffectual U VSu  ~CEuP ECECEC }fC u hJ7 e[^ÐU WVS] ~Eu ƋE󥤃uUBB M Ae[^_ÐUu迖 Ðnegative NSEL length is absurdsetting NSEL length valid only for isoUuK }}h(jH ptfxthHj) ÐUUzt }BÐU5~5 ~5(~Ðusage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ dstsa address/spi/protocol ] [ srcsa address/spi/protocol ] [ clearsa address/spi/protocol ] [ giftunnel srcaddress dstaddress ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] Uh(h j} vlan: %d parent interface: %s U$Sj]S;Q hh:i 5y t,Ef}uttREPh2 ]SIOCGETVLANSIOCSETVLANU VSum ƣ,~0~j]SP hh:i 5Ay uh4j fuhh9i 5 y uh@j e[^Ðmust specify both vlan tag and deviceU$S=0~uhj蕉 j]SO hh:i 5dx uh4j! juS:n ,~fEhh9i 5x uh@j ]ÐU$Sj]SO hh:i 5w uh4j jSN fEhh9i 5w uh@jD ]%dd%dh%dm%ds%luUSTTuh)PS2 ؋]Uuu uinit: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsUWVSu} (q t'j1= Phh jy kv thh jjy j jht }hRhb }@h.ftsu~~Sh4h1WVÃu95thLjj hjjjj j jjjh8jjjjjhjjh ]jjjjjjjjj j j jjj]SLjSju EEEj]SjCt jSj6t jt jt jt 5~e[^_ÐUSEEEE]U t>Eu E EjEPRs Suŋ]US]UE t*Hv P/! !Bu[ÐUE Puj!m q j2 UE Pujl q ÐUE Pujl q ÐU~~~ ufatal signal: %sUS]SwPhj(2 SKx cannot get kernel security level: %sU$SEE@ EjjURURjPJv à tE5P/!.9 Ph؋]Ðcannot change kernel security level from %d to %d: %sUSD9]tKEE@ jURjjjPu u5P/!8 PuSh&]ÐUEUSEXSath`h`S`]can't open %s: %mcan't get %s for controlling terminal: %mUS]S蕏 j0 jS uSh jv PauShju ]/bin/sh-sh/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binPATHcan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingUWVSYYGa~ j ƅhe~DžjPjo Fjhth謓 VS ShDžaFVW Wh}j- j9s u3hVjjj ~ =~jPj ÃtS u=P/!tBhT9uu hjSm 9r=~t ~Yt= u$hGj, j#r h#~x[^_sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modereboot~U0VSo ƅEEEj]Sjj jSjj heENEQ1=~uYEEjEPjl EPhY~ hQhYhbjp u?hQhYh{jjj j) jEPj ÃtS u%=P/!tUhQhYh9uEu*hQhYhZjSi 9oUЃt2tNu)=~t uEEP踊 thQhYh42Eu(~h`hnhuXe[^session database close: %ssession database open: %sUȡt,P@Ѓt5P/!/ PhT jjjjj{ ȡ t1!5P/!n/ Phinsert %d: %sUEEMAEEE@ȡjPQRBЃt5P/!. PEphddelete %d: %sUS]CEUBȡjRP@Ѓt5P/!. Psh>]ÐUEEUB ȡjEPRQA ЅuE1 UWS]߰P^ ǃhpSՋ  u1hpj豋 Cue[_ÐUS]s^ CtP^ s^ CtPr^ s g^ S[^ ]/dev/%s%sU WVSuF t{>tv~tpj,] É1 C E >эAPm] C 6hJhPP VS uS1*C(}uġC$ MY(K$؍e[^_%s %scan't parse getty for port %scan't parse window for port %sU WVS]u CtP ] s] ~ҋ>э PV\ C6vhP sCu&sh!Ns\ C1e~tZCt Pr\ vd CP,C u&shTs3\ C1e[^_ÐU WVS15ġt*~t V^(V*ޅuġt!-PGWVhÃtH uL X e[^_Ðcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mUS]! ush4fu`EjEPjd Ȁ }h`PC P0g sC 0hjg ]Ðcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mUWVS}j EG ؅tEPr  ƃuwhttdtXua jEPu` tuua [u]a }1uO O 5u1a hjw裻 ƃ uAP/!t tu-jh]s$` s` je jh]s_ s` V` j G9E~&)E}whjW tWj; EjEPja GP0 wG0hj e e[^_USE=ġPÃSjjCPESjCC t2S$t C(B( C(ġS(tC$B$S.9SWu~@ Cj' CS]ÐUEt!t<t+t0~@ .~"~$ ~t  ~US~u jpġ Cj{ CS [(tG{uSbu~@ $jjj: t P9=~tա~]Ðport %s changed utmp index from %d to %dU WVS1ġc [(uG1ġ؋[(CP6^b uۀK 9;tW3sh ;F t~uK js\ Jc VSu5sh!OK js\ VWP5}A ƅ7E ġt#C u C jso\ [(uݸX e[^_Uġt H @(uX ÐU̡Ð shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advisedU VSġt"C $ C jsy[ [(u߃h`h huJjhQ ` ƒEEEj]SjZ jSjZ hejEPj\ jh hQhNhY< h hQhYh j` jEPRͰ Euu1ې4 jSZ u =P/!tm̡j ~u jjjf t Pe=̡u =P/! ũ=P/! tC~h \Vx e[^ USġt H @(uh`h huH1ۃ4 jkY u =P/!tj̡j t jjj~ t P}=̡u =P/! ũ=P/! tC~h t]Uuu umore-E-m-GMORELESS--help-?--version-V--VISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t optionU WVS] S58u  :K赪(#= tNh h hh*Q Pؐ0%MhQ P豐 }ud3uh#舐3& u.h0ƿ3tPGM}~<-t<+uzuut6jh6DP t8u(h=&P t8u DhGO pt8u pP1MxP3&jMyjt: uKiuVu,W%cUuWjUtj謆jNj =6i~jhdj 5= u jn5 QPt jL@(,=(u(xu j0&huUKTt j<je[^_ÐUVSu]Su VJ De[^ÐUWS]j߰Q,ǃSW e[_Cannot allocate memoryUu u ujh]膢jÐUE@ t tÐUS]} ԡԡjN=t=tVjSW /dev/ttyUVh>e[^_TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbcho|^home cursorll move cursor to lower left of screenalsrscroll backwardsU WVShjB uoPP;"wwBBh>ݙh>h=h= h=h=8 } 88X<~ Dž,Shv=,t(-!PhN=tu tPh$=xu x=u>= u5Ph<|Ph< =|u |=u Ph<Du t8uhDPhJ<H=t'u t8uhODPh;@u t8uh @Ph;<u t8u< Phr;Luu LPhD;Puu PPh;Tuu LTPh:Xuu PXPh:\uuL\P`*Ph:`u `PhV:duuLdPh*Ph:hu hPh9luu lh9u%Ph9pt8u pPh 9Ãuu<8u : jjP:P+ װщ h hRSg0Ph8à uu<:u ? HPjR:P װщ h h0RS8PhTm8à uuPhWG8ƒuu= t4hhZRSg448u [^_ÐUEÐUh,%5u8ÐU WVSu] >u;u0uE);tVǃS9|e[^_ÐU=u;Zw7/ y ؉}  )ÉY$1e[^_ÐU@tp Bщ¡P(H,ut RP uu1ÐUVSjjxt99u'9tދA9B}ы9uAC C$1e[^ÐU=uP,@( U塌P P$ЙÐU A9B uB$;A s Dt$J$ AJ$ B B$UB$~ HB$:B ~BuHP9u 8H @$ A9B uB$;A s DCannot allocate %d buffersUS]9X}=t+X]EPh2Ńxu jM@]seek error to 0UBuB(B,|9t@9up @щ¡P(H,@@@ @$jjjp V5 uujh2Uhjߴ t%@APQP H1ÐU" BAJR+ 9uա@ÐUjjju4 1ɃutÐUS]58Hj0j ‰RBBBBB B$B B(B,E BSE t H55Gx uX ]ÐUS1ۡ@tBu"ur 73 @ u(5}* j5 G]ÐU塌@8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256U WVS}1E?G<9 <0}-<.t7E6E.GtP벐jh5jG rjh5j# ECN1]ECre[^_invalid charset nameUVSut>u1WsE0=0t3V5 tʃ;ujh6~jqe[^UShZ7j1ҋŠDt   t  BvӋ]*s<%X>UUt:u7:*uXBPWz I  1}ÐU=v,x u&=v"x to=vx u1ÐU< u'?8 t+< tu1UWSBP@P&É߰эA)Cu=w1e[_ÐU=t!?=t1ÐUW8t6PWx I 1}ÐUWS=vDP@P2ÉډװэA)'Cu1e[_ÐUEUWS=u >} uPR PP@X u =;tPPa‰װ I RSw C;u1e[_ÐUWStm;ths . u;u3jj3ÃhC PSPXBe[_ÐU=luRua!P$>@@ ? ??4??D@??0@X@|@|@@@@@l@h-hi{ht$< tt < u8 t11h=vڀx t=vx u붐hh_8u낐hphhhnhqZhFhP}P#hÐU WVSэAu5UR‰װѡ\\H9| װэA)Éэ;rCK;sUXxPX‰װэt\H9|;װэA);5~3N;5%R sC;uN;51e[^_UVSu>t&PtÃt F>u1e[^ÐU t&t" t*t&< tu=vx t =u1!H=vx tH=vx uUVS tP  \ƅtg5($t Pz j)@P8‰$)PVR V* e[^?UEU tt Rh4Rh4|CÐUS]=htuP u ,ShPh4$jSe, $5,SI,{(9w,uh5$Pthm1]ÐUS]=tS-tS|~Su1]ÐUh; ÐUW}Wo I }ÐU帜UYoÐUVSE] uSVke[^U1t %@*!/?Ut  thE=}hE@thEt hE hE5|!done|doneUSá*$FPGHHHHdGHHHHPGHHHHHHHHHHHHHHHHHHHGGpHHHHHHHHHHG5S,~C<+t< tt R ;u~S{~5SP\5jCP5jPCPS};!t&t Pu SQ$u hiFPKjhjFm"SP[MjhpFm]ÐUS]/4$HIJJJJJxIJJJJJJJJJJJJJJJIJJJJJJJJJJJJJJJJJJJJJJJJICЃ `jSydIX(1v;;t <+t<-+t -tL@=uSH]t!5hiFS Z<+t<-u ~S+]uE-]EEjPj/ C1*t$ !t @t @ t1J t6 t1Su +݃w~ T][Press 'h' for instructions.] [Press space to continue, 'q' to quit.]USt =<mt@=(u(xu jjj50(,RP-7$=$tB5=u+=Pt"5.u jo3=Lt&ih6KhwLJvÅu j:#h0+SZh=DthpKAh!]less version %sUEEPhLiUta=<vP@Pet5llt,ttt g _ungetcc overflowU=u <=rjhM\hjEÐU WVSuэ\9rP|K9se[^_Pattern not foundU WVS] 1=tXt %/tj ju,SEP5O~Ãt?|=|~jh(N8gtW$t je[^_:%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: UWVSB]=t*=t j{+F=uƃ=u=tPV{~t˃=t+VVIEfEfEEESPN ǃEt PtpGc $ QhSSpTURYZ$WLYTe[^_.lessCannot use lesskey file "%s"USh_@ Ãt0S}]EPh_/VS ]ÐU55IP5PJ5P P]ÐUEt5PPj>-%s"%s" may be a binary file. See it anyway? U,WVSE;Et}EPdEEEPEPEP^ E Åu]E}tEV޿buLEE-SCEtiEPhb,Ru }t"uEPEP EPu EPVEPjSY^ E}3EPMEEPhbQu n=u_EPuLu- t:EEEPhbgRytYtu;  }tEEEPEEPh(5tEPut=t P ~t PW=N=t3R'`t =~EEEPhb8P1e[^_ÐU,WVSEEu]SEjEP4 ǃW]S1 ,Vcu}u5XEVSƃuÃW EPEPEx}u S5EP;u1/EP0t jìEPe[^_UjUjRU WVS}u&SaƃOySu1e[^_ÐU WVS}u&S-ƃOySDu1e[^_ÐUVSu1ېSÃtS9uރSe[^ÐMissing filename ("less -\?" for help)U5Ll tjhTh~Mj hbÐU PKWuKÐWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"U WVS}jWY ÃSy Ӄ } =tO}EPhh`Mi05$j-k-kak-k-k-k-k-k-k-k-k-k-kj-k-k-k-k-k-k-k-k-k-k-k-k-k-k-k-k-kj-k-kak-k-k-k-k-k-k-k-k-k-kj-k khW. ljWW jjjPx Éփ uDu?5 &j蚨jh4iL=}}EPhriJe[^_%s/%sU WVS]u t8;t3j߰҉э Pr| ǃu18VShlkW菝 jWV } W 1 P7 e[^_HOMEUuhl# PJu1LESSHELP/usr/share/misc/more.helpUh2l u h;lP蟦ÐU WVS1ۋu>t\<#t<%uJtuEP[Pǰэ\ CF>ujCPoEËu>tP<#t<%u:5 5PS軘 ߰э\ CF>uEe[^_%s*UWS]j߰эAPեǃShsmW谛 WÃWS/ uS 1ۃW ؍e[_ULWVSuVtYjjjVX uu >8j@]SVi 19}PkuF9|1e[^_ÐUjjju uu ÐU WVSEdjjdÉ߃T)ڋEH9|@EEjP蒤ǃSW S э| GMAPQЅ}Q4  M0 t t؍e[^_SHELL%s -c "%s"rU WVSu}эQ} t} эT tэ BjP讣VM QEPS艙 hYo` ƃtM>tHj҉эD PWSVh_oW4 Sk hjoSƃSM e[^_echo %sU WVSu ǃjWh]pà t2SƃS >t W V e[^_LESSOPEN-UWVS]Ejhp: ޿p8|u@EjSP'ƃtv}tP~jEPW= t VDJEPE0E 8hp脡$VǃV?t1e[^_LESSCLOSEUEt PhqF tuu PXPÐUlWVSuEPVgP }V?=uIE%f=@u5jэAPÃVSq hT?f=u1:jэAP谠ÃVS0 hdS6 ؍e[^_UtS]EPS | EЋU SS]U=u ̳ÐUVS=u7u.jLDÉփut z9u 9uPe[^ÐU=TtT ...skipping... UWVSu }]EEEt H9E|9E~H9EtE}=t>H9E|3趼9u9t&=t =|tEj5C9u 9u -EtNCWVbCEtu葲谱=|uhs2@M}~MuH11BWVRƉ׃u)u$E}ujBunuiWVBE}uJ=|t-u(u#u=u=u Tuڱ=MD=tP }tu Pg}u < }tm |jme[^_ÐUWVS}] uEbE9}tH9~EP(VSAE}u <Ox!VS6Éփuƒu}u}uc }t je[^_ÐU WVS} =t/=Pt&jHj觜j@ÉփtHPjxBte=tLGBt11Mjjj#@RPjwj @ÉփutcPjuWVSue[^_ÐU WVS} j?Éփu&u!tS?щƒ u uWVSue[^_ÐU塸}=u'Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of helpUWSCÅujhpx<|j߰ҋ=э PS5hxW S% W }ujhx<W e[_UEU =t P=uÐUMU uQH RBQj1ÐUU BAJj2| U WVS]u j$jǃS˜GGGGVWLe[^_ÐUS]t6;uSiSPs S ]ÐUEu=u1UEu@=u1ÐUS]SuSu1]ÐU塤ÐUVSut%sVx u u1e[^ÐUS]Su u Sz]ÐUEt@1UE@ÐUMU ABABA UUM BBAB AUE@ÐUE@ÐUE@ ÐUUE B U WVS]u ut[=u@RPVSXRVS臲u(VSVSg oÃu1 t u_X RPS t3=Htà t:u3Éփ1-t tu赳ÉָP#=@t8t43薳à t ttسcÉ։؉e[^_ÐUWVS} }=u>EU RP@;U u;EwM] )Ӊȉ11RPPEU EU RPEU Ұ=@tfɲIJ t uF à t tugƉ׃2k讲à t˃u-Ɖ׃WV'uuEu}:u}WVnUMQR )jV A뵐9} ui9uvd˱Ãt t P t*}RPS3 t=H{EMQ EUe[^_Cannot seek to end of fileU!tjh6IRPщƒuuHPjjHPQRÐCannot seek to beginning of fileCannot seek to line number %dU WVS}WGÉփut&VS0u5VSK/~u&5RPjh4}EPh4e[^_UEP87uEURPDetermining length of fileDon't know length of fileU VS#EU}u}ujh55EU}u}ujh4eEÉEEUEEEEjjdEURPh9Uu9Ew EU5RP e[^ÐUVS]u VS|u#׮ t u ukNÉփuVSIe[^ÐCannot seek to that file positionUWVS]u u7EVS 6ǃ |P+}~%jjjj>4RPWCjjj4RPWnVSrtjh\2xj3EUj3EU }u}t9uu 9]1;}}[}u}t,;u'u;]w jjjEURP+ED[VSnÉփutG;}|PT$)}URjjVSHP },9u#u9]wjjEURPGP([GH9}VSWÉփuuy0$VS 3jjVSHPe[^_UįȯЯԯ̯د%6dU WVS=EU RPB PhįP荃 įэQȯ~ī؃@Juį=u ī=į0 įȯPȯЉEuӋE̯e[^_ÐUEtt,tt  81UEtt,tt < X1UVSEu u cP賱t1Mį~ë9tPjXtįt ë9t VÉ؍e[^U įįīRPS)ȯÐU WVSu] EUjRPRP? tSVE=~!S‹EȯЃ;\ į=v ī~rt3P< u&:uS ~įH88į~2P:t(<t$ uuP ~  ȯį򈐴8Eȯ1e[^_ÐU WVS}] u=دt4ܯRPدPPt 9د u =uد ܯ51 VSW e[^_ÐU WVS]=ЯЯį08u$U MQRj0P_uU MQRjՐ_uE URPjSŐSU MQRjS뢐u_t t+l\E URPjjb=į9"Я% uK=u U MQRjj įȯ=uS =uE URPjSSË5dVjEV‰߰ ȯ}DЃ;\D;tME URPVPZu#įC;u#U MQRjS4t į1e[^_USدt'< u}uܯRPدP\9ȯ|%=t=uī=u#į ī BįÉʡį]~ UUM =ԯt">=t;īÐUԯÐUVSEU uutRPgu kuF CH tu !rte[^ÐUVSEU uuvRPѡtE117K t tցw}te[^UDsBDrD|`  ÐUVSMttAZr +Xp Yq[^ÐU WVSMu } 9KtC 9u;swߋCEt ‹||EBrz JSRES<EP0=|uQPHÁ;t(1C9u9SwދVN;u5||PQPe[^_Calculating line numbersUjhnW'ÐU|-uF+ch V h Ej讑 jja=jEj jh . }MQ1hv ÃtZ;tU>uS:~ǃ@j߰҉эD PU~VShW2t u>u hV}ǃWW< j EPMQ jT<j~)$EPk t j}j;e[^_ÐUWVS} EPEU}u }uEyj!Éփu u11jw!}.u69uu9]wVSEURPu u EURPVSW=e[^_Cannot seek to start positionwCannot create pipeUVSuE URPEtjh#hVÃujh eghVhǎj|jz:jj j }u}tE UE U;UQu;EwJ艙ƃt>CPSЅ} ;C| tSVp u tMtH5ƃt 1؋]ÐUu%ÐUSuÃt%EPECECEC ]ÐUEPfEu}t EBEBܸÐUugƒtsܸu,zu&zu ܸBBB BEBEB E;tPuuEURPMark not in current fileUuƒt!9u BRjhcmInput is not a pipeLog file is already in useNo log fileLog file "%s"USE]  tttjhě=|jh؛cSwÃSP赑8=}jh\EEPh?]ÐUu uÐLine number is required after -lUS] }uG]EPjlEP+ }ujh$SI]Cannot use lesskey file "%s"US] }u$St]EPh,]ÐUSEU tt tlRuP5 tQPnu;j7u!uStjJu5RP]Tags file "%s"UUE t+ t<u4PtPEEPh//U}u"u ˮh辮%sUVSE] tUtoui$ÐUE|~ u)ÐUS]|Ĭu js]Use "h" for helpUE=uUt|OJjh;9js}$63j_jsÐU塰There is no %s flag ("less -\?" for help)UWVSEt&PjBj_18SE0V@E0>$hL,U:+NBUEE8+u@EPp~ PkVuEMzVÃu*VEEPh̠YjpCt1 ttktF}uS { ft S CW9%Ps0E8EVPEjVUR)‹C CtMQjЃE8e[^_There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flagUWVS}uW Ãu#WEEPh|Cu(@t$WEEPhgMu(t#WrEEPhУ: Ctuu E 8u1m{} j=Cto t C) ttS : S {  tt9%PC 09%Ps‹C w|rjht7 t Nt3EEPjE PFƒ}u'C  S Cjh,Ctu uRЃt {}#Ct%:5|0jC tCC EEPs)tC t $e[^_ÐUE} t%%-%sUu蛑PhCha Uu t@S%ÐUu t@ u1@ÐU=%String is required after %sUuCEEPhا ÐUPÐUS];uu jhk؀8t8$u@@8u]Number is required after %sU WVSuE0j1;-uGC< v:t Zu eEEPh{- jj1TBC< vEttډЍe[^_Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenU幸=tQ tA 9uÐUSM=t/L9tBtDC9u :u1[Uhpt4jN94EPE PEPѵ 4}UjhopUEP% E%s: %sU WVSu5P/!| Ãjʉ)Qaǃ SVhWV e[^_ÐU塀UVS]u  ujjdRP9 u$;vjjdEURPϰRPVS1؉M]SQRP萰e[^UWVSt$1E}9]twtt*tttt uCtEt t+tt?twtts]tu uVEWEP ƃGtt*ttstWtse[^_ÐUS $t:=tSh$P 9t $ $]US]= $r=xtxr  [ÐUS];tPC;u]ÐUWVSEu t؍]ߐ0Cut-C)9vKP?9we[^_ÐU WVSu} E>te>%tPFEIFFN %dUuh)5(N ÐU(&)PuRWcÐU(?(ÐUS]CS u u |;|݃u u&u]-UWVU E6$Dؼ 8`t|Ƚ=(,%RP5设ƿӻ%1=tYsuJtJC%ttk1Rut[su v:Cs1Ƀut 5%1e^_ÐU WVSU E6r$}} }}}}}}t}}}}}}}}}}}}}}}}}}}}}}}}4}}D}}X}}}}$}}}PRƉ׃u WV`5"J5'5芼R}{qӃuSQ^~wHF蔻;RƉ*qӃutAu;v7SQWVP5pӃut SQbWZ(=,vMx uGH(=,v8x t05~tPZPe[^_ÐUE@:t t..t됐?t\tAِuIu@ŐHÐUVS]u E8EPjEP}tgE8EE8^u@EM 9t.9t)E8\u@EEEAU9t:uڀy$uIS AShhL Sդ jh e[^_Tag not foundUWVSt.PEjh511jjEuΉ]uEP؉RP_Éփ}tEut=tVSURװэAPuR苕 uEUe[^_/dev/ttyUjh } ÐUSjEP5|Ãt$} j<}uEuE]Uuu uFfs.%sUlWVSu] 8}Dft Ft .st%08,shLSV蔞u)Ƹ<=,t4tt =t5jhP3P js3P tWVZ tVhRjW) E%f=@t193tjV3/ ǃ93uW螒 %s: is a directory%s/%sUpVSu] =,uNEPV t V=0u'E%f=@uVhw@ }u"EPSm uEE%f=@u7j/V%, u@PShhSd =8tS/ } =P/!uSV4ЃtShR? 1[^Ðusage: ln [-fs] file1 file2 ln [-fs] file ... directory Uhh  j Uuu uUE @PE@Pp ÐUE@PE @PP ÐU WVS}u N<_ UVSUfz2uB@PhhSժ &B@PBphhS譪 ރhSVCn u#5P/!]5 PVhh hS' S [^UVS]1;tjDu =u? TT} ;d| tLLhLR FC;ue[^Ðusage: ls [-1ACFLRSTWacdfiklmnopqrstux] [file ...] Uh<h jp Uuu u%m:pinvalid file mode: %s%sUWVSu ghjjvׁf}ME emtpuVER5h/!:-Ãu5h/!hj}hS+ǃS/d hVEPzuƃ>uEUU߃>j6 HVUH;v8/t}t!EPS6z}PEGS6 |fv,S6Du6hU Eu>cURn /%s: %sU|WVS}E fEEfEEEhqS肍ÃhqSލà ;EPW tE=P/!u&EtEPW tK=P/!tBWh :E%f=@tj1 PWhs@ /A1x[^_Ðusage: mkdir [-p] [-m mode] dirname ... Uhph j~m Uuu u%mkfifom:invalid file mode.UWVS] dEEhjN581t uwEn?tWmuR5h/!*Euhj[zhEP(fEEP` EPhhSEPww)E;uEP+}u;}u C8puEEC}tEP}tjfE}tEPSEPPk EPSEPPk node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%sUWVSu ]Fut4SCO tLRED}uAPhNj u0]U$uft ciRED}uAPhG CtP;t0s{ uoPE}uAPhG Ct hw=t&h|E}uAPhGp C@t&hE}uAPhGD {}&hE}uAPhG C =u= t$PhE}uAPh C$=u= t$PhE}uAPh C(=u= t$PhE}uAPhs C,=u t$PhE}uAPh> C0=u t$PhE}uAPh C4=ut$PhE}uAPh C8=ut$PhE}uAPh CC<=ut$PhE}uAPh` C@=u @PhE}uAPhuuPEPEP|HPUx1uPhED}uAPh 0u]=uEtu xt4sphslhED}uAPhP =u f{t0CtPhED}uAPhu%<]=uUtu xt4sphslhED}uAPh =uf{tt+CtPhED}uAPhd Cxt)h+ED}uAPhG5 Cxt)h1ED}uAPhG Cxt)h6ED}uAPhG Cxh>uB]Ett)hIED}uAPhGi Clt)hPED}uAPhG: Clt)hUED}uAPhG   }t\P e[^_ÐU WVSjEP919}Q1ۃEPEPS tEPETPS u ]èF9|1e[^_ÐUVSuTu@=.Ã;tj3VgR t؃;u=%e[^empty type listU WVS]tuhj^nu~ou EEj=V> t]  t3PV9 u;tE;Cu [ C!VhNjY1hLVHmƃ[EPK@ e[^_Uuu uUm b _ \ W L F B = 8 1 +  $ updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %sUWVS}u A1EEEEE0$!""""""""""""""""""" """""""""""""""""""!"!""!""""!<4,EPh|5h/!Q hw VW0T)Ǎ4tvEEE Et EE]EPuVh~ dd})=P/!-uVh jnu~ou EEj=V9 t]  t3PVM u;tE;Cu [ C!Vh:#jT1h8#V\hƃ[EP_; e[^_Uuu u%%%%%%z%v%q%l%e%_% Y%@T%M%F%@%forcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %sU|WVSu] X<E'!}EE+?touWhh$5h/!fh%SVOu)ƍtE[EEt E EEPuSh%_}\P/!tt!-t%"%&5P/!v PSuh+&jQjC usage: mount_ffs [-o options] special node Uh'h jfC ,-o %s: option not supportedUWVS}u Eujju>nu~ou EEj=V*5 t]  t3PV u;tE;Cu [ C!Vh'j,P1h'Vcƃ[EP6 e[^_Uuu u)))))))))))) )updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaGsl9u:g:m:o:"%s" is a relative path.getcwd/using "%s" instead.stat %smsdosfilesystem not supported by kernelmount table fullnot an MSDOS filesystem%s on %s: %sU WVSu 7DžDžDžDž}L+ $ǃ<$d,,,,,,,,,,,,,,@,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,X,,,,,,,L,,p,MMMM5h/!.EDže5h/!EDžE5h/!rfEDž$Sh)5h/!Ph*VMQQI);Et t>/Vh*>hQn uh)*j<эQ)Ph0*R0 эA)SVR0 Vh2* MEt EEtt udPVb uVhF*j^u 0Eu 4Eu ,fUMQVhN*EX}ZP/!t t-uh*!**5P/! PVuh*jIj*< unknown group id: %sUS]S&t@Iـ9t&DtC;tDu;u QNQ Qh/jTI]unknown user id: %sUS]SQt@Iـ9t&DtC;tDu;u QP Qh/jH]invalid file mode: %sUVSu1ۊ<wCjEP5h/! ƒt |E8tVh0jeHe[^Ðusage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir Uh0hT j&: ,-o %s: option not supportedUWVS}uQ EujjOu>nu~ou EEj=V+ t]  t3PVm u;tE;Cu [ C!Vh1jF1h1V|Zƃ[EP- e[^_Uuu u)&333333222222 unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfsFilesystem not supported by kernelUVS]u %/E-?t#ouEPhH25h/!h03VSBu)Í4tjuvh33Rt'=P/!-uhH3jDjj1e[^Ðusage: mount_kernfs [-o options] /kern mount_point UhH4h̳ j6 ,-o %s: option not supportedUWVS}u Eujju>nu~ou EEj=Vb( t]  t3PV u;tE;Cu [ C!Vh4jdC1h4VVƃ[EP) e[^_Uuu u666666666666 x6updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ext2fsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %sU|WVSu] 0+E'!}EE+?touWh55h/!jh6SV>u)ƍtE[EEt E EEPuSh6N}\P/!tt!-t6"6075P/!N PSuhS7j[@j2 usage: mount_ext2fs [-o options] special node Uh8hh j:2 ,-o %s: option not supportedUWVS}ue Eujjcu>nu~ou EEj=V# t]  t3PV u;tE;Cu [ C!Vh9j?1h9VRƃ[EP% e[^_Uuu uIif%s: destination pathname too longUWVSu(]@ftiu.   h4:U RVi;u)Ƌ} <} k j SE tp uE%f=@t#~- U r2eP/ } TװэA=vU 2hT:jI=RWT эQ׉/t/DžN3E j/ShuNu mNu zuL9rHFPVЅ}W$9  tuȃytYuM QEP&Gu1T=P/!usSUR 1uSMQhn=8PSEuInu~ou EEj=V t]  t3PV u;tE;Cu [ C!VhFj11hFVDƃ[EP e[^_updateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:Ua:b:c:d:e:f:i:m:o:s:NOS:UT:a:b:c:d:e:f:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s/sbin%s/newfs_%s/usr/sbin%s not foundswap/dev/%sr%s%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% disagrees with disk labelWarning: calculated sectors per cylinder%s (%d) %s (%lu) mfs:%dU\WVSDžE DžhiH58賶 t Ã~ShmHDžH=t DžHl`\PU RMQ&;$OlUlUlUlUlUlUlUlUlUlUlUlUlUlUlUPPlUlUlUPP QlUlUlUlUlUlUlUlUlUlUlUQPQQQQ(RlUlU\RlURRR0SdST4TDTxTT UlUlU8UlUT5h/!/ 5h/!hHgh/!fV5h/!/ ؔ75h/!hI5h/!n/ Ĕ=5h/!h3I5h/!:/ Ȕ5h/!hFI5h/!. ܔ5h/!h^Io5h/!. _5h/!hI;5h/!. +5h/!hI5h/!b. 5h/!hI5h/!.. 5h/!hI5h/!- 5h/!hIk5h/!- ̔| cV5h/!hJ25h/!- #5h/!h0J=t#hh5h/!h/!ƿQJuДԔƿWJuДԔhpJc5h/!, S5h/!hJ/.5h/!z, 5h/!hJ5h/!F, 5h/!hJ5h/!, 5h/!hKh/!ƿKtsDžt5h/!+ K5h/!hK*5h/!+ }5h/!hPK/ w)EU U t )M}t<E =ujP8KRhsKhQM Qh|KhKhPM (RQ.PhKhKhRQM (QPRhKj =K1t DžeDžDž@DžDžDžDž@fDžfDžfDžDž@Džƅ fDžlj/Pӭu_RhKhKh蓱 Qhj uPhKhKh\ Dž=tDžRjRwj }#5P/!h PQhK* jPÃu#5P/!+ PRhK jPhKT uKjWhK u ƆrWQ tGPP u!TPRhK-Km=t<t3P Ãu5hKjQh }#5P/! PPhK RQ }#5P/! PPhKV %f= t&=uR58hLgjM 1 Bt"z`~ B;~%RDuU 2hPLQPËDt>uPE 0hLX~ uPM 1hL3=u9v&=uPPM 1hM=uCH =u!C0E 0hIM=u!C,U 2h`M=u!C(M 1h~MU=u CL=uCJ =u FC(=s=Ĕu*F FĔ= ~ Ĕ=ؔu=ĔH}ؔ= u  =̔E=Дt<=Ԕu3hMh( jhMh Д =u C@=u CB+S89t!RhNPh0NhYNh藊 =uĔ\F`FdF h  e ș ș ș ș1b~Wȅ} RQPV Й~} 1=uGtSRQ=uP R =h PhkNQ蚩 Džt Dž DžhlR5M qhiH&}"5P/!s PE phK6 j ioctl (GDINFO)UShhedAu H }Vt0PÃu5hK#hk`迸uh]ioctl (WDINFO)%s: can't rewrite disk labelUS]=uNfǃS{fShgdu w }h`'uha]ÐUVSu] jj&B }+jj58! SVj Y SVjE usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -U enable soft updates -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder U=t58hb58hPbh@ hybh. hbh hbh hbh hch hchԁ h0ch hOch谁 h_ch螁 hch茁 hchz hdhh hdhV h/dhD hPdh2 hpdh hdh hdh heh heh؀ hPehƀ hpeh贀 heh袀 heh萀 heh~ jP buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk minimum bytes per inode isWith a block size of %d %s %d Minimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, This requires the block size%s to be changed from %d to %d and the fragment size %s to be changed from %d to %d CylinderWarning: cylinder%s groups must have a multiple of %d cylinders panic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder File system performance may be impaired. and ntrakrotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sinode blocks/cyl group (%d) >= data blocks (%d) must be increasednumber of cylinders per cylinder group (%d) %s. Filesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed cylinders%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/>U<WVSDžhh j/tKhF.t2h-.th.uhg觯j EPf = Th jj y|tXuhh j jEP|P_LtEu Ph j ^ jF- 9v1S -u j  EE=tǀ,ǀ(ǀ,ǀ(<=t Phh'j } 55HP. Phhԭj* Qh3h趭j ĔJ0B4ytQhLh膭j ptPhhgj 9}Sr4hhAj  hr0h ijm 9}Pr0hLijM ӉZHЉBL8<@DBP|~1@ѽ||BP@TP4|~1@ѽ||BTHTX0ىH8@`|~1@ѽ||B`{8~)C0}Ps0s4hijU PC0{tCxC4=C|Cd|~1@ѽ||Bd=O4DW8t8w8wDO8DG ȉGI_|ىșËO8DGG|~ѽ||BH#tZۉZJ0I04ΉBtLPDž|LӋPËLÉΉߋ04|yJ`B|X|~)u$XXѽ|~ |t܋Xx`{xD1ljpS0VUUUꋅ)D9p~pC`pdSddK|dCCDHxDljtpؔ~~$Dž\ PE4B}B<0Q|ÍC}CNjY0D$~;I`ӥP}P;Dw;D 89@Dž\5F0=gF0|u ѽ|;X҉XxɉxH|tP8҉P8@`~DP4;P0u$hi_hiRj x8H`҉P4H|ɉH|PE4B}B<C|A}A<@K08$4K`ӥP}P2@;8yDžXddt`)ؙ= sxLșƉp[0VUUUщ)D9pXx{8s0t`+d)‹{x\ؙș@PhjVh,jc Y04Y0y8y`O0y`ѽxHxDxPE4B}B,A|ÍC}C,Ã$~B0ӥP}P;4w ;4vX0ۉX0vt`+dЙ= sxLșƉp[0VUUUщ)D9pX Y0VUUU)‹YxLș9p~-t`+d@PhLjt6\u35 hkjPtQhj< \t/hjtShj Xu \tW@0Ĕ9tPRhjh k̢@49tPRh,khLk覢j ȔЙxt`xWvk=tmkPhkRHxxx=uȔ5`+d șNjNxT9Й(w0VUUU)T$Й9(~[DžX+x`+dt$9 PE4B}B<0Y|ÍC}CNjY0 $~8I`ӥP}P; w G; v<~. ~#_= ^9Dž\+x`+dș_xL ș󉷸PEB}B؉O|A}AO0$&O`ӥP}P;C|Ë Q`ӥthkўj' ;t} tRh l訞j ;5Ȕ=uh=lz\uXu j \t'Xt hLl\t htl hlhl=t jM =PEB}B؉_|P}P $~.O`P}P ˋ@D KL!Cd؋G$Njz|Ë9~CDžhhl蟜j ǁL@d#ALAhuǁXPX҉W`G|‰؉љÁduLJT\LJX`*ǀT``X J`B|9~Lh mh7mhLmhmhmBǀX |@#ZLZhDžlHl;X1 lC;P}Ql\6LuTlPBfF ;P|l;XuP8|| A|˙щlșӋ=ىș֋PƋO`| 6Lull\TlXf8u*Lu 8` XcLu :` XLu\TPH(ȈLu\TPHf8X8)|gЙK,tAK,K`SxыЙSK{׉s,F|9~||#{ϋ 9|nЙ{8P|C!||K<1{{8)Whm˗hnhLn讗j N‰C$+|9! ;|u'C8@C|PhnAj |{8PC!{{8Phn|H|Qh,o5N,)ωș~|É^$NdDžh htE=u<JdJ|H))RhoRBB,@#BLz0|߉zlBp|~1@ѽ||Bpj\uhoǕj ǁ\TܔA@̔A<ؔAXA\֍3)ЉADДǁǁǁǁǁƁƀƀEW =hoB$B|Pu ho賔 EEB4p$r,B$EEB4$h,pV =uhlp=Dž|KDžll;H,ulS= lA!AQIdRhp]S0| Ƌ|9|hp莓Dž||ShpmhL ll;P,;=uhp-=t=u jn u EB R5 =PDž| |;}f| Q+|P09~RPT|@dSbX0||;|Džl l;A,}PQ5lA#lAQIdRl l;Q,|MA B4AB8A fA=tAjTS j j j hp=[^_ÐPanic: cylinder group too big U Ey8ÃSxU t@`P59$~,5؅}Cvl)ø2 AUS|ЙÍyU tDTIT=MO|șƉщșىșPщЙÍxU t 0 @Xpf@8EU9UMH( 5F+EA(Y8]؋Eׅt{)}؋]D4EEI8M)}U9}[E}xU t @`‹E}$M)@$EM9M|]] A8;EHEy8ÃSxU t @`P5-$~,5؅}Cvl)ø2 AUS|ЙÍyU tDTIT=MO|șƉщșىșPщЙÍxU t 0 @XpfB8EE;EU9U}j+U4E}xU t @`‹E}$M)@$EM9M|$vh[l MCE11;Hp}XUE䐐EEtAtU$9~1ɉt EEUCEGE;xp|t$9~ BB$BB B]BCB CB$C Rq0EQ!UUQA IdP e[^_ÐU WVSE(08=t fC fAf=t jh jh| $Pp4lj=@  $@DYL!! 5q4IdW jhe[^_ÐUWVSE=EE H9E}Tu1ېUfD$fDDPVW MD)EEE H9E|UUMEfLMD$ʃPRW e[^_cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 UWVS5Hd@ PYxU t hrxu h̙`1;x}Q y8QxU t@`P5u&x8;x|h 19H`SxU t @`P5y$~,5؅}Cvl)ø 2K JE @t C Q|ЙxU tDT@TJ|ȉәƉыEș}ӡىș}PщЙҡxU t0 @Xpf U;Q0q4TЙËA8)B Q8)P$Q8)D4;q8}V7>}xU t @`‰؅}C$)CF;p8|5Hd@ Pe[^_Ðfsinit: inode value out of range (%d). UWVSu hE UBl5Hd@ P {U thjV K [\5Hd@ P MHA,9rVhL耂j 1E׉ËMA!EEAY1qxQ`ËUBdEPr0S 1qxM<1u EPp0SURe[^_ÐUj getrlimitsetrlimitUWVS]=jY H0!ƒ)R: ƃ}Wj }hj EUEUWj8}h&i E)!á9v)أtS 1e[^_ÐU WVSu} W Ãu1tWVS VD؍e[^_ÐUVSuu VÃt VjSC ؍e[^ÐUseek error: %ld rdfsread error: %ld UWVS}=t#==E PWURQ }E MMEeÉ֋MM΋EEjVS53 }(WhhUh j! U REP5& ;E t&WhHhh j" e[^_wtfswrite error: %ld UWVS}=t#==E PURWA =}E MMEeÉ֋MM΋EEjVS5 }'Whq~h8g j# U REP5 ;E t&Wh,~hf j$u e[^_isblock bad fs_frag %d UVSUu ]B8t? tPjtu^<3%g؃ '؃ ك"38%r8hТhD 1e[^clrblock bad fs_frag %d USM] UA8t8 tM_t uRaЃ  EЃ  ,у q8hhD ]setblock bad fs_frag %d USM] UA8t8 tIWt uJYЃ ?Ѓ &уq8hFhsC ]COLUMNSUVS1]Shht@j tsu(h t PƅuPe[^Uuu uFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sULWVS]ؙt P ؙܙtv$tHuؙx4hjS ؙ}Sh5P/!jؙjzuؙDhhS ؙ}Sh5P/!jb ؙt{trjPR auؙFhjS ؙ}(Shإ5P/!j=ؙ} t+P&t5h5P/!jh5ؙ }5h5P/!jR'%f=@uB5h8j5ؙ' ؙ)f= u2EPhm8@5ؙ蛾 tܙTf=`uܙ@jjj5ؙ uu=P/!u ܙ ܙܙt uOO$x/utxB=wu  ==ܙ눐u?t5ؙRPRP蚻щ ux5= ~ؙRPWVBщ u (=xx1e[^_%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. UWVS=ؙ}&t=tk=ܙub=t/BHJȅ|  Rj -\ 5hX5; 5Ӝ =tTh5ؙР u:%f=u( u5 =w4=t+~"jP腺 jEP5 5ؙĺ =t7=ܙu.5h\ 5 ؙ=u ==t=S=t8BHJȅ|  Rj Z u.RP5h59 U׹uX tjhRPjh QRRPhū5y9 Xѫ}tDRP QR5tHP3MQhث59 05B te[^_US=ܙu1=~(hS5ؙ ÐUnable to truncate archive fileU=ܙuKjjj5ؙj |RP5ؙ }h5P/!j1ÐCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specU=ܙu hX=t55hjs1ÐFailed read on archive volume %dEnd of archive volume %d reachedUSMU =ܙuERQ5ؙյ Ã~T;t{tmaRQ5ؙ萵 Ã~>}5h85P/!j5hxj#؋]ÐWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUVS] Su5ؙ蒳 ƃ9u}5 ܙ}~KtCjjj5ؙ& Ӄ)ӃSQ5ؙ |x}sP/!BvEu\1`}KP/! u"hxj1t tu 1|~ =uHhjenu5hx?}5h5P/!j9Pt әuh8jhxje[^ÐCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.UVS=f=Yw h8t ܙtbtfEE@Phm5ؙİ ~ =ܙtjjj5ؙ |HVSRP)։؉jRP5ؙҰ | =~h8j1hje[^ÐFoward positioning operation on archive failedU WVS}G} }=ܙu|jjj5ؙ Ӄ|gȉEU 59 u);v!)ډW M] _jRP5ؙ芯 |1'h5P/!je[^_ÐReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.U VS]u ܙ~-u(^Vh8j06.jjj5ؙU }hx)y"=~hj>11jRP5ؙ hEEEURPVS航щ th8jNfEEURPVSۧ]CShm5ؙګ }'shx5P/!j 1e[^ÐUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksUWVSDž=u9hS5ؙ } hXtfDžCShm5ؙ ߅} hx4fDžGWhm5ؙ } hhS5ؙV ƃ hhS5ؙ, }hXfDžGWhm5ؙ, } hxktHth8jDfDžGWhm5ؙĨ |wh85P/!j[^_Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again U WVSShj^ }hM5P/!jZFjSj- }hg5P/!j)==ѫǹPhֿ 1t ֿxܙu 5RhؿLh5RhX,h wh1h5hhXhhh S|޿u65hOtVuM~5PW8d5GPJ< t5@t.P{tphO5P/!j wWK W+OÃx|RP/} W=i=\BHJȅ|  Rj 9 !WHƃ}6x|RPWk RVW@<ЉÃVW~I =tB=t9BHJȅ|  Rj 9 u% x|RPt3xt-5-tht5P/!jWi uW虔Ã@(Ѓjhj虘 ~[^_Unable to open %s to readU,WVS}E@Eu Xz@,Ѕh@0E=t GE Ej EUUWY}tWɮt t u9jj# E}h5P/!jq`W苕ƃ}MQW1UWܯ 6=xt3uWU} EPWTW螯 t:~5URW_5GP7 tWMщƃ}EPWxTE~a=t@=t7BHJȅ|  Rj 5 EPWT]SuW@@ЉƃURWS =t@=t7BHJȅ|  Rj ]5 Cu}tEURP||| u&xtx|QR|JWgZu:W?uE==t&=t E98!E9@E98=t5FP/ t=tV@ Vo@ƒ:=U=HBHJȅ t9 t4w V ? VBƒ}V腦낃jjf }h5P/!j%V<Ã}PVnKV xSVXSV:=PV6K=tB=t9BHJȅ|  Rj , VRxjhjnj =|O[^_ÐPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.UWVS1EEX߸$SU_}t/Et }htu$=hjd$SP 9uh$UR@$Ѓtzu"EPVh$B8Ѓtu =t|htjEPh%h$ˏ E$UxtAUR@8Ѓu. hSh4ja萐t1e[^_ÐCannot identify format. Searching...Sorry, unable to determine archive format.UWVSEE=\|$\;E}E:}}7UŬEPh$v1_E$S,KE$}u&= hTjEVSl Ã~]U9U|1E\=\|;\<URh$ȜЃC>}˃}u"=twhTjUEM}~.EPh%h$8 +u]$5$E hje[^_Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableU$$=u @=~hPhj/thPhj=~~h~Ph(j^x5`}t}/$‰(,1ÐWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleU$$=u?t6=~hPhhthPhj_S5.}B} .$(,1ÐU$$xÐCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.U VS=thj=ux xQ,()‰ЙEU xEEEURPEU RP}EUEeÉ֋EEƋEE9u u 9]v]uVS+]u $,x(9s555,<,,;(r΃$,)‰ЙRP|}$É,x($x‰(,xEU )|1hj]e[^ÐUnable to append when there are archive read errors.Archive read error limit (%d) reachedUS1ۃ=|=uhHj}e}.$,У(Й11ۃ5x5$6ƒ|~C9~Phj t}]UE ,)‰,PuRl ÐU,WVSu} EE U,()‰u};M u;UwUME,+u} EEEURPWV|EUEURPWVNzEUEeƉ׋EENjEEǃEPWV}M])EU \,()‰ЉƉuw Ɖx tEU;} u;uwƉ5,)u}}u}w1e[^_ÐU,;$v+()PjRA (,5x] ÐU WVS}u ~\,()Å5x% Ã}.9~؉ÃSW5,> ,)ރ1e[^_ÐU WVS}u ~X,()ÅÅE )519~؉ÃS5,W~ ,)߃E e[^_ÐUWVSu} ,()‰U 5x.E}YEEE9} u9uwMMQj5,~ E,)߃uv1e[^_Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUlWVS1ɋEHLb,()‰Ѕ5x9u9wQ5,E Pfz ~) ,uw}Uh@E tEhhjgEPU R` }-Eh5P/!jb3U2z.EU98thj葾E0x1e[^_ÐUnable to obtain block size for file %sActual crc does not match expected crc %sUWVSEHLEEE1EPU R^ uEt.E)MqEPh(5P/!jUUMAș]u9 u9wEUEPUREPEPMQ5,E P16ƒ p=xtJ|,,Iy ,Й)օu(v$, ()`SQEt,ML uHtPEPU R6uvM Au 2=xt$ uE9tPhhj/1h[^_ÐFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUWVS}EE1GEEEEPT L9u9HwE]SEP(\ u EtEEPh(5P/!jrEEX}tS5$EPu ƃ(EPEPEPEPS5$EP3ƃ 9u*EU5x5$E Pwu Ã}*GPhh5P/!j˺ E;Hu E;LtGPhOEPE P[ }h5P/!ji$E98tGPhj觹}u-Et&L uHtPEPEP3h[^_ÐU=t611r;|5x5$}#$,ȣ(șÐUser specified archive volume byte limit reached.U WVS}1E…=99hj*)}5+1$x$‰(9})ƃ5x5$趾Ã;xuQ]~1V5(5$u $,x9|l뚐$,\H]ؙ$,)߉SPRt $ډ,Pt ؉֙uEe[^_Unable to allocate memory for user id cache tableU=Țu$=ؚu5jh= Țt1ؚhj7ÐUnable to allocate memory for group id cache tableU=̚u$=ܚu5jh] ̚t1ܚhpj藵ÐUnable to allocate memory for user name cache tableU=Кu$=u5jh= Кt1hjÐUnable to allocate memory for group name cache tableU=Ԛu$=u5jh= Ԛt1hjS%luU WVSu} =Țu />3)Ѝ)¡Țt~9s$uuukC=ujuj(Jf ÃVu-t s$Vh=j Sת ؅u0<)us$j0sVd C#e[^_ÐU WVSu} =̚u ;%H)ʍ)ȉ)¡̚t~9s$uuumC=ĚujA]Ěuj(:e ÃV`\u-t s$Vh=j Sǩ ؅u0<)us$j0sVc C#e[^_ÐU WVS]߰эq ;=Кu h=VSI¡К<t,?~'GPS&r u?G$=ujiu@h=VSݘǃj(c ¡К׃ uStC@,jSGPb G#St@G$U 1e[^_ÐU WVS]߰эq ;=Ԛu hVS ¡Ԛ<t,?~'GPSp u?G$=ĚujZĚu@hVS街ǃj(b ¡Ԛ׃ uSIYtC@,jSGPIa G#S$Yt@G$U 1e[^_UTRAILER!!!UWVEp uH LЅu1^_ÐUMǁǁǁA %%=`tT= tW =t*p=@t-g=t]~[=t<=tAKǁrǁfǁZǁNǁBǁ6 ̀f ǁHLQ|1ÐUWp1$Džp EfEtBxBf|B ~pPB0ЋXÐCpio file name length %d is out of rangeCpio file name in header is corruptedU WVSu ~ v Vh0V]S9u<u Exuhj1e[^_ÐCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptUVS]L HtHu= vHLRPhIP V;Ht h# 0 t1hje[^070707U} KvjhuJk t 1UVS]u jLVlǃxǃ|jjFP3jjF Pz3jjFPd3f jjFPM3$jjFP73(jjF$P!3f"jjF*P 3,jj F0P280@jj FAP3HLjjF;P2 ~fPPS|P %f=uH Luǃ ƃ S| Se[^UW1U-ÐFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sU\WVSuhhV͇} džxdž|>G]v dž,tO tV O |Jjj CAPHLRPd2 t?hjj EP jj CAPj0jjShq0jjCP0jjC P0hjjCP Pc0HjjCP$E0*jjCP('0 jjC$P"P0jjC*P,/jj C0P8/jjC;PW/jLUR|WFP}hM t t u1]uP P}4h0jNhpj/e[^_070701U} mvjhfue t 1070702U} mvjhuVe t 1UxxÐU WVSu} =xtjnWjnWMBdžxdž|jjGPj-jjGPT-f jjGP=-$jjGP'-(jjG.P-80@jjG6P-HLjjG&P,f"jjG>P,ÃjjGFP, ÉjjGNP,ÃjjGVP}, É,jjGfPb,jjG^PL,ÃCSVCn)ƒ1RP" %f=uH LuGdž Ɔ HL1)Ӊȉڃx|QV|8HL1)ӉȉڃRPo} Ve[^_ÐU|1UxÐFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sU|WVS}jjWӀ} @Euv LJ,=xt.jjURhqL*qjjEP(jjMQhq*CjjEPj*) t  HL1)Ӊȉڃx|jjF6PHLRP* thh LJxLJ|jjF6P LJxLJ|jjF6Pj):jjFP(jjFP P(jjFP$(jjFP((jjF.P8}(jjF&P"P](jjF>PP=(bjjFFPP(BjjFNP-P'"jjFVP,P'jjF^PUR'jnMQ|@]SGP|)؃n)ƒ1RP}h p t t u1~ut Pj|$ )ƒЙRP:}4h0 jhp jx[^_ÐUSE} vGffffHȴ fqu1+ fqu=4u4א[U WVS}u jV3LJxLJ|=4 FV ЉFV ЉfFfV f F V Љ$F V Љ(fF fV f"FV Љ,VF ‰8FN ‰8FV Љ1ۉHLFV 1 ӉHL^FFV ЉFV ЉfFfV f FV Љ$F V Љ(fF fV f"FV Љ,VF ‰8FN ‰8FV Љ1ۉHLFV 1 ӉHL^F Ë80@CSWC1RP3 %f=uH LuHLJ Ƈ HL1)Ӊȉڃx|RW|8HL1)ӉȉڃRP} We[^_ÐU&1ÐFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sUv LJ,u䋇 t: / &HLM؉]܃ee1+EU܉E؉U܃x|ȉFȉFNHFFV Љ1FV 1 9Hu 9Lh(LJxLJ| EEE EEU UM 9$LJxLJ|FFFFqFNjFFFV 9]FFFV 91 fF FfFfV f9$F$F FV 9(F (F F V 9"fF "F fF fV f9w,F,FFV 9K8FFF8FFV VN 9UCF^FV 9jEP|0SGP|E1RP_}hr t t u1~ut P|' )ƒЙRP}1hj返hPj裔e[^_Unable to create %sU WVSU VhӃS }~ES t^D5P/!=uU($Su }ShVj舔WhS |e[^_ÐUnable to close file descriptor on %sUVS]E 1PO }CPh5P/!j=t($CP ƃ=tt f =t PCP =u =tj08CP~ e[^Unable to link to %s from %sA hard link to the directory %s is not allowedUlWVSu}W S虨 }FPSh5P/!j2E%f=@tjFPWSeShje[^_ÐUUtjBPPÐUnable to copy %s, file would overwrite itselfUpVS]EPsV蝧 |:= t12E9u!E9uVhj1e[^ÐUnable to link file %s to itselfUnable to remove %sCould not link to %s from %sUlWVS} ]EPSئ = E9u%E9GuEPhjJE%f=@uSjSK }p}uaSh5P/!j菐fSEPhVjsJ5P/!=uww S&t}tSEPCju1e[^_Ð%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)U|WVSEEE fUj=P/!uSxE|9s?u C9s;t9u*jRPURVB } E Phr%/yUVWEP!A 9tU Rh%5P/!j5+} e[^_Failed seek on file %sUVS]u }tRjjjSA }Vh&5P/!jR*jhpS@ }Vh%5P/!j&e[^ÐUVS]u |4P A =tj08e[^File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sU|(WVSDžDžDž} }Eǀ1<UX(v()ș19}B9|WVE P;? ‹U;Hu;LtUhW'WPE P$ }Uhl'5P/!jKpU98th'j膃GjjjE PY? |U1#Uh'5P/!jكx[^_Unable to allocate memory for file name bufferU<=t< <=t <=t <@=u1h ,5 Duh\)jyw|=t }c|1Invalid file name arguementUnable to allocate memory for filenameUWS]t;u h7*jr4 ƒuh\*jY߰эA~ </uBE BB =t P 1e[_ÐUt@=t L=t&EutjP5;ÐWARNING! These file names were not selected:%s UVS1=t btG{8{u2uh+ju3h+h1 [ ue[^ÐCan't fchdir to starting directoryCan't chdir to %sUtP6uFhh 5D^Tj 5D0 t@ u dxt[5Z} h\,&0A[N0h,5P/!j0Dj5<hD<21File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sUWVS=LtL5"5u}ݸ5@4H $./4//T//.l///////=wEPEPB %s U\WVSu=u#EPh1V V= }]SU P9u U81;E  1ÃG PPSj@]S> uEjwqPjjw YPjG PEPh1V[ U0wW%PRh1G0W4RPh2V EPSh 2V EBwE Ph2Vش EuE Ph2V踴 %FPVЅ|  Vj V e[^_%s%s %s U\WVS}u+8j19 1ƃ8PPVj@uV= uE]S P7GPVSh3we[^_ÐUVSUM ]AB9su)9s B9r[^UVSM1ۉu A9s < t<0t}u[9seB< w\,B<w\B<w+\A9r\A9s TTu TgVR% t:u Q7h07x:u5;U|Q7hG7h! ?h/!Bȍe[^_ustartarsv4crcsv4cpiocpiobcpiopaxU WVS] j/3t@j8ǹuSEP =}8ǹuSEP8SEPe[^_Ðab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedU\WVS1E8$:>@\?t?@?@@@@@@@@0@@@@H@l@@@@@@@@@@@@;;; <@ <@@4<@H<\<@p<<<@=====>>@> 5h/!K5h/!ho9|h/!  @wˀcO5h/!o1'=h/!?$<=t=t=t=$=t=t=t=t=t=t=t=P=t=\=h=kA3'Ph9joG?'3)5h/!B" @πh/!EhRjHjhEP9 t5h/!h9j#nhh91 7h9hȩ HFvhh995h/!F(u =u5h/!h9jwmr% thh:jBm=x`h/!*:ǹu|0PA|hD:jl5h/!f8 @5h/!:?h5h/!5D/ hD9E PURr5ځu$L]en9u]e c%=u=u]e 0(u]e}tSu=u $AAAsBsB@B;EjM 4 }`P;E||M9 |h:j.j)MUM ;E}4jU 4}H ;E||e[^_Ðb:cef:hmopqruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-C-TrUnable to open file '%s' for readProblem with file '%s'TAPEUWVSu] E1fЃJT$ D$G0GlGlGÃhPKS?à ;EPWv t5=P/!uhWw t;WhRKj`2E%f=@tWhRKjj#au/X1e[^_ÐabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinU\WVS}  ʃD$MPPPPPPPPPPPO,Otj,V ǃtj=V Ãtj W ƒt2CZB1tw=uPt>u1e[^_ÐUWVS]jEPSu M9 kt%btjmt'wt2^É DÉ 4É$ÉֹEUEEU9au9w[E}xt LtL*uCÉփGPEUEEUEEEEEU9u9v11ҍe[^_ÐUVS]EPSƃuC fƒ\LE| t@Eu ÃtEHPVS ED\1e[^ÐU1Ðusage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory UhhV謯hh$W蚯hhCW舯hhdWvhhWdhhWRhhW@hhX.hhDXhhdW hhiXhhXhhXԮhhY®hhDY谮hhCW螮hhdY茮hhYzhhYhhhYVhh$ZDhhdY2hhdZ j usage: tar -{txru}[cevfbmopqswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] [-T file] file1 file2... UhhD\phh\^jD usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Uhh]萫hhd]~hh]lhh^Zhhd^Hj. Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sU WVS}tE8uh_YUPCSQǃuEPh)_+j ƃu hP_jS^SJUt=hSRPNEPSh_jKV UGPWu(P/V URh)_j>@F8tjPtGtgtpt NBN:Py/V8 URh_j K0@8uF=t Ğp55Ğ1[^_Empty pattern stringUnable to allocate memory for pattern stringUW}t?u haj ƒuhaj&JQ:BIJ BBE B=t P1}ÐWARNING! These patterns were not matched:%s UVS1t?Cu2uhbj[I3hbh [ue[^Pattern select out of memoryPattern list inconsistantU WVSutمt =u K1Cu=CuFP虢u(hZcjiHCt/CCt /CװэAC A</uC CBӺt99tȐS[t&9utCS džhwcjGe[^_UVSudžu=t|=|mCPFP3%[t)CtߍVC </uPR3 uԅu=|%<=|u1&V|dže[^U WVSu] }F?t4t*t6[tWyt=tt ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s U WVS5hi!AURhPi@hi@hi@h P@iu hi%эA= vhjs@[uh/jQ@<.uuhPj.@1_Rhj@PU2ӃSƃh PSkU|1[^_U WVS]} uVWSCPZ|+wVW P P0|1e[^_File name %s/%s, too longU WVS} E] ހ>/uCI+u ~SEPhlj?57}9r JI9sW;Ur JI;UsE1e[^_Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s UWVSDžPTURXSލ\\T`HTLjHPj VLR= DžP`FC9s9r9twWST0HRLPV }#}URh8mj=Ë`h)‰9t>tT@;Pu*TRT PFC9su9u'>t"}tn\PURhpmj9=U}tCT@t7\uURhm\PURhmhx \u .h \PUR‹E Eƀ 1([^_ÐU WVSEu}@EE9&uE B\u33)؍)á t 91tAIuj uh vjc51A 1e[^ÐUE$/>3)Ѝ)¡tʐ9u1 @uÐUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUVS];=u+jh=o uhw<#t.<\u{#uCS u Shwrpj jCP|ƃ/>3)؍)á t 91tAIuj uh,xjC31A 1e[^ÐUE(/>3)Ѝ)¡tʐ9u1 @uEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]U WVS}E1ۅt?uhyj/WƃtF?tGPЀ v6<,u}uAE1<.u u Why{A9uj@ Ãuh,zRt>u CXC>tJuj[C?t#SW}Whz8K}trE8tjCPEP^}#EPhzj/S ^C Ct$C9~WEPhzj/S BUװuRDBЉ=~߰эAw$~Vw~5w~w~~w~~SDBЉFDdFSDBЉF jHFSDBЉF ESDBЉF$SDBЉF;VU t1e[^_Cannot allocate memory for hard link tableU=$ujh Jh $t1hj,Hard link table out of memoryqvUWVS} $i<f".E%$ )؍)؋])Ë4U MFEv9Vuꋇ9Fu߅twh 6 S譳 uLJ LJF PV ЃwFU6x Vo xj ƃtQGPIt0FF"F $F41!V hj*e[^_qvU WVS}5$f"v~tstn ti% )Ѝ)Љ)‹t= S[t,9Ku9CutC3K SB e[^_ÐU WVS=$tG1ɋ$yt+v3 S u ~e[^_ÐCannot allocate memory for file time table/tmp/paxXXXXXXXXXXCannot allocate memory for temporary file nameUnable to create temporary file: %sUS=(t1jhGd (uhԂj(xhׂÃuhj(5(CS{ <|S S 1"ShT5P/!j(Sl ]Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryU WVS=(u1E8hGWÃS(49>uujFV RP5< ;Fu;V th>5P/!j'CWS5< 9WRSvtvut$M8;F~ F1j: ƃjjj5<h FV |_WP5<A 9u*U8F>(F41ght5P/!j&8h5P/!j& hVhj%t V [^_ÐCannot allocate memory for interactive rename tableU=,ujha ,t1hԆjA%ÐNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryU WVS}=,uhTj$1hu W ơ,t^[tU3WusEPts: EP.~C uhsj ÃtVW}t8EP}Ct,C)3 S hj#e[^_ÐU WVSu} =,tWh7V ¡,t63VuEHPsV0[u͍e[^_ÐCannot allocate memory for device mapping tableU=0ujh=F^ 0t1hj"ÐUEjOt1ÐDevice map table out of memoryUVSu 0t~/>3)؍)Ë It 91utJ} tAj P t1A0A hTj!1e[^ÐUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedUWVS}MEE1=0#E 9tEE!M9Et E!ƃjR}Ãt4KI91utAE8}u }&j Ã}u3t/j ACAK@P@Ѕj5@u%@#U 9uojRu[@P@Ѕ=@~;j t(1@QCAKE%GPhj-hTj1e[^_Cannot allocate space for directory access time tableU=4ujh=^Z 4t1htjÐUVS=4t61Ґ4rtjss 3[u<~͍e[^ÐDirectory access time reset table ran out of memoryU WVS} 4/>3))Ƌt&9{u E 9Ct[t9{uU 9Suukj* ÃtIuwt)E C{EC EC4CS[ hTj1e[^_ÐU WVS}u 4tk/>3)Ѝ)‹tI S[t:9su9{ut,CS ESE3 S 1e[^_ÐCannot allocate memory for temporary filenameUnable to create temporary file for directory times: %sUVS58uohvÃuhjHS 8}Sh4jS S S 1e[^ÐUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sU0VSu]8jjjP EU}VhjrU BUCfEC ECEEERV58_ ;Eu'jEP58C u dVhTj@e[^ÐUnable to set mode and times for created directoriesU, WVS=8D1jP58 jRP58 S58 ;jRP580 |t=u tPSΑ=u =tjW豏F;5dsjjj58 58k 8;5dthTj[^_UWVSEU E@~ L@U19}'YUp9s AB9rEE9|ڃ}t$EEU9s AB9rMME1u[^_UjhVÐU1UUM1:u@=<t=t} uPЃ~1ÐUVSMu ]EPt%~/tu%@P$@ @P@ P J J9r$ 0Ju9r 0J9su1[^ÐUWVSM] }uEPt%~/tu%@P$@ @P@ P J J9r$$ 0J u9r 0J9s u1[^_ÐUVSu򍊔9s B9rM 9s B9r[^ustarUVSu} ~P>tKjhdPt.jjPÃhV[9u1e[^write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.U WVS޿ܖ 1t RuUֿt"RShjhhܖh0vEPShpjjl蹺…g1e[^_ÐU WVSu} hW} k^fdž"džh WSݛjjGdPf jjGlP$jjGtPϛ(jj G|P赜HLjj P蚛80@Edžxdž|dždž <1tU<2t<5džh P SӚ !džfdž"h P S莚 !dž!@fdž"Ɔ dž Ɔ dž E8/udž!@fdž"edž!HL1)ډӁx|HLU:/u1e[^_ÐTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sUWVSuH $`Ԝ=ltw hh0hph dv PhuCcvFPhʛpjcFPR7Acdžxdž|u3E}1Ƅ/jj xPj\IuE2 w@E1jc PEP論Ejj xPj E}1jj xPHLRPV thNHL%1)Ӊȉ%x|jjdP PbjjlP$>jjtP(jj P8uyjjPhSPuEhSOK|jh-L} 0 tu1hj [^_ÐUW| X}1U!V| V}1UVSu} ~P>tKjhdPu.jjPwÃhV9u1e[^U WVSu} 1ۃhWq} Ffdž"dž‰UYt&h YPP術ËU/BC )PWR耓؉UjjGdP蝓f jj G|PHLjj Pd80@ƇH(P)P Z}jjGtP(Ƈ($P PX}jjGlP$Ɔ dž džxdž|dždždž,7$@8888888888888888888888888888888888888888888888888أأpp8 8dž!ddž!@fdž"HU</8-4udž!`dž! jjIP ÃjjQP É,2udž!dž!fdž"h P S[ edžHL1)ډӁx|HL!1e[^_ÐUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sU WVSUuht t u!M cv Ph]3߃WÃuWh Eǀxǀ|9t#hWeP'/Ce1&fjcSVFc]H $ЦtttƆ51󫉆IMQUjj F|PjP]u Ɔ3 Ɔ41jjIP]-PKjjQP,P{(jj F|PjaƆ61󫉆IMQUjj F|Pj{]u Ɔ2 Ɔ1jcE PP_ƆdžIdžMdžQdžUjj F|Pj JE u Ɔ7 Ɔ01󫉆IMQUUHL%1)Ӊȉ%]x|jj F|PRPf th0jhdP2jhNP jjFdPU P}*jjFlPM$\ jjFtP](;jj P8j j$>NP Pnj j(!OP)PI jjPh PPuKh R#@|jj A}6M tu1]hpj[^_UME c<=,ȍP@BtUVSu ]}t =t3=t*52 hj  5hh: Suh5< ~V Phh: hj e[^Uuu uejUEĠÐUVSut%Ġt؋Pk ;uĠe[^allocate bad sizecannot allocateUWVSE} 111ۅuhIW]zpFE5M1ۋQA 9t9rӋ9u ;Mu1ɁEuv]CP- څuh[Wy=Ġu I HADA A A‹EBJA A 1ۃVSRQW$e[^_allocated object too smallU WVS}u U]K)yhlW>y7STJr}uVE؍e[^_Ðallocation resizing free pointercannot re-allocateU,WVS]]EtCE} uhIURxE H@E}=s>NMF 9Fth]SAx]C PV5 ƒ؅u69uEĠUW:M91u9h]Sw9t&9uR WM]93uJ MQ]MYD B BE+E9E~a}XSUE+ExERMq 9t5MDM9w$D9u9zsWU9t MD9v߅tgE9E_=X+UCMKLQAEPQoWMQREPURr‹CBCLMQ] S4Ã}t/UB;E vE PMQS޷ EPURn؍e[^_freeing null pointerfreeing memory outside of block (corrupted?)freeing free objectUWVS]uh|E Pus{vU RVF E9r;^ rhU RuEN9s M 9r9uhɲE P~uA9uy{ }u^0UJʍC9uKEHUE96t"V;UuB;F u U RV e[^_ÐUSM] 9u ĠABQ9 uQj ]LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s ULWVSEE/Lt ?)PtE Eh<h`URu`E=th?h[E؃h_Eԃ Mu4hfPEЃ =h|g}uOEЉƿQEP=EЃ=uhEUz :uhPRNÃu hƴ+5 M9IMMQIM̋EװMUȃhPU̍2EPjEЃV5 Q) ]}WEpS 5 U<2MQWS E h״EhEPhEEEhPE }}č}u}tXEPWVUR5 莍E }t]]SuM]S |}:}tMQh#5P/!rvPShjf 8tjP}W~E8/u?}tPHÃu]t S苏jSEP< hg]}u}tSh 1e[^_Ðcan't get current directory - %sUVSu%Lt ?Pt 1h<h`V؄u`<0t h״g 8tt P%1ۅtjSq}1ۅu6jj莊Ãu!5P/!tPhPSh ^1e[^Rnprsu,ne-p: %s-u: %s: %sU,WVSEEU8eE}7>-x~nFt)-~u76$ $LT\Me?MeEPjE}huhBLeRMJ5h>u E4EPjVE}uVhISh`UR讁Fpu-`}4t*uB`Et ``EEhEPhtR6趯P6Wà u E#t$hs #>u}tHW]SE"t$hs z#V+Ãu΋Ee[^_no argumentsUVS]{uh1}tjEPRu׾e[^lpnzU WVS]11EKnt+ ?t4lt5ptzt(! jhh`Siu`Ã;uVWjFt,E#VW3,tE;uދEe[^_bgjob control not enabled%%U WVS]3=uh?mhh`S!i?u K`Ã;tV3E;uVh*1҅u =u‰Ѝe[^_%*d %*s %s%*d %*d %sU WVSu]}M AtRvQ6hWS. vQ6hWS؍e[^_bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %sU,WVSEEEx?-WUuDj_SEu S|Ur4utmlt ?G6st-E#j5h蔲h7h`MQzfu`}t}uU…u(}u,h<h谂h}tzEPM4\~Uw€UEPwt Ph  QhCE<u=tG0tPWh 9~܃h E]gfffE)ƃ EC1]:tэAEM;A~CэA;E~E ~CEUDPShjhg15hh$1E}tM Mǐ?%u#EPWEPWcZuWhVM}URQ|6EPQ? }"5P/!TPWh CU<Ge[^_ÐUS]~-=uPhb]missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGUWVS]hh`Sb?u `ËEuh3uh)>tjVL8tVh?h@@LuhXjv;uX @1 ;t@<u9!t/|эA9vh|URhSxaǃ|+?ttE+EE|UE?E?t h Ë€tjjhjh u jSR jPSpVƒjEPRV ؀=|tjjjjVE|؍e[^_lmU WVS]1E17lt ?t &mt E |hh`S`u`Ã;uVjjj`ǃ;t9j=3~t@jURP3[`t;ulje[^_ÐTdT@}tLmdie`bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasUE8f%%s: bad numbernothing to shiftUVS]hphh`S*^?tg`tjEPS蟺M} Sh(9N|FF)N1he[^Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskU,WVS]1?>Suhh`S:]uҡ`j$ЉUR tfU]1ҿC=C1ɍrR)‹Es9CJA~,C~CURhEPhEt7EUTЉUC<v;@h"jBЉUR3EЉEE1 ;7CGu EMShHht1fv(fu It\J֋Rtfv fuIut99MuPPhVj119}hP4@C;]|1ۋUt CBu>uGE 0e[^_UWVSM))=uK.K)0 F~݅uى[^_ÐUShx t\1ۡh@ f-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tUtDFE;t9E:Cu(SVnsuSuBv ;u1e[^_internal error: unknown opUWVSu]}}u 1E H#[$ H\pL xH(8Pd;%;%;!tCS2<}Dž<$|`ֿQ u5=VjEPRő{Uu'EEuQh[OS։}={u.EPs[^ Et u}Etu}3hm豴uu ht CRPWVYƉ׃Vhr;o{MMQs] }tkEtu}Mtu}EPs i{}WP/!uh˱P$Ph谱Mtu} Etu}}u=uuht菳!CRPWVXƃVhl1e[^_U j!h h蚄t @15DÐU@COLUMNSLINESUS=@@X9]Shht@5,[ مAftD f vQjjjjh ¬ƒ tCPRçf}t,jjjjh 茬ƒ tEPR荧]UVSu] =@t j^=u =t SV=tSV1Ãj؍e[^US]*(t!jj{jjSji6} =P/!tuE]ÐUhyCÐUMBuRQJHBBBÐUVS];t8FuVPC_JHFVCF;uЍe[^ÐULWVSE<9k<I}}Ծ0 EE EEEEeԿewDEEEEjEP5,D9u D9 u  D9u D9u D9u D9u }t%h?3jh05,C؍e[^_ÐU WVS]1E1tg~ u\U^T tS:MuB t u 1s/ u u S~H:Mu@SӀ;u} tU 2[^_ÐU WVS}j/Wtx1P4l+ WtjjS! Fvʍe[^_ÐUWVSuE>#u911ҹ9}"t<1#t12B<1 %A9|ދE1W19} <1 uGA9|;E |/K|<1 uJ2#J12Iy#E8[^_ÐUWVSE}kE PUR ƃN}ujM 1p ƃ1G;}}jU PK 9~;}hO~} |2/t N~|2/uEPP5EEDE1;}}YE;Er8U)hPPR贝E؉E؉EEU EG;}|E;Er9U)hPPR]E؉E؉EEEj j E }tEP}thPu襟e[^_fileglob: substitute errorU|WVSE}1Pu (111ۃ?t%:<\u u  ;Ct1B<:u;hPj8xjb =thCj'1/hPh@EE耉E h EP5!=E;Er:U)hPPR貛E؉E؉EEEhPUE)$PRr1;t F<uu=W3XuEP3設|8uSV1hPW蹝t E Ux[^_ÐUVS]u FPCPWu F[)É؍e[^FPATHUBu7>*<;\uC9} | uC9};Bu ;<'t<"uЉ])u}t~N|9DtIx 9DuE|9PhCtE}t"9}<>/t A9}<9/u9ЉUEUE0Ee[^_ÐUWVS] }EPWuuSƃ EuEEu t1R`tEPVSMQ҉…uE 1 }$tEM$EM E70Ѝe[^_*+?@!U WVS} E} 1hPGPu7>tW;\u {tC><*t<<[t8~u}t 7*D>e[^_ÐUWVS}1TE װI;E}41ҋu G9v'/u H9v8/t9v8/tH9v8/u8/u H9s)_ÐUWVSu u]ShvjURxWnt];Fr8V)hPPR4F؉؉FhPW ‹EPfhse[^_ÐU"'\UWVS}] jhFvPEE1 .jhYU҃j>PUF) F9tI>PhJ=u>PEP=tʃVWU҃tEt}u SWU҉EEe[^_<%2%E%hE%8E%*l%,W%+C%-/%6%%7%2%2 %PE%D4$<$ 3$,)$($:$xC$ E$E$L:$`:$t:$<|$0n$h7\$,N$P7B$15$,($L2 $2$ 4$E#2#K#L1#1#4#dC#D=#<}#D9m#De#CM#|;H#E:#E.#M#L#L#hJ"K"commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#- 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDUWVSEXhU ‰\d`ldh  xEP5|M)щ lp x) tjR |@H)ы+9|)R z!ƅ}1dtEEE @0 ÉDu=6td d[P;Ѓt5 tVt7JD;=E/Xd)‰#jbjtje[^_USEuj =EfEfE =t ]S =u1]ÐUM=htjX 5% ȋht8u h1ÐUS] d;\s9`)BRPPD Su5`D `d1j]U WVSU`5tװэAPRe} s#l9`ƒpS;5tu(l;`vKP;`wp1e[^_Uu uu1U`+Xuj.9~+Rj5P1U`d)‰Ѕuje 9~j51ÐU WVS}D t"`9v9v  ) } t W8)=d5`E_tPFEs`d)@PPRB p5`|x)à ~C;E~EÉ]rj Fs]Ktj*sp!;5`vNP;5`we[^_UjXP1ÐUA1ÐU`P1ÐUjP>1ÐUWVSE`X9ujK1 =EE;]tjCDu2K_t*$t%}KE9t?CDu K_t$u;]t"KE;]tCDuC<_t<$tEHwSEe[^_ÐUWVSE`d9ujc1 =EE;]thDu1 _t*$t%}֐CE9t=Du _t$u;]t"CE;]tDu<_t<$tEHyEe[^_ÐUS]h9r 9r`X`9s$P`@P:`9r&9v"`P`;`wދ]ÐUSuVÃrjs]ÐUVS]1;tPCƃ;ue[^UE u СD u ÐUVS]5tPC';t;ls;5ttۍe[^ US] uhX0?ӡD t%j^?t @P S]ÐU`+Xuj9~+R1U`d)ujy9~R1UVS`dM|<;dtVCP+1Åu$V5X+Ãu j =uS 1e[^ÐUVS`Q6ڋ XJ9ud|9uj$9uՉ =uS1e[^ÐUj Dj : "d dÐUÐU51U51U)‰Pw1ÐUPS1ÐU=t5/&R)P1ÐUWS};=r;=vj#=5XÃ75XVXh?эD `d <d9vR Se[_U )R)‰@u UUX9du=t R R I-search: U WVSƅ<)<u$9vK9u Vjj<utE9rjn C|>W5X[ƃ|&X)Ѐ^uHP$VjWxƃQE}h{4W |$ҡ} j1[^_ÐU WVSu=} ugbV7Ã|L}} j WDXуD >^uHP$;=sjGe[^_UWS]E 8^u-PװэAPRSz51҅tPSt)ډЍe[_UVSdXd)ÃPơX`SXdhl`VP1e[^ÐU5d1U5Xt1Uj1UVS]pu j j X9hu.jlP j5| |x)‰5hX9hu l9dv xl9dv1 +h)1j C9}x9||޾ l9dvX>9hv*X9hv<Vtjsl;`vKPS;`wpe[^ÐU` X9uj<;dt =tg)ȃtԃBP`@P`@P`@P`HPP`HgBP`P^`@PL`HP``P?`@P1Ud1ÐUd1ÐUd1ÐUSX`)‹ d)ȃ=u9~)yXPۃjS~1]ÐUVShTu5`á\ 0thTPw\Hgfff)) \e[^ nothing to yankU\u `` `` t`R$hh;Sj1 yank something firstU WVS<0t<th;jf{` <0эY`)PjS ʐ`u` H``<tԃ4A1e[^_ÐUXh`dlUj 1UuSXhd`ljW1ÐU1ÐU WVS]hPS>ǀ;t8^u%C>~@?tр ^@K@C;ue[^_ÐUMѡD tL^N?t @M LML%s%s = %s '%s' UVS]u u5ܠPh>L u5bPh>+ VKPh> <t @44 h > 4h>e[^cannot bind, not a tty%s: no such functionUWVSEE=uh>}tB4 Í@0t8 uRh >-À:v!udE1}E@E쐉t t}tuVUR[F~NjMM~PkEA1U<u E<u EӐ} uVEPOU :u}ubÀ:w%Í@4 tM QPs,uԀ;tÍ@8 t=E Ph>{U RhTPE  MU U<u!E<thT4qEEM u* >ȅ}A) ( >ȅ}A)1e[^_ÐU WVShTJlhThl1Ƀ A~1ɉA~C~1ۿ%1%%7CGvڃhTh ls Iy~ٍe[^_ÐUVSu ] ȅ}A)r E[^ÐUS]|jPjj3j C|j Pj~C|jPjgC |jPjPC| j$Pj9]U`1ÐUVSuj 6`9v )Ɖ )։ӃS5jV1e[^ÐUt`R j1ÐUWVSX\E=h}dE=`} +h =`=h=X}э d\RƉX}=\Eh}=dE` эAP | t V=1e[^_ÐU1ÐUjjR1ÐUjj:1ÐUjj"1ÐUjj 1ÐUjj1ÐUjj1ÐUjj1ÐU VSEPEPEPEPX`)Pd)PRjƃ u jfEXPjEU)‰PA1ۃ 9}5E4|F9}h|C9|1e[^ÐU,WVS] EEEEEPEPEPEPX`)Pd)PREP5E ~zuR|1EU)RXPE0 % u hPWE0E1ۃ}t&EuEP }tS1e[^_ÐUVS=u31hPƃC;ds;5|މlle[^substituteU WVS]=hPjǶƉ^5j舛 =th|NjSn=hPVcu 5e[^_ÐUWVS]} ;uhPh&_‰UU􍂀E9r"hPjR`EEEEE;tuWV3;uE;Er9U)hPPRU`E؉E؉EEEhPUE)$PR`e[^_ÐU VSu] hPj#^EEE SEPV UE)t2hPRRbe[^ÐU VSu] hPj]EEE SEPVUE)t t 2SV#ƃhPuae[^expand(NULL)%S%s: bad substitutionparameter null or not set%s: %sUWVS]EEDžxuh'QjkEtSlt eM =te=tM=}t UtM@EhEPhM\EMMƃE]EDžtE(ЉpEDžlMMeEEȐ|EH)…~RVEP~ƃ}U$RRX$Y2YYXM ME $R S,S8S|S0TPSpS(UVxXXXEETMUUECEDžpEE DžpMtVE$F(FE8EH)…~RVEPZƃUEFM9uEPEP0Eu UtEjMQl @EDžxZEDžpEtT$F(F(FU:t3EH)…~RVEPƃMEFE8u)F)FEE EjjURP]SfFjMQ@ES\Ã;EH)…~RVEPƃCF;u`E}jWK@EEPEPEPWEP E0}8jURLƊGPh4Qj@j}GPh7QfMtEDžp}|xu)hPjX@|PB|I|Ef+EfAUfQEAEfA EtUU%t#tX=t'?tFLeMEFF!E@uM(MeDžpeMDžpMjMQjKEEDžp|@ E|RUӃtM|f%t& f#tEf=trf?/F)F|puPV|rZPEEMtE|@|rujVhPQVPeP|r#[|qvYEE tE|@l|Z]9tSSLQP|APhfQWc|@|EDžlU耉EEDžlE|DžlE)EMM;uEEEEEEnMfEEEEEP}tf}tEEEE Mu}t f}E }f}EExtE xqxUB ~HB EP M@RE}tɃ} txt%}t%uEP_E x}uEDžxu8f}t uEUM}t?}(M}lEPWWM Qp EtE%PU RWW Mu}|RU ;BruE j[E PEEtS@<*t<@uHUz]u?1ۃM QmfPLƃ  tEtctCvuQ*t@uh@X9E PLPPE =ЉU}эY=tu}uU Rh_ZMhPj S<PoUE11ۊE<u^:uE1ۀ~u^ӸP t  ]6@u}t/9]<1uD9uM}u}uˋUEEU *t@uk}%t #t=th@xu!M@3)@HUJ@B@j[E PE@<*t<@Uz]}% # =hPhKEE耉EM QcPpJƃ tetVE;Er7U)hPPRLE؉E؉EVN‹EEvuEU)u7EMy@uhPRAO;Er3hPPRiLEЉEЉEEEEUBBMy@fJ Q}=uU EjbM QIUBP MM }@u6}}U8u!M9u=t-t ?t+u1=t0E8u%}@u t+tU Rh_Ve[^_%Rfunny $() command: %s%s: cannot open $() inputUWVS] hPj1XPƉ u 1 f>F8u~F8uvF toBtRhdj jT7PhdUj0jjjrYSǃuSheUEf@ n]StZjjuǃjjwYEjjs)Ys j2V EPjY\iEf@ Exe[^_U WVSu]jVǃ%% #t=tM=9EjE PVAurEC9v9EjE PVu6EK9sq9rijE PSuK9sJE@hP)SVW&9wjE PSuC9ve[^_ÐU WVS}u F)uVWuW;Fr8V)hPPRHF؉؉FWW‹!h= F))RP e[^_ÐUWVS] }C3)EhEPhEEU‰UE%PSEPEPEP&uuIC)É)e[^_.UWVSE 0#}]uE1EPUrYtfMQ9v\~/uVE%f=@tHf=@PRY}uH%f=@`e}unEP9vd~/t^E%f=@tIf=uJu*@PRX} ~H%f=@u/FU;Br:R)hPPREMA؉؉AhPUB)VPQ‹MxE;pv/FU:/u3MH)…~RVQKƃUEFM9/t̓j/EP<tÊ;<ƅ;}ыU\ SMQuk+]DU+~PVR贿ƃMQVэtU 2MQEPtD>uF}Ph+mu$< tC(CF>u9}t WEP2Ee[^_ÐUWVS}]E0EhEPj_@EU‰U*EH)…~RQEPGA?uGP&B R =u1UVSuV4PVhà u,V\u1hpC C e[^U,WVS]}jWǃt{utX1Et8<u$G<{uE<}uM<,u}uGt}u˅t }Et"eURMQE P[U;Br:R)hPPR?MA؉؉AE PPs‹M'}uEPSWU RMQAEE;}+M M+]]G?NJ{u EG}uMtG,}E@)ÃhPUډUUU@PP0Phrhp1ۃ E8t:E|tRE4h"rh6CE<uɃh`E8tjE0RƃE E Ex uEf8t Ef8u*hPj@Z:ǡhx 1Ex tbEX ;tWV3%}:EE~Fh&G;uEH$tuu8uvTxTxxx$y$y{D{zzD{'}h|8x|||vE PEPVEP E PEpuE E E $E jjLJ¡h@ fjjh@ PIjjJ¡h@ fPEf8ui]АSJjjsIuЋE PEpTjjuISJE E E@EEf8th@ @PjIh@ f@jE @PEP{TËE E ]E %PEpE@EEf8tԃE %PEPEPhjMhfjP5à t jEPj藯S~=Tt=H|h'rDjKjjjH¡h@ fjjQH¡h@ fP]SIjjuGuCHTD |jjPGEEXE t j7Et'E u=t jj Ee[^__builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundU,WVS]EE=uH=t?؃;t88ujpjhjhh}9 P3E1j W E E Wh} <E x 0u{E EE x 1jh` h}h`STptEt=SE=`E;EP3E E t4E xu+EE x ;E }t;t;E t E @u+(E@}t E tE xuE @uE=|tM1UB8j MA4ǃ=u7 jhr,P 0P#Phrhc UB|tRWh"rh8MA|uh_jjjEPWE7 FUB<1;u MaE uL=t0j/WmtWh}j9EEPWE E @t: tSE P E E xu?E xtE pPWh}Wh$~j<9EqjjjE p蛝}45P/!貫PE pWhd~j8E0+jW^PW@tu E pWh~j8EE dUE @t dh@X1FuhBNpE @t'BH z(jVEE $E %EE HhfjPӜƃu$E%PE p EdEM E E ‰E %=u.E tE E pE p E FwH$؄EWVfoVh~j8'E ulE xt+E pmPWh~j6E~ Wh~j6Eh}j}6E=u2jE p jhjhh}A3 P$-Et6?Et =t!jhL jhl  ftUE @ xjEPhtfDEEtM jEe[^_EXECSHELL/bin/sh%s: %s: %sUVSuh&P*à t#;tjj5dSÃt;uVFFFu FP0'{5P/!衧PSvh4shcomexec: %sUVSu6OP6hà u6h.j5VSe[^U WVS} 1ҡhXÅtKWEPsVMƒu1CLuك}tӃWEPVBB Ѝe[^_ÐU WVSu1jVPVdËttC$Ɛt$ss 4} uS3sE pC ƒU fzt 1e[^_UVS]1C<=u <*u<+u ؃SPShsƒ2BE B e[^FPATHUWVS} EP`E1Ej/EP' tEF tEPEPhw1t tFtthjEPEPÃtUuHh y#Pw'ƒ uCCCPjREPCt tF tuwttue0uWEPEPhpÃtPt4js t t$hs -(#t{ uA}t)u%EPEPhptCCCPjEu dlPEPtthP@C UtMh !P%ƒ t-EPjREP0tCC؍e[^_ÐUWVS}hp]S3t,uC 8/t ths &#VpÃue[^_ÐUlWVS}u1ۃEPW>6}^E PW} P/!6} u-MʁfuIu f@ut t>ue[^_ÐU,WVS}t Ej/URtGMQEPUR+QEKuMU)PR"+}MUEhEPh EEEu ]j:VEuэLM쐐9ut7})+E~PSEP6ÃWVSE/CuU+E~PSEPÃMQEPSURMQu F.1uun$1e[^_UVSu] \\hjjjh`:SF ЉÃhB\\؍e[^%R%s%s opencreatedupcannot %s %s: %scould not finish (dup) redirection %s: %sUWVSEEXPUDž|DžxDžtt"=t PSÃ}uu}t]EM=tHVhj j Pjhr7P2!PIPh- EHC$d|0DžtDžt Džt=E@@EPS1|E%f=DžtDžtDž|UBPrEqDž|;-u{uEDžxHEPMy}PS/E}uVhj jo Ph@r&|tJ=t&ttSh}jK*htRS0E}}K}u΃5P/!賜PS}t}t}u  Phj)뉡hM@ ft C<uuh<P: 8uVhPPhr'(hԕj hPt17hP 8tP~9TЍe[^%*d) %sUSMU ]4BRqhΖuS%؋]ÐUWVS11UEE:t":IM9}C:u߉] ~gfffAEE)‰U EEuMDPEPhؖSh؍e[^_ÐUWVS}u 1ɋGu%^:u :t:%w@tcMG:u]9sBA:u9rEPVWa(1Ƀt t4` G0ȅtGȍe[^_ÐUMAu19A}u$E w j jRi‰ÐUuuuu u`dbteste_error: %s (offset %d)UEu uhj $++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():U4S] EEuuEP‹EЋ]U$SE UUEEEEjʊjhP藅à tBEt` u!Eu 1hS迉EP|Uz(uB't UBj EPLPUR ƒ Ex(tjjPE@tRP EPR PUR/]end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %sUS]U E$Tl؝C't w &tG(t)t"8C:s*g#CEfEfEE @(P3hy8P3h.P3h"P3hҜP3h P3h-jj [missing )zero divisormissing :UWVS1E} \E@E߃v }t}ugURjEPPURƃ0}!uV }"u~ ƒV }^ }#uFEPRj UR@ƃ Ex$th!jPURH}w*EPjUrEPR@ƃUREڃwEpPjjURUBjVPRƃEPv] KSURwƋE@E]HE@E 902UR<u}tVEPsƃUU w4EPUREPj URPEP4ǃ02}t+}t%}tUREPPURǃ Ev }t}u, u&Ex t G h+jURUE$4Htġԡ\lxġԡ  ܢt\lx0F G ECF  E3F  #G EV UG V )O F EO V G 9F G 9F G 9F G 9F G 9F ~G 9F jF #G E\V 3W LF G E@~ uUB EPURPEPE ~ t EH ~ tUB EPURLPEPE ~ u tE~ ~ ؅uE@ j URƃuEH Uz%th8jREPtUB j EPǃtUJ G EW U} w4EG UBt WREPUR8 }tEF URUЃwRU 90e[^_missing ]UWVSExËDtGDuUzu B(úBѨtGBu[u(W!uh<jEPSNjUz tdUBH@hPEP)PR˅ÃS<UBhPS E@&5_t u#uG_tAu#thPO)PRQUB`B@BX BPP uSjEPYhPS UB'UEP}hE5(tXE(E,E9uEEPURWtE E E EE(u…u UB)Exe[^_ÐU WVS]u }WVSSWSà us C s K Gt SW s W@ }us ؍e[^_ÐUMU Exu@uR(PjQ@tR(PjQÐUhPj @hP@ @ÐU WVS}] {u%=u]ƃSV uBCtCPjWG_KjSc PV%cGe[^_e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sUWVSEEEDž|DžxDžtDžpDžlPЃC$Щ``````````@HPXh޿@u xhP߰эAPSEhBRق nEiEa|VtN5hPhFÃpu p$lthLFlh$h`EP蠒`Ex$1Dž`}u}u|u tthdIUtM8tHj=@PFÃt3hPE0K~lj؋U+8C`EpuEptEluU:thL4ptjjpP jƅUR`PWV}t"}u |th:puUptEluEltEU:thLgpuS}tjjh jhh!jd}%P1}u ltPpPahlt#}%PjlR)}tj hddhd9hv%hhdtЉt}Dž\|t Dž\htd)@)P\Ph讫>WC)Phh莫߃j W*ÃuуWhhbtt;hr ;dahp1?hP@RjPExu$5P/!~PUrhĨq htt0d(6hW贪tt;hr;dvɃWDu 5P/!V~Ph s=u&jEpjhQP\EuPqjjjUrǃuEphd EPw 蕜|UBU@$EPBP$EU‰U+ӋU)؅ +E)Ѕ~PSEPyÃWE)PSãƒ|(WE)SP-u:*w$|PEphD W諝H[^_ÐU WVS}tmj VaÃt C;u19t jVjWBHJPVh ރtC uWoe[^_substitution failedU,WVSu} uhP6w\} IM}IMEEhEPh9EU‰UÃ6u_E+uM1+E~PSEPwÃVEPS趶URMQS裶] }}E PURQǃt}t}z}uh^}֍+E~PSEP wÃVEPSރuE)VP Pe[^_%s: not in history%s: invalid rangeU WVS]u }EPS t^U|+P;stu9vt^Wkud9u`SheD;?uC1PSj)‰HPJ‰U}ShR$1Ѝe[^_no history (yet)U9r }u9uhZ1ÐU9whZ1U ; r8B9t'HBh1@ÐU塸ÐU塼ÐUSU )|9|[ÐUWVSu)EE} tE}эy|9|ލ9rb;]w]}tWEP33t&EP3fNt+E;r;ve[^_ÐU WVS}~^;=tV)49}V)PRhV5=e[^_ÐU=tNt7uPt2thP5ÐU=u)hh-ÐU WVS9rAh2[HPBPR\ hu q‰։эD 9v x u@e[^_ÐU WVSu:IMэY~ | uYhMD P2¡E<} t GSVWŰ;e[^_HISTFILErUWVS=;EhP t8uhPphPz1DžDžj0jS-ǃtjS@jSj)X29Љ;|1ۋPhjV\gR|[^_w%s%cU WVSP )9|ڍ4Ρt]hPyEtE1;5w/>t*j4hEP,G;w<u؃UR輾e[^_US];t.jE PShhj jhjdiUS] uEPSh譟hj h]%s: US];tPj\tPh`h$E PSh#hj 萛 h4\u=tt\jeh]internal error: UVSu] jdhh~EPSh耞hj h蔓t jge[^%s[%d]: US]t&t@t5dPt!d8-u@Ph`hڜt8 t.At'QQRPhh觜@]ÐU=t!E Puh腝h訒shl_stdout not validU=uhvjE Puh+ÐUhEPu׎1҅uE%f=%ÐUhjjhjjhjjόtoo many files open in shellUu u蠅}=P/! t}uhEÐUVSu Lj jVÃ}"=P/! u 3hE} uV9S؍e[^UVS]u uh} SjSVVקe[^can't create pipe - try againUS]S1}h` j3jsC]ÐUS]3PsE]bad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameU WVSM} ]DtoyuijjpVF}tphu5t0tu ttt9u&'9puyu SWt4e[^_ÐUHD@PLÐUU@|%9u!R5@跥@ÐUD|!@|9EuR聥DÐUUH|9uRUHno coprocessUU Et@H}tÐU@}t =D|}9|P@D|P¤DH|P裤H/tmp%s/shXXXXXXXXU WVS5uэQ+UuA?PǍ__GE G VhEPSS[|jjP߇GGU:e[^_hargument must be %job or process idambiguousno such jobU WVS]Pjhj+j)hDhu=tjjj=u =t1  0j j PKyހ=t =t jQe[^_ÐUVS1S;u{C t$uoCu=t`=uW;XuOCu jS# jPy{ u"Cu jS# jPQpt j`9Xu+|"P5,赣5j} =t e[^j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlU WVS=jX1=,|=0%ܿ}(5P/!fPhj0 =tCj jh jj謟5,.;uӻj j PKy=X9Pj聽}^5P/!fPhjg 5P/!ePhj9 P5X5,0}-5P/!ePh(j X=uhHj,h0PV=t-j j PXKy; 0 tj R PKyՀ=uGe[^_Ðexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procUWVSEE te U REP^]Shj XFFF U t<=u5h(jE05EU uu @E@ UBE@ @$@ @UBPЋUBr(B05jRyEPhQj0FPU UeWZ8Å}W=P/!#u tЅ}Ct}t't@thWS C HwK }uut 3C thSujEPj1e[^_notifyU WVS]Shjԏ5߅t6=tF@thjVF HwN 6uˋ5t F thV*ޅuhhwjWjKe[^_ÐUS]Shj&tHjSj ]asyncj_async: job not startedj_async: bad nzombie (%d)zombieUS]t B%=uh RGCuhjC,@ z1ɋt&9tB ttA9B}ыuu2@ tt>Rh,j "hFQ 9v]ÐUUJB(8t 8uB,=tj5CÐj_waitj: tcsetpgrp(%d, %d) failed: %sU WVSu} FƒVt F=uXSht FÃ$Fh荰 ^tÅF tttFƒVT$F==~~ u5,蠍F`|N 55,Z}*5P/!QP55,hj 0~ uN F4P5,,|^~ u.~u(F t"h0R9f~ %Ph0Rk~ uf F,@=t.~ u(ƒtt } RĭF$F ^u/=t~ t?hjV6hs ~ t=tu uV ؍e[^_ÐU,WVS=P/!t)9BuBuuރEP>DuEP$Dt J(t 9Y t uuuEEEEEEEEpE])ÉB$E])ÉB EEEEEEEEE܉Au At A ARxjVjÃ#=P/!e[^_Ðcheck_job: job started (flags 0x%x)checkjobUVS]CuPhj61ɋS(tB9~uK C,Ptt@C@ C CC HwK9TuT5H8C0t!;Lu Pu5@C @C={ ujS=Ct|h5tB t fxtHRuVjQsl5jS5oCu{ thSW=uACu:{ t4;t{}CChS e[^%d RunningDoneDone (%d)[%d] %c %s%5d (core dumped)%s%s |%-20s %s%s%s%s%5d %-20s %s%s %s%sU\WVSE E} u.UBu R,EtB PhEPUxUbEz ~E9EuE+ U;uE-EX(.UU1CtB ttgtEECn} tWCuEEaPhj@URwH{}} uuCt uECEPa"} t0U;Z(uEPrh URhEPw} us hURv} u5}tpEtPEPhURvCEЅtPЃ;tPCPEPhURjv {sj} u6;tPCPhs EPh&UR%v +} u%;tPCPh7EPut9{u9st}thURue[^_ÐU WVSUEtcR莛tS,t 9B utSt9mu} pE bU:%t} ME ?EU?$(EPș9Cu1s(t=E@PFPtt} U ߋ6uċuX}эq1t:VC(PURdut} t.E #ߋuȅt} t U 1e[^_ÐUSt hjd=t9PutBꐐQȋ]ÐUt ‹hj@‰Ðremove_job: job not found (%s)US]t9t$‹t9u9tu hj*mS(t Ћu C t9Cu ;u ;u ]ÐUVSM] օt9t‹t9u9utt/ ‹tx t [^ÐU WVSE} 1X(t#C tWP}}u݉e[^_no closing quote UWVSPLhTDžDžL`PhTiDžx@h|PjHtx‰pǃ MtDžXEt5GDžX`BDž\GDžXMt DžX t\t= u\#\\ t\ t\#uUt\t= u\c#\\t \ u \P"B t$B =tUtMXLXt X u\EpH)…~RWpPu>ǃX UX$84p<\`\[E`jt_dP tmG[Gd;t9pH)…~RWpP=ǃGCG;uɃhPd2\p$j‹dB BB8 \*t(\@t\+t\?t \! t\t= u!Ã(uL G\G` `T;JuQR!`` oSC \'to\"\\t\t= u\ W \\ . G` `T;AuPQ ``DžX G` `T;AuPQv ``DžXS \\t/\\\$H\`6t\t= u\3\\$t"\"t\\t \`u 5 pH)…~RWpP:ǃ\y G\GV t\t= u\\\(t\t= u\;\\(u`` `T;JuQR``DžX@+tPG \QI` `T;PuRPL``DžXAAG \{cG{GWpPǃt\t= u\ \\:u?G:Gt\t= u\\\#t \%u[\P ` `T;JuQR#`` DžX \R` `T;AuPQ``DžX \PGXGpH)…~RWpPl7ǃ\Gt\t= u\ g\\FuGGXG\Pb tKpH)…~RWpP6ǃGXG\GGGXGG$G\Qa` `T;PuRP^``DžXGA=(`h9t8u`A9@\'uO``;huRTQ``XG \"``;huQTP``XG+`A$\(t3\"t\\'tc\)t\\t&`@`J`A`@q`B[H`AL\"u`@4\\u+`B\'u`A `x7``;huRTQ``X\(u`A%\)`BHJ t\t= uÃ)uH``;huPTR_`` XGS`Xt)PSsVZv(G`BBDžX +\}s \}uO``;huPTR`` XG}G=\|\( G G` `T;PuRP`` \`uGG``;huPTR`` X\\gt\t= u\ \\$$\"t!7\\\`u`zt "G\\b\)uS`B~ HBQ t\t= uÃ) \(`A\\uWt\t= u\ s\\G\G\'uS` `T;JuQR``DžXG\"u` DžX G~G\Gl\"uG` DžX B\\urt\t= u\ S\\$t3\"t(\\t\`t\tG\GG\G\)uC G``;huQTP``Xf\|u GW\(' G G` `T;AuPQ`` DžX t\t= u\ \\pH)…~RWpP-ǃL9`th8uX u DžXt\X)t$>FEhPjYǃu FЉ\>ƒ t\t= u9\t\uk!\>u GG G t\t= uÃ-u\O b&u\u G G\>u |uO@ SGG G|ts=L9X{|R<\)P2\&t?\ &\(\;t \| t\t= u  3;\uA\;t(\|t,\&u\\|us&unDž\k?M =uD t\t= uÃ(u Dž\ S \)G|t)WPXH\P ts!BFs\Bt)QjV)i\tt=tE S΀ƃUtMVShÃt5}}C = t}u hP5轰C MVhthh轁Ãtptkzu9Z tWR8ztp$j‹C BZ B8hP5& 8[^_US8;`s3:;`r`8]here document `%s' unclosed U,WVSjEp LEUBuEhEPhEU‰UÃEE}UB E]U)U@}t t3E9uVEH)…~RSEPA'ÃCG t\t= u  G ƅu?ut u ]]V ?uEPh EH)…~RSEP&ÃC t\t= u ƃ uEH)…~RSEPV&à CCuE)SP>UBBu e[^_US A] wQ8ыBvjYSuhVh?U WVS]} Wj<ިƉ^FFFFF F8~$Kw%F0~4WF0P胨F,F0F(F(F,F0F4e[^_ÐUSC$T x         1S3C CC CC 8uCCCCS tC8 P S B 8t5jr \VPDt[8K C8S  P t&K CCCCC8}.C9CthPs $[8C;uCC16C th3GQhI ]ÐU WVSu^,E=t ~ЉU1}t F F()…~RSF(P"Ã^t\tPlz=u=u =t"hS}1}tj5Fv F()PSLu3V t%z$u (tɃjw뺐t0À{ t(C+F,+F(~PSF(P!ÃK념~uv G5t =tjUyF,F)RP9F,9u~uv Fq}t{‹,u):tX B:tE<}u:t/ujv,袮FPVj6Pܭ}t jje[^_PS1%dPS2UWSE] ,t/h 蓢P葦E jjBǰэMPjCǃU:tRE8!u EU:!uWUPE6Mt C@1Ph WOE8uWDEhUjjhPzt$)EPjURBPh P}e[_ÐUE hEP2MhDmissing ] U WVSu 1t<\t= u  Ã`$x #u Et t E[EPuh! [F];t/UH)…~RVEPƃCF;uуhPumt<\t= uEuuFP/UH)…~RVEP4ƃF@e[^_ÐU VSE hEPj(:EU‰UÃt<\t= u E EEH)…~RSEPÃEC<[uF }]uN~ }t} uCuE)SPc‹E%e[^ÐUS] tH =utD;PvJ,p$jCˆZBBBB8]US=t8u#)= u' 8ths` 8tKÃ\u18t+ tƒP ؋]UVS]u hPh8pS e[^US]E H @ChPRbt]MAILUtSjkƒ=,u,+,;0,th s1ۅtktf_StMEPR脱u9E%f=u+E EtE9C t9E SEC C u]ÐUE0ÐUtS]$thP? thP%hS $t*EPS豰uE%f=u E( (]ÐU WVS]5hSZƃ uj:PKƃtFEj%PJÃt0{\u&߰QSCP[Cu =uj?EPJÃtCSEPk¡Qe[^_ÐUVS]t1ދuhv褟hV蓟uЍe[^ÐUlWVS]u hj_wEPw uE%f=u EG G e[^__you have mail in $_%s UVS]jsjh VjCu Pd:Ph (jV螨e[^IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION) &    )   )   )      u f V @ +                        ~ { x t whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV)   =  U|WVS7JE 8uE EU dhb}1fE]EP@h 躐1p1jhhpijhhhijhhibj@hhi =t%1ې4Oo<u=t'1ې4o<ujlD jjjgt)@PhP萔Sjglh ej5lP}dװэt  1t  t&ֿ{ tֿ ujjj?H/!t(Ã;t!jjjh 3[ ;uOMXjjjjhD ,jhd 3h \ǃWUÉރ;/uN\PSq|7Ph V|9\u9`t1V, 8t P+ 8utjPWUkÃSh  蚑P]j3XPh oP2,jh h OP = t%Sk;t ;u;u` t $h Ãt'=`u2j#SȔP@uj5$SCƅ@;`uj k9tƅjjM QÃ} jN=tShPj0ƋU FCuh JM  dC;]}w=unhPjƋU FCj0jjv)-F u'5P/!Pvh FdhPjZF jj蒠 Pj-F j-t0j-tN F FQj/|%f= u j~%=%Pإ=tCh@M TPM)ىHdj輻= 8u=th jÜ=t=jjjh #=u*jjjjh .P=t jjjh+ -h= 裍P衑jP.8tjjjPE 0u#h  WPUP{0tthD gt=tV7ijVV1x[^_include: %dU$SEj0jjEP7*Eu }thPBEBEEEj0jhPà EtEp g.SEt hQEBQEBCw\$h! ! ! ! ! ! ! ! ! }t=t SSh jd}thPMJ@U PhPjuEEMH hPEP‹EPjEPÃEp R- >Et hQEBQEBۉ؋]ÐUS]hPjXjP+]shell: %dUse `exit' to leave ksh U$SE@ EE 1=t E %EEjEt jhPÃC$`# # # # # # # # # EtMuh諚=tExuEt E@MUA;ESESh" j'(t jhEx8u=t EH  E` EtɴuQ=t腞Ft8Àtu%jj PhSjv@ 5Ch@hPV^e[^ÐU WVShtJ{ t<1{C f()*@#!$-? =-+?#% "#$&'()*;<>?[\`|U Iy Iy jhi) jht) jh) jh) j h) j@h) hh) 0123456789ABCDEFUWVSEu GG[* K1:ȅu[^_ÐUW}u1'Wu Q蔃P}ÐUS] |"uCPgSuP?31]ÐU WVS]u U{C9sCCs PW܄CS‰)e[^_Ð- a}- v- cp- h- eb- X- L- iD- k>- l5- X-- m#- C- n- f-  - - b, u, , , p, r, , s, h, v, , , , , , xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexportU WVS}1۾l+ ޅtWP;?u C"v޸e[^_onoff%-*s %sUVS]uM D- |t- Rt3h- uV,e[^Current option settings set -o %sU<WVS}h4. DžDž1ۃ1l+ t<ǰэQ55;~C"vPPh- PhNhM. [1ۃ|<3tl+ tPhQ. 1C"v؃h[^_U,WVSU1ɉ׾l+ |Dt <tBA"vhPWe[^_U WVS]} u|  u9it tu!ty]uGtCu?`PU5`VWPUHWPUu t}uGwX9u e[^_o:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierUEUt1-t+u%xu-u=uE}t$1҃}uEu EM<t}}tKE܀8tjP萉8t0URh0 kSh0 j㐐}t5uM<t F}<uh= E)VUP}t;EEPMQ}W衒EU<tBM|uUEe[^_ÐUS]j EPSW€;tE8u~~1 E ]%s: bad numberUVSuu VÃuVh4 :؍e[^ÐULWVSu] tu 1эLMэ| }uYWSsuH)ߍW@w}hPRxǃSWo7VW%7%EPWSEPVQe[^_*+?@! UWVSuEEE1;u >F*t?u E[uCE~~!u~~]}]utt}uL1j}4؃Ph5 &tEtE;E4|ut(}u"1@)ut msꐐ}tMF;u  1}tu }%e[^_ÐU WVS}t5}t/UE1ҋM 9MsME<t91ME=2?*E[tG=/=!== =tREPETGU9UMMQEPURM QEP tEE;E rjURMQjEMExu'URMQEPU RMQp }jEPWƋ]U 9wuMQFPWSEP* tPURMQEPU RS 9]t'MQEPEPU RS ~C;] v;u]jMQEPnEMUzu'MQEPURM QEPt }jURWƃ]M9MuG] BEPFPWSUR* t$MQEPURM QS C;] v;u4눃jEPUREM]M 9}jEPWcƃURFPWSMQ0u4;uu1u)URMQEPU RS\ t 7C;] vMA9uE9EAU 9U%e[^_ÐU WVSM] 1M19u A9!tAA<uA}<t  u(u1[uqEl9u7y-u1yuy]t%AuA}t9~1.9t 99vy]l19tA[^_ÐU WVS]} 19sK;u>C<)ur<|u}t uC&}Ph5 -!tFC9r1e[^_ÐUUuE PRU WVSE +E+U<֋M M9s,36U҃u ܅}Ӑ9}vkM17U҃uMՐ~89uM볐MEiE뒐9uT+UE )9| EPU RGP] MQSEP}UM}e[^_Uu u.ÐUEU @@P @@: %s%s-%c: unknown option%s%s-`%c' requires argumentUWVS}] StDEtC-u%x-uxuBCKt-t C t+u @EuCC$C-u  CC}?t3}:t-};t'},t!}#tuVEP=uuOE8:uECCCEPC *> )> tRʅuRh-> @<:t<;3LS< t S<;u CE8:uECCC:EPC *> )> tRʅuRhE> j{ C t h|?j<,uCDCCN<#uGLS< t Et#щK̋tEtS뱐CEe[^_%s'\''UVSM1ˀ;t%DBuC;tDBt;uQh@ u}ˀ;ti;'u@ )PS}1Fuh@ ;}AuQPHAQAC;ut h@ |e[^%-*s%*sUWVShP]CSlEÃuU Dǃ} t9~ ߉;} ~} EË5)ƉEEE9}1ɋE@E9}cNjuq;U }GE@PEPRURUPEPhA URS 9}hEPhA UR59|uVj EE9qhPURpe[^_UWVS] SjEPEtg]]9sJF;us>tE)PjVǃu})SVEP6+];urEE)EE؍e[^_ÐU WVSuU }~)װэY;]|]KSRV~&3e[^_U WVS}1EPE PW#Ã}0u,=P/!#u#W$~ P/!#؍e[^_US]jjS_|&u1#$PjSj_| ]ÐU WVSu} u%hPhiÃWSǃu=t'hP߰QS:khPSme[^_U WVS}u jjW^t*9t$P/!V"P/!VjWs^e[^_UWVSEEEEX} uE U /uE@)/FD>U+~PVRƃWSVhSEp  }=P/!t61BUr/tSVEPƃtʋ[^_U WVSuthPG0PQcáhC,C0C{(uE Pukwǃ |/ t= 8j jWhXEW }}s,SSg11}E tu SVWe[^_Ðshf_fdopen: missing read/writeU WVSu ]ttBjjEPW|(tt tuhK jpt/thPWaC1C)hPG0PaÍC0ChC,EC CCCC {Cu{ C3C${(t EP$؍e[^_Ðshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeU WVSu ]ttBjjEPU|(tt tuhhM jot {t9{(}hM jnEC CCCC {Cu{C% C$t EP[#؍e[^_shf_sopen: flags 0x%xU WVSu }]tuWhN j6nuhPj0X_ÁhS,}u&BBu@RV_EC ECCCs sFCs;C$s(؍e[^_ÐUVS]1{ |"Shƃs o }ts,Scts,sbe[^UVS]1{ |:Sƃs }C CCCC e[^ÐUVS]st-CPSuSjCCCCt s,S6be[^ÐUVS]1{ |SLƃts,Sats,sae[^shf_flush: no fdUS]t1tx{ }hQ jktC$P/!I t+ωC ~$jؙRPs C CC@u1jS]shf_emptybuf: no fdU WVSuEFu~ }hQ j6ktF$P/!1 t"E t1VEf߃t^U t%@=@uv,FPv]VF)ȉFF)ȉFFFVFN@F^)ÉDž~]SWv }AP/!u>}ِNF$FF9SWP^^)롐E tFFFf1FFFFN@Ee[^_shf_fillbuf: no fdUS]C{ }hOS jitt{C$P/!q@tjStfK CCsss C }=P/!u;}׋C (}"KP/!C$C CCK1]ÐU WVS} }P/!tG$P/!@tjWLG tg}uT}}*G W)‰ӉU Mڃ9.u9w(G ‰;Mu;U v+E G E GEE1]EL$\ ] X^ X^ ] X^ X^ X^ X^ X^ X^ ^ ] X^ =^ ] X^ ] X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ X^ P^ X^ X^ X^ H^ @΀EE}}} }UU] EAEЉEE EE E UAt(}UTBЉUE EE EAuM }}E}tUU}}E EE }}E}E<w E ES$4_ b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b ` b b b b ` b b b b b ` ` b b b b ` b b ` ρ t EUJ E}OEU BUЉ Uۍ}}ԃ$` 0a Wb Wb Wb Wb 0a Wb Wb Wb Wb Wb a a Wb Wb Wb Wb Ga Wb Wb a } EEE @EЉ Uۍ}}ԋ=[ K)0 хu}u}t K-t K+K U BUЉ$Eۉ}}ԐK$0ute<0ta[E[ úetEܼ[ E @EЉ Uۉ}}Kȃ}܊8utK}tXxK0CU)‰Ѐ}tu9E~ }}@ZETEEXu[ ߰эA$E}GEE]U BUЉ};E}E}9}%)}]%@=@<+t<-t< uUBtYk<0UBuRPH}GWGCEM}~N 3‹EEjhHE;Er9U)hPPRqAE؉E؉EUEjEMME؀ Eܐ EH ET EP - u Pƃj@hpj5Nu!i ui Phi mhPhtFS]S F"FS ~S}W  u P ƃjF FW멃j ƃjhFS]S< FS[ S]S j Q ƃj9FFj h ejƃu j jVjjp ejbjjVjL !jhj5ƃ "}~hi 豓UMEEPu̓}uhPURJAF .MEhPPURf>F ft fE;Er9U)hPPR!>E؉E؉EEEhPUE)$PR=FE;Er8U)hPPR=E؉E؉EEEhPUE)$PRr=F)hPu@hPu?e[^_ÐUVS=tj &wÁu{u} jB jzƃj Sie[^USj hJjP Ãj8Cu j C؋]ÐUS=tj,Vv=t =t$JjÃu1jkj ÃjC 'C 1]ÐU WVS=tj uÁu {u} j11'SkuƉGFƃ=u&h3u9u 9uj Se[^_ÐUWVS}hPj@9EE@Ejkƃ=tj t(t jh E;Er:U)hPPR2:E؉E؉EUE=tjt|iE;Er7U)hPPR9E؉E؉EEEhPUE)$PRf9Fjj)jF=u"j Fs9u 9=tj he[^_%s: invalid function name U WVS} u+Ɖ>t'Eu:=uVh5w xB:uڃjDÉsf{@Ctj j{ hBƃ fBjCjChPjG6‹CPhPj,6‹C@C@C@@:C@@C@@hPj5‹CPC@C@u h`؍e[^_ÐUShPj@5EE@E=tj :q=ti;E;Er8U)hPPR6E؉E؉EUE=tjp={ t;t jEU)uhPR81e;Er3hPPR6EЉEЉEEEhPUE)$PR5]ÐU WVS] u}ucXpxe[^_Ð{ { { { { { { i i { { { { { { { { {{ }{ { { { ~{ {{ x{ p{ newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifUSj hhz =z tU WVS}] =u0@tAPjE1u =tȅuuu5h u (u )CwxuGu?BHw0hP| zuy P!EOtJhtSWxƃE$tht 5 t|}uhP4` EW;BrA+ZhPPr.‹GPGPډGXGM e[^_ÐUVSu=u j@h=t1mV;BrD+ZhPPr$.‹FPFPډFXFe[^UÐUEM }+@P)$uUU1ɀ:t HB:u ȍAÐUUE MBfBfBt QRUWVSu] FEVU6P:+19}@9|f^ gfff)fV~}1;E}mU@EtUtF EEFu:Ft=j×@=j襗E8tlt uFEeFF EPct u%FthEP$EF E Fe[^_UVS(  CCtC t8tjSP NyӍe[^UVS  C0tjPS7 Nyލe[^ÐUVS]u C thP#hV|C Kt>t 1ҋC C@t u 0Ct)t =t($ωCu C C jRSxe[^ÐUS1C ujjSOC%{ujjS-]ÐU}tjjhÐUWVSu}  F u0EPhR&V }u FF]FtEut =u1[EPVuFE t~ 9~t$~EE}jEP6e[^_Ðsetexecsig: unset signal %d(%s)US]C us3h j+KʃωSE t~1tt!% t C S]%S #no-vars# #no-args# ( %T) %T| %T%;||&&%T%s %T! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi whileuntil%s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%sUWVS}B$ܒ 4 Г @ T Ԗ Ԗ ė < | ȓ p Gt-Ã;t>3h E PEP ;uh E PEPk Gt1Ã;J3h E PEP= ;u$h wh E wh :wh .wƑ fuÑ Pwhɑ hё E PEP|hԑ E PEP1ۃG8t'G4hב E PEPlCG<uۃhۑ 6wh E PEP;f? uwh E PEPE EtRh E PEP_3h E PEP;uh E PEPwh EPEPh wh E PEPwt{E Eh E PEPW^;t3){t|P3h E PEP$ ;uvh EPEPvuh& wh. E PEP5ǃh E PEPwh= E PEP t0h E PEP|wh4 E PEPd Gt6f8th E PEP?whE E PEP' hN wZ f uT Ph` E PEPhf E PEPwhk E PEPh whp E PEPhv E PEP nwh{ Rwh Fww ft PE PEP8 'wh h E PEP_ E;t3E PEP;u_ ;t_3Fu~tEPj +EPvjv ϷPh E PEP|E 뜃}tEPj ܿe[^_< <<- << >> >| > <> <&>&%s U WVS}Ept8t3t.t!tуu49tJ1ɋE9tWB0P@C$@ X l Й h U R t h nh U Rbh R@th U R>h .h U R"}h U R h E PWuUB t:Ph E PW(UBtP Bt PE PWe[^_ÐUVS]u `u-V^}$PV@S=؃u&V^}$P躽Vj?诽 VS袽e[^ÐU WVSu} EF w$ ( 4 p  , @ Ĝ ̜ WPF-F}t"t `t$uWj\WS{Wj$Wj( >tWPF>uWj)跼F.Wj$衼Wj(薼Wj(苼WPF^>uWj)gWj)\F EWj"EWj"Wj$F<{uWj{FyWSFu^F<}QWj}3WPF躻Wj(读 'Wj|Wj)葻 e[^_UEPuu uH1UDSU]SuBPu R袱EPujSS]ÐU WVS}UE%UPE:j$ X X ؟ Ğ < | ܞ ܞ EPwj_uF;aURPC賹;uBEPw"W1duj ЅtPkÃtK-uF;URPC;;uEPU Rw^UBt;uRj;EPj yURj ڸ] uF~EPj 躸~GURj 蚸K,wE PUR URPkuFUuSe[^_ÐU WVS}u 1tE Pj &NjUfBfGf: uE PrCU REp"GEPu GQӐuE P)ӃS GƋUZE P3;uEPu GQӐuE P)ӃSI GƋUZE P3s;uUB tU RP11G E PUrGE PUrGUBGe[^_ÐU WVS]u jSR)߃VW WSPYe[^_Ðwdscan: unknown char 0x%x (carrying on)U WVS]} 1C $H x x 4 4 Cu볐FCu룐Cu$tFCC9uu,{ vNpCPh jXTe[^_USPF Sj$Sj( >SPFδ>uSj$赴Sj(誴Sj( SPF蒴>uSj)Sj)wSj$iF<{uSj{TFSP:FuF<}Sj}3SPFSj( Sj|Sj)ݳye[^_UWVS]uE P+]S EU:ME ME Pjv EU}uExtU RpMAUB tM QPlUB MAtU RP@MAEEU<XM؍e[^_U WVS}u Gt VP Gt/Ã;tV3 ;uVw Gt-Ã;tV3 ;uVw G t VP.VwKVw?VW} e[^_ÐU WVS} uLCt WPO C t WP; Ct WP' WS ue[^_Uu u̦ÐUu juf/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %sUVS,|P),0jjh Ã}q05P/!pPh j }E1j茣t1.jvuh\ j|j jS,}"5P/!Ph| j; fP}85P/!辅Ph j 5,,}th05,t S۾e[^U,|P輾,UShPjPC SLh BuCC @CB@CCDCHjSCPjSCPhBCLZ]ÐU WVShZ{CLBsNxAt3@t-Pt P@ PNyC ts(SjhPS,e[^_ǫ ë      { q h a Y S L LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNSU WVSj hh= t< 17SPSh` B <7uˍe[^_%s: subscript out of rangeUWVSu} jVÃ9;[SƒhPBPCP%~ǃjW踡EhPWhP)SV}ƃjEPEPUvVh= EhPEPe[^_bad substitutionUWVSh@EEPEPuǃW E }thP C5hsStM1uvuAtTBGAu;UjMA4SKƁ5 B߃$|  P , P P P P P P P P < P P P P P P P P P P P P P P P P P  XC *C 6C UBC c7C #uSL|h@EMQWuV}Ãt}uJUBLu΃MQWVÃ}tuSà WtK؍e[^_ÐUWVShXEPEPuDEPNjU Eu'FhFWURCP ƃ} tHuC1Ґ[LtWEPCPpƒt߅t% BtBFBF}tuVƃURztNe[^_Ð0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzUWVS}Gt WEu u ww E@ tE tG G }؋_u NN1EM Eu t9N#Ngfff)э)‹E ~ NUGu  }N-Gt VWƉe[^_%s: bad numberUS]EPSuSPhm  E]%s: is read onlysetstr: %s=%s: assigning to selfU WVSu] }t+FPh jhhtEV 9r-UװэD 9wSFPh j vv IƒFttSVÃtSVe4vSvF tWSV5u1 t V e[^_ÐUS]U CuE@ hHP jPPSS  t S ]UWVS]ECt S uC uC U CCÅu 1E-uEz#u}uc~^$Y1EVMt?Dtt©ɨu|9} Ǎ< Cp}tߋE 8e[^_ÐUVS]EPu ƃu1L%uss EC {us t S~ ؍e[^%0*s%.*s%*s%.*s%-*.*sUWVSU װэqE@txupMQhPZSE}]fU _D ;U v#B DtJ;U v BDu+E 9~)E ؃U RPh)SMAtu Et; R}WEP{U MY DtE u Dut} ?0u E E 80tU RSShL MQuVzFP} WEP|Ut,U:tT Dt LDHB:u2t)U:t! Dt DHB:uEe[^_ÐUWVSE0EtP UMMϰэY} MUE0pUDPƋMq SEPV艱=FU+J JEPU RVg}tMqEPe[^_ENVSHELL%s: restrictedUWVSjEPEEU9@}?[uMW? "E t*A9}Ð}:FB9|ME8=u'hPE+EPEUR,qÃ} ]E=tJ޿ t&޿ t޿ uSh E tPS Sǁe G tURe PE}E@t$}u}u E tSh }thPSE EyE]Q1EEu t4}t9t*u E utEu tE}t8tSES KEtU#ut C$U E!‰t}~}t9tUSE tEC}t_jQS$u4Et$ tss #C}tsUR[}uh_}tSa5D;uPjoEj\;u$ tx u)S 5RSuADt#uuW5CÃ+j YDj OD /Du29ptp pVP 2 @ @ e[^/?U WVS] $  T H |  =u^St3 tr#4\=uH=%P m ddhCσwЉh4dS u_@@ /ujjh jjh !t j)= R@@ j װэAPRP!j( ؃ t"B@Pr!2HP @je(ӡDthDCУhd4dlCσwЉld4d49؃ utӡDtlDCУlhullhd4d49tY؃ tSyqu\d4d< t uJu=u08<Ph58;tu_t2H<P/¡H )щʉP P3j3&; u$@ @;5u~JV< Dtօ~)VDuօ~V<Dt]<P.¡)P K9}މ5B B'u U/<}0=t'HP  M@ HP  -@ ~u"HP  ^@ HP @ HP  @ B Bj$ct?It=h45ht(t %P$hth5]tvtc=tEMQRPh5 u>Ds==5 x t1@,jjHB Bk jh j ¡Pp pn F8u,cu9Fct9t SW&>ytSWx>cIvx t@j5h/uJOC1j5huOڅtBtHBp pp p p pB3HB*u=Gu @)=)ǃ_S5hG;jh j¡PP5=J)P5)= y g^u QAK S9~)׃Ps*P uL=t+@Bjprz)ǃWh t Ppp8|zIJ K S9~)׃Ps. xWp"[ Q9}׃RA)P p@)P )x25P<9u EHH ?>NuhW55nÃ}!} jrjN>& %EЋUDu uCMDu tфOtuuDu# tUC Du uDu uC Du t ʄiOu^;1Ҁ>t- Du; u  t1҉C;uډP;P tBP t0EDu tGCtDu ujjhx ujWVe tB~HBux dHHDt!L#t"DPB HJ9}AJKuzP RppY-…| @nj58==zWj jN=uBt ;B |HB1e[^_ÐU WVS}U E1t$$ ,                        T    L h          M                   l                           H  ,    T              , }uxW }uxW }uB@;B Wj "}uB@;B W ƃ}r;p dF^DBD 5EftFuEa؀:,uEPSW5ƅ}F}u zr)1}u B@;B J r9}uB@;B _WW}uB@;B 3W+1X K9HDF9DuH 9~΅NH 1pF;p }@P%Etۡ;p ta}~F;p |INxE@PÃ;]uG E9uOu}t}~F e[^_ÐUS]4=%P5ht 'KŋB~HB1]ÐUUE )УtPPRhÐUE[t1(t")t5K{t# ]t,:}t+1+# 1Up ph4Z@ 4ƀ4U@4P Rh4pÐUVS]hjƃhsFCFsv=C F CFe[^UVSu] s svrC F CFSe[^ÐUS]hshS]ÐUEM ||BJ00H@ B @B0|EP5#  U)‰9~)У)  $ tA9tBA$hP5h5$5   5$j 5G~5$j 5 1~ )‰Ѓ(, 04ÐUju uUS] }tB;B};B ~FB AJ  ;B|I+JQBBPBBP<X SuPPRX1]ÐUVSu] B 9t)PBPBPր))X e[^ÐUWVS}U ux t6Hr!ÅtA;K u IxC9us}ut I A[^_U WVS Q;Q mMA]t'5;Q }gÐBEtT;Q |MDuNO Eu*Du4;W }B Eu Du;W |MADt!E;P }*_񐐐BDt;W |;Q } m:[^_ÐUWVS}HEr}EEI~lUBUDuBt]Ix4CBu%uڐIxFEuDtA~s[^_UWVSPH 9m}MHE M}B;U}pG uDuuF H9}NHt]K ÐB9}4GCu%Mq B9}GEuDtJ;U} m{[^_UWVS} QM;Q }lrg5MYBDu;Q |MADt&E;P }+MYBDtE;P |M;Q }s[^_U WVS]Hƅ~MrHu=Ix2UBDuDuIxFDtA~s[^_ÐUWVS}PH I9}br]uMEB;U}FF ]Du]C H9}$^ B9}FDtJC9}s[^_grabhist: bad history arrayU WVS} |B9E 8u E P0uh' jZ}tuэAC S9|JS p Vp{@E 1e[^_ÐU WVS} ]u}tkH9|}t[}tGO;^u C1PSEPW"ƃ}1t%}tSh4y| 1nf}tVs߰эAB J9|IJ p Spz@e[^_ÐUS]5$j (vtj sj i j , ]ÐUS]} 00=tS(4)4m+((]USH9|?1҉9})R@PCƒ;X|;}1]ÐUWVS1EE1E1U;P}t+U9~EE}]uV@PC]ƃ;X|!W@UPE0ǃ)9ǡUe[^_ÐUSE] tPC]ÐUWVSE1E]‹=9};J ;Hu}t u EBy< u CF;5}RuH}=tMCF;5}-CF$y;5}<v<u^CF;5}4@CF;Ju}u  HE=9} ;J H;Ju u U9} CF;5|E 5 ]E E=OtCU8t-95tEPVPCEFsƒ:~ }t+<: }t>:,t4UR @P>P, E9t URP e[^_ÐUVSu] 9V)9}Uj Gj  9PC9|b 9~Uj 95+ 9}PC9|5e[^UWVSE}u>=Lu5ptKP5pL1HptPpjEPEPEPpp pjV ƃ u5pLuuEB1ۃ C9}Pjjhu19}4h U<эAP4 %tEpEZ)Ã}u ~XjEe[^_ÐU,WVSMu tudLu!tjPjL1Pu4u/tEP5tL1tPtEPEPEPEPpp ptPE uN;u|:uuEPuUR jg}tXjE4. ËE1G;}}69tSjE4‹ERpuʋE߰эyE0EPURL}ЉU5tuuEBh WS"ƃu1}t+L~|;/tjjhƃuEPje[^_ÐU$SUEPEPEPEPrr rjà t)uuSuS2jL1 ]ÐUU}=t~u@M-US]=t}h ~uj^v@Sg]ÐU5}uP Uj#US=t+h5,CC]Uuu uUicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromA{Gz?.AUWVSuP`DžƅƅƅDž|h &uh j>vpjj'8}h j0Pf"PDž= PDTHX\`dhlpLtxV3D$      4   8       4 H                        L            jj5h/!f*@O5h/!hP jt !ƅ& @tj)Phv js jhL:#PR5h/!#:u95h/!"Ãu5h/!hy jhsC !xj5h/! "$t ( u؃5h/!h jsEu! tj(Ph jr0 $Eu$؀  dƅtja(Phv jxrjj5h/!(~5h/!h j@r ] 5h/!WJ&? 1  % jj5h/!(5h/!h jq=5h/!h jq !jj5h/!w|=5h/!h jZq !jj5h/!o'u[5h/!h* jq !E1ۃ9'/ TxL LhLj -EԋUEԋMEԋuEԋMuh %ffPPh  EKEԋu>EԋEE9v;uGE9Eu-uFEEEEEE/ uEE1 / / &2$,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 ,2 1 ,2 ,2 ,2 ,2 ,2 ,2 ,2 1 ,2 1 ,2 2 2 MCE8EM(}tEMEkh/ E PEPDtj[Ph/ jrF}tEP*Th/ j} Åu[P t}t@j"jh/ 3}tSh/ Sh/ j-'j"jh/ 2Sh/ j- h/ h/ h/ #}u/Rjjk4uh/ j<jj\3jj P3jh0  Dh0 Ruh0 Quh0 jh0 襎Ãuh#0 jSjS jS~ S3]SjPMSjjTjh/ h0 h(0 h+0 j8jjPcjj3u=P/!th30 }j&}uPjPCj j2u =P/!t%~˃hT0 :EPOQjj\2u{0 Rj]Cusage: %s [-dlnpq] U58h5 h覲jx5Uuu udfiPRrWU WVSu] ,h5 jiE@6 "$7 ,7 7 ,7 ,7 ,7 ,7 7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 6 ,7 6 ,7 ,7 6 ,7 ,7 ,7 ,7 ,7 ,7 ,7 ,7 7 Y C +E h5 SV?)ƍ S ;t0j}t S3 S53%s: %s%sfts_readU WVS1=u= u =u=t jPu'ƃjjC4H $H8 8 $9 $9 8 $9 9 p8 $9 $9 8 sEPsh7 jY@C=t 5PPsh7  =sFPVЅ}W7 tu1ytYue[^_Ð"." and ".." may not be removedUVS1];j3VH;v8/tj/37ƒ@u8.uJPt .u>xu8Fuh@ Curie[^Ðusage: rm [-dfiPRrW] file ... UhA hhj:)Uuu uroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. UEtPh B h脥h@B hohB h]j/(route: %s: %s UVS]5P/!h C htShC hVWPhC hj'nqdtv/dev/nullsocketU WVSu] E jC $`D lD lD lD lD lD lD lD lD lD 0D lD lD D+8- @Pv1$G lH |H H H H H H H H H H H H H H H H H H H H H H H H H H H H PP}PqPePYPMP A5P/!Ph G h~WhDG =3EEEEEEjj}WjjuVu" }hdF EtZPE܃uhzF jjWEPjV " }hF pE܉E؋EE؃=t-hF =Pt@PhG }BE]܋E9!=tPS&C sLPt F9~=tCECPS59-E==t WSj&hCt P PPhZG >t H D0FPPhZG hdG ;]EP_e[^_ÐUVSEH$Q%0B$0AB.BK~ B=rB$[^defaultinvalidiso %s(%d) %sU,WVSu1=tZhh}u.j.hsǃtGPhչ1>uK K HF$pL L |N |N |N 4N XN |N |N |N |N |N |N |N |N |N |N LN |N |N |N |N @N lM FEt>wK uT=uKjjEPdÃt2j.3rǃthGPu;huu{Ph}4E =tE!}1]PVSEEـ>u=Uu E$u=Uu E$Rh$S ~(u<=PuhPh1S  uh7S tKt t #7t9S FS SS VGPhjS R%e[^_UVSE] u1Ҁ u1it )Tw E=w 3=wtftuffCffSCJ:u9wC(ˆ[^64128U WVU1Ƀzu!z uzuzuzu R KB$< u@EEEEr}1t p[ um[ t Q{e^_Internal Error%s: bad value route: %s: bad value U\WVS=PuPPE H$\ ] ] `] ] `] `] `] ,] `] `] `] `] `] `] `] 8] `] `] `] `] `] `] `] `] `] `] `] `] `] `] `] H] E_ESEGED;E$*EPUBh \ OMYu K uJ}t8}ty}t"kjE PjvOUCC$] ` ` ` ` (_ 0` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` _ L^ }1]EEEPEPhR E PDuEăxuxt"U Rh\ h贉j }pEPЀf=t fuUztBffB B}uMQdu1S}u>BBB BB EԃU RPEԋMAE؉AE܉A 1fyu y}u7BB BB EȃU RPgEȋMAỦQEЉA 1u fy UKE P4Ƌ}󥤃}t}u;UBDBUʐH;Ev8t(ЋMEPU R踔MQE P#}u vU,RM QA믐}uEEUj/M QyƃtU}uOEU RÃt,jjFPPMQffS>EU RÃt9}u =u*MYSםffE Ph*\ hje[^_U WVS]S7E @=vSh\ h装ju]uGGG ~ShW~ Ee[^_Uu& =s @=r1*.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sULWVSUJMBEB EEf%fEfEMf}u=f}u6f}u/u+fu jc EPhnc hA}1t Uu uc O׹u yc 3BPBPBPBPBPEPh{c ]S̤ރ f}t,EffEEPhc ]S螤 EEPVEffPhc h2h>e[^_*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sUWVSUJMBEB EEf%fEfEf}u>f}u7f}u0u,fu jc +EPhe hL豣 }1t Uu uc ׹uyc ffdBPBPBPBPBPEPhe h/ ff=0u=s@80u=rf}t*EffEEPh*e hϢ hWVh/e h2hL#=Le[^_Ðactual retrieval of interface tableU,WVSEEEEEEjjuVjj]Sm }hdF EtyPǃuhzF jjVWjS }hf lu9sPSS 9rWe[^_got message of size %d on %sU WVS=ttjhV5HÃjoWjPShg VSVuwriting to routing socketroute: read from routing socket: %s UWVSEDP/!1U}au EJ}cu E8}gu*E=%u!%$  EEE PУ X t tQ=tH XSVEP8]=thh VtS=tH XSVUR]=thh VctS=tH XSVMQ]=thh VtS=DtDH XDSVEP$]=thh VtS=$t$H X$SVUR]=thh VO tS=tH XSVMQl]=thh V ]f=tSEP =tSUR5+}hh _x}uphLh5,Ã~9 uҡx9uŅ}!5P/!Phh h{Sh1e[^_US ȐvJ:t(ˆ$4m n m n m m m n m m m n m m m m m m m m m m m m n n H}19~9v H9wvJH w=u [ÐRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:US]={tCPhp 良PC4hp hC |t ~7ujC Php @hshLsCT.shp hdshLwsCP3ssshq ծhdshL<S] route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire %s %8d%c %8d%c sockaddrs: UWVSu] EE1EhEPh*r N ~tFPhp 79~SPh@r htFt"PPPhtr hytVL^ tatSt t1tt#UUzu ztU:t H Tu}t't UBGEPRPhr [ t-W'Phr 0 }t FtURPhr  }tEPUBPhr ߫hr ϫhdvhL6hr h0s 訫 F$tLPv4h5s 臫 F$tLPv8h5s f F$ tLPv Vj>ue[^_ÐUVSutVPuuCe[^%s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; USU] B$ z z { { { z z { { { { { { { { { { hz { { { { z z RS|PShy BP}PShy or)RPShy XhPBPjOPShy 5r rr[rPShy r rr ~PShy ӥ hL{ÐUWVSuU ‰U11EPjE PsM AB< w ƒЉE7B<w E%B<w ɉEuFwG${ { { { { | | | A})}1ۉA1 A ;MK*E U e[^_$OpenBSD: show.c,v 1.18 2000/09/24 01:02:24 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables U,WVS1EEEEEEjjEEPjj]S }h| `jEtbPǃuh| ZjjjEPWjS }h| j~uh| t%9sS9rWe[^_FlagsGatewayDestination%-*.*s %-*.*s %-6.6s Uh~ h ~ jjh~ jjh ~ }%-6.6s UVSu^LC9tP~ u j$jS/jvS~Lt FLH D0MFPjjPha~ F%P& TxL LhLj 衉e[^InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: UUB$  $ $ $  $ $  $ $ $ $ $  $ $ $ $ $ $   * 33 += #A E I N 1tPhX 褠Rh^ 蒠link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s UWVSU uMAxtExu'fxu BPhL VgMyuWA|Dž|T 1ۀyP|PhU VDž|Z CGUB9|aMQTuExu \ ?tUR+ MQ Exux u xuxt)tURMQ\ j:VxэA;EIMURTƃo]MǍFz|APhd )PChi VɆƃ9s$PCho V譆ƃ9s;|rx}}Vht 0=tVURhx VMQQh~ ̝X[^_ÐU,WVS}^| U܉f=^| t&E9sÐtABf9t9rVu ke[^_xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeaddUWVSE} E fE @ *u,F] } <,t\]<.t<:u/}EEPgU fBF]BB< w|9sxFC<,uF] } *M fA]}9s8SCVƋE f@t<,uۋU fzufB>uW1XF] }M fyt!}>,t9s׃SCV0ƃ>uE fxuE )ËU fZe[^_USU] :\u B5P/!8PSh j Ct,<~w$DtC<~w Du;uhʈ h JCt,<~w$DtC<~w Du;u F h S F oCt,<~w$DtC<~w Duh S[ F ߰uh jVCt<\uh jj }FPSà uhX jYKvSEÃvSOà t-<~w%DtC<~w Du;;HKCFPS Ãt,<~w$DtC<~w Du<;u Cu*hx je[^_Ð\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])US] EU@E}\uh E@} h8 jx[u!SEPtÃuYhf ː\u3P[t :Uu@E+nu  CE'\u \EC U8iEECE8u1]ÐUWVS}] BC:^u^BC:]u^]W:[uCr.t :t=u0CBCB <]u9t( t=BC<]u9u:\u znu BBCt<]u:]uBC11[^_RE error: %sU WVSSuJƃt߰u U ZjU t.jSPN"t U 2PiPh jU @9<s<[^_123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionUWVS}EGu21`GC+]]URMQU B5M A@AEEPEE]]]?<\ubGPh“ tt9\CrЋM At;pvRh̓ j,E 9p}4p/<&t<\u%\C:E< uh jCG?j+]]E+E=U҉UREhWA h8 je[^_Ðmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'UVSu FFF 1ېMt3<~w+DtAE<~w DuU)=W hPe>FPP [^_Ðunterminated regular expressionexpected context addressUVS]u <9<0}L<$t<#u~nu L5w=@u8#uxnu L񐐐OHÄt t&<;X4  A@A듐e[^_stdinUVSu= 5@u,D D,h P%u$5P/!P5,h j| BHJȅ}RO @5P=p=Dt5F1cD1OD8EP5ná@ @t-P/!uPP5,h j u uSV@5r@^u,D E,h P譍u$5P/!kP5,h j BHJȅ}R D5Pne[^ÐUVS]u j ‰Zre[^ÐUS]j\B]$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%sUSu覶Ãu5P/!/Phd j؋]ÐUSEU u R0RP*Ãu5P/!ۅPhd jz؋]U WVS}u t P胶jh VWÃS/ SPVWe[^_sed: %lu: %s: UVS]uhW h>#|5,5@h] h>Vu h@hg h> t jPe[^$OpenBSD: process.c,v 1.5 1999/06/06 15:42:24 deraadt Exp $%s %s: %s %lu U,WVS@>HURTu M MuFC$ V V V @ V V V V V V V V  t V V V V V V V V V V V V V V V V V V V V V V ȫ 8 H V V T V V V V x  X د V V  İ  V V V E@49|%4P58858[MA Dy ILURUMyt =uv h0 =HPj 5nÃtËB))ȣPCPRrj55h` B=ujjh3 P; j55h j55h j55h Ep h0 5=Lu$=uhL5j5NjhOu j.7jh=Lu$=uhL5j5_jƼ=hL5j5+=HPj 5kÃtUH) hL5j5Iu5;=Lu$=uhL5j5j49|%4P58%858[MA Dy MUEHDCUR  d= Y MIMI=1u~uAhh v qFu!5P/!d~Pv h5 j 55Ep߶;5P/!~PUr h5 j =ujjh3 S }ߍuD=u9 It*uVCIu5@h= oEE}=Lu$=uhL5j56jhe[^_\%d not defined in the REU,WVS5UBHMu-$t#H;Jv@@Qh jK5jjVEP u 1=UBEt,MMWjjVEP }uPB9uB 9Bt.Pj0VhUBpVh PQ9uY;Y t)E; u j@PV jjPh5P@)E3jWVhKt-P@)ǃWjjVMQ KuԋP )jPQhUBpVhP@)ǃ jWVhtMM}uUBxthL5j5gMAx=x uOhh p‹MAP u'5P/!zPUBph5 j 55MAp u;t$5P/!yPUBph5 jJe[^_rstdout: %sU WVS1; 8[t t${yhLtjt<{Zh/ tCƃ{t=hLPjSVh jSauڃVy;\L@ @t$P/!uPxPh1 jA [^_COLUMNS\ \ \abfnrtv%03oUWVSu=uahJ 趪tP.:]Shht@j%uCft C <1>@;=|hR i1|\DtM\tH TT} ;d| tLLhLRbQGU TT};d|L\LhLj\QPSͥtN)^ TT} ;d| tLLhLRPPhg hF> TT};d|L$LhLj$aP TxL LhLj 5PL@ @t$P/!uP vPh1 je[^_first RE may not be emptyRE error: %sU WVS}GEU&u1\u#EDtUE}W\uU<\t<&uEWB9Gr#GPw (G GEEEGP 2u|2thD2u|2 tX)ˋW)H9Gr$GPw G GESPE 2PUR{]_EEWB9Gr GPw VG GEUe[^_ÐUVS]uSB;CvCPs C }uCVu CPѳSSe[^%s: %sUVS]u 9C 8 3 . ( $         werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard   rprntflushbrkUUE 02@Ðoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sU,WVSuEEh j jh ]SxE u*h j jh\ SWE u 1$PXuEPh V&uu޿ t uEMA_Uu>uUR} t$h7 E PI>Et 8e[^_ttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakallUUE 02踤illegal option -- -%soption requires an argument -- %sUWVS} U;-u GC G]h$ j jhdEPTƃ u1cFutSh> P Ft*MP@GuShd bP WFиe[^_UEjpPDRP)ÐUUzt R"J"JB$ B$B ÐUS]sfCFC]ÐUE@+@-@0P$߃CP$`@ ÐUEjpPDRPuÐUS]{tEEPh`t3蚝EEPh`t3~C ]ÐUS]sGPCP C ]ÐUExt``߀`'HH H'@ ÐUExt HH ``@ ÐUS]s軵PCPmC ]ÐUS]{t SO CPXC C C ]US]sOfCDC]ÐUEP KP @"+P$g@P$@@ %d %d UEPFR@DPh T%d UEP軞Ph TTIOCSETDUUEEPht2葛}h" jO5TIOCSTARTUEhnt 0T}hj j5TIOCSTOPUEhot 0}h j4           # 3 # 3 2 3 3 # @ @ @ @ x p g ` X -mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5      y q k d ] U O @H @B ; 5 . ( !              -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk    v l f _ Y R K C ; 2 (       @ @ @ @   @ @z r k c _ C$Z CS C$K C@ 4 + !   -xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho         @ @      -onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopostU WVSEu 8 = t33W評uC#F F CF ;uл = t23WiuC#FF CF~ ;uл = t23W)uC#F$F$ CF$> ;uл = t>3Wu"C#FF CFF  ;u1e[^_tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s UWVS}u EDž0tdt$ t?tt&0hH /hV #hb hm Phz E0WÃW詏 9tPSh Sh E0}vFPPh mE00th NE_ h }wu P }w| P}wu  P}wu P}wt P}wt P]}wt؃ P<}wt P}w@t P}w t P}wt " P}w}- P}w@t5 Pe}wt= P>}w tE P}wtM P}wt Y P}wtb Phi O}w tp Po}wux PK}w@t P'}w} P}wt  P}wu  P}wt  P}wu  Pt}w u  PP}wt؃ P/}wu P }wt P}wt P}wt P_h I}wu؃ Pl}wu PI}wt P%}w@t P}w} P}w t P}wu P}wt Pr_h }wu ! P;%=t&tF=t!=t&4h( "h, h0 h4  8 P}w t @ P}w@uH P~}wf}O PZ}wt W P6}wt_ P}wth P4}unhp  = t?]G4PW1P7hw jdS$S ?uŃj+j Dž0= }tWG48 7h 0d)SE,PG4PWuPh S8Vؿ000 u/Dž0,Qh <Sh < ?C0t%EPh m<8Ph Y<[^_ÐU=dth 0<dEh%s: %s %s %sUWS]duS5hh ;dP߰эD Hv%h ;Sh ;dSh ;de[_%dUEU @wRh[ jh\OSu^ H\}\M]-^u ^@?^@@@\-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZUlWVSB|1EẺEUUEEUUE Elet' atftgtF>6j5h/!E}5h/!h j;U}Th E 4áU <эA9uh RUR8E EPuBf}h jTURht@u<}h jEPhht@u}h 1t(r w7 E 8u*VuUREP{uUREPEEE 8]UREP0UREP UREP} Dt+QǃWSƁWŚERjh" 73u E PURcEE 0h( j0E PU x }t)EPju}h= jJ}t+URhgtuZ~}hG 0j蕁usage: stty [-a|-e|-g] [-f file] [operands] Uh hhj:Uuu uQaFfh:t:vonly one -t option may be specified.nfsU WVS] 'x1 G04$l d x jt]Qh/!|@=Xth@ j45h/!"xO h SEPq9Eut t =|t=Xuhe t 8&1;t3Jt;uV~/U WVSjEPfÃu jj1Kxp[4jZho ETPLt5EDPtETPtXKye[^_%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCUWVSSEPu}߉`EPWuLE%f=`u*PjWd`uWf=@tWh@ SjW&ƃuySjW`u\U`SjQƃu@Sj`P`uURh *tStރjhe S6}j@Wndt'@dPdxd@Jj:WIndt(W,xdGd: DžxxQ' =xt`PWhf *1=t5`Rq}`Qh{ )jhe S|;x.!dEEEEEfExr B0]EP~DžpDžtDž||PptRPjhS\Ã0uh~ 2DžhDžlChlQRjhFWhl jSЃ th S.P PBЃCS@1H[^_getmntinfoUWVSujEPaEuh[ (1;}1ې} uJEPEP'{u,tEPD@DBFBFB F ]CTc} uJEPETPzu.tEPD@DBFBFB F ]èG;}P1e[^_ÐUVSuXu@=l.Ã;tj3Vsyt؃;u=l%e[^empty type listU WVS]tuh j߅uUPhD S n>эAPQ‰ujjB-MB6BPs#}uE-EEUMEEE8>}tUM uE +KUe[^_/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help U@ WSEEE@EJ Ed& EK E& E& Ph } h Et7}tEEEP7@ EPPPP9$                                     X  l       t     4      L X װэAPh RXS褆ǃ9=t S{h( WSG- װэAPh  RWwS,ǃW6<uSh  hhSPsyװэAPh" R WS>t@uSh) hh) pS3,װэAPhE RVc"$j6=سt%װэAPhM R"VhR h h h h h$ hd h h h$ hD hf h h h h h hD hPװэAPhg RU[PPװэAPhj R6Uuhn hTRPhq h31װэAPhu "װэAPhz RTwװэAPh~ RfT?=ܳt"h hܳxh hbܳZװэAPh RSji4װэAPh RSn\װэAPh RnSuK=سt"h hسh hnسfPh hGE[_%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! U WVS] u~=@58h* hh/58hhOg8@ tu y C= tэAJ< t< tBSh‰^4:uhUREPS@h5@{ƒ:u @@=/u URP(PEPh0 hSURSFPjh@EP6$Ã}fURv4h6 h/t' t*u#h? !hN hb hs hFtKFhFV)‹F4EPFPVuFP.[^_Ðcommand lines cannot be continued missing %c UVS]C< t< tu   t\uCuh hJ 't "tCF9C CF8tuCuPh hK< t< tu؍e[^../..U WVS]޿ tjh S Ou U +;/u U f U f BhSE PPu >t(FS/u /F/tӀ>uK;/uu >tsFF(ÃP)u&hu hR=hx' j QP<RQtCs8;shu h)PZ=[^_ÐWarning: undefined file type %d UVSu ]FP7Cƒ:t=ܳu <^v?B:uf+SfS=سt! I84rC ^%u 1t@tC *C FwC$4# # # # p# # p# # p# # p# # p# # p# # Phd" h;C @6C =.C #&C %62-u C /C e[^%*d %sU,WVS} EEEMEˋ ܳ9s89sC9E}E{ tE{ tE ;]rʃ}tE}tEt8Eօ~gfffE)ƅUMTUEQ}EuEUD:}E191NM;}sE@U=ܳt%3MQh# hTC@EfC}tGS } ;| thRbfCsh# h}tFS } ;| thRfCUR;Erhu hs^[G;]M)ىː };| hj Kuu;upe[^_UVSu4=ܳu;t#=سu, I84rV#Ãut1  C C@SPRh YC1e[^ÐUVSu ut3=سuK84s=ܳu u!S)u fF@fF1e[^ÐUUE prbErestore interrupted, continueUSP/!=iu= tjh h' 7su j:CP/!]leafdir %s%10d %s UVSu =؍N84sB=ܳt&( }u( Ph( hLڿuVh( hLĿ؍e[^%s: not on the tape ./%uU|WVSu}=ЉUM I84r&=سVh( hLF} u=iu =ܳ=u/E Ph( jd]SzރuU RV%VE P)ÃtS+PV[C t$WU RV?,Ãu ShKEx[^_ÐUS=؋M I84s/u*ƒtB$ fBzt R-؋]Mark entries to be removed. Delete whiteouts %s: REMOVE U WVS=ܳth=* hLĽj'Ãtg=ܳthZ* hL蓽sCPJ8s84sSkS, u;58VS'Ã~N8rm=سtS)Phl* hL޼ {uSphSC,#Sds' C   [u;58Re[^_corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state UWVSEEM I84ЉUEP&ǃt3Mw$ƃuh+ 5n9tEU R$ƃtM^[t9uEu[9tW}uWeW) 4=سtW&Ph, hL W:b1eEt"t F;EuUt G;EtM}E$. (2 4/ / |/ 1 / . H0 `2 `2 82 0 82 / 82 0 N=سVjPUREP}uWdW( W_aURE PUR&Ã}u SbK=سSF}uFu> fFFu2EPV%P%bURV0)N ~u"EVJ%PEPhP, dMURE PUR%ÀK=سcSiPEPUR|Phv, }uzWcW'E PE PURz%Ã}u SaK=سSIiPEPURPhv, }uOO=سWFth, V~gz~uZt5~th, VXgVbV& vu̓EPU REP$ƃV`? u V_v!" F 5 URE PURK$ƃ N=سV,hPEPURPh4, hLx=سt#EPURPh, hLDE\E PURh, EPURlPh- h$EPURAPh/- siEe[^_|NIL|ONTAPE|INOFND|NAMEFND|MODECHGUVSu 2 2 C th2 S th2 Sth2 Sth2 S e[^Find unreferenced names. %s: remove unreferenced name unreferenced with flagsU WVS=ܳthK3 hL蠴;8Sƃ{to~tiK84sO^tHf{u:=سtS Phe3 hL' S_S# [u;8n5 tn^t`{uRf{th3 Sc=سtS Phe3 hL訳 S@_S# [uv ue[^_ÐRemove old nodes (directories). cannot remove, non-emptyU WVS=ܳth4 hL1  t0{ts C S]SU"G uӅu th5 Sb[ ue[^_ÐContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeU WVS=Ru=ܳtHh5 hL賱1=ܳth5 hL蕱5EP$jc`VÃuVh6 dSPh6 h0c V`ƃ;5T4rT49tPVh06 hPChV ÃuhO6 adCuhe6 S`CtSH\cS\P>c 9tPEP#B=89T4)e[^_Extract requested files UWVS=ܳth8 hL \4jT4/Bnj^E8HP_EEP^EEP^E 9EJ9T4v+\4j3AE9T4w׃5T4Q^ƃ=;5T4vA;5T4v9=tnAG9t9L;5T4sUV/Ãuh+ bSPh6 hծcV]ƃ;5T4r;5T4;uVÃuh+ bSCP<c 9=@e[^_Add whiteouts Add links U WVSjFǃtD=ܳth: hLGtWP[g u݃=ܳth: hL趭;8SǃCtY_tRCtEW9PV ujjSPV Zc[u;8r[^_Check the symbol table. incomplete operationsUVS=ܳthK; hL;58sQVÃFt吐C€fS{u$fCf{thd; S\[u멐e[^Warning: missing name %s missing inumber %d type should be LEAFU WVSu} EVÃuVh< h٫1ZW9tE@t9uuWh!< /_{u}th5< S[Ee[^_Extract directories from tape %s/rstdir%d-XXXXXXXXXXwcannot create directory temporary %s%s/rstmode%dcannot create modefile %sopendirfileRoot directory is not on tape UWS=ܳth< hLJ5H45@4h= hhe %d) UWVS=Գt?}} ]9bf;tVSLVO 9r41;u )]=8tShD EI=4t;t=8uCCC%)CuS9C$9=ܳthD hLCt=ܳthD hLܡSC$9s=ܳt2PRhE hL諡=ܳthoE hL荡փ;S[^_ÐUVSufF$fFFļ8=~7ȼf+ȼfD5hjSdHļFļPVS"ļȼF‰ļe[^ÐUȼ8f+ȼfT5j5ļQG5HļU WVSUu 1BFjR^SډװɈNf$fFe[^_Ðbad seek pointer to rst_seekdir %ld U WVS}] uW9tV)yShpH h菟j%RP7%GthG P7Ge[^_error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d U WVS]{u>hC P3C!=سhI h^nK;K| C뫐T fztr)9~"=سt7BPhPI hK:urC u18;8r*=س1PhI h辝Ѝe[^_ÐUVSuOt6P-Ãt$hkƃssV1e[^ÐUS]3So]ÐUS]jjj3+CC]ÐUSjuDwÃt+h t@S1]ÐSet directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopencannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes U:EPSD:uSL:EPS6fWj$jEPG  +@thL nMW+e[^_ÐCannot find directory inode %d named %s %s: cannot create filewrite error extracting inode %d, name %sreadwrite error extracting inode %d, name %s writeUWVSu} WÃuVWhN aLhhV s}VhN 1ss50e8s ~SWPzu*5P45T4hN AhO jZ=uCSWPu*5P45T4h0O hǗhZO j NPkP\[^_Uutno memory directory table U,WVS}u jjÃuhQ JMb)ʍ)   {EC td}܋FE~Mb)‰UFE~Mb)‰UfEFdEFpEFtEQj$jEP=؍e[^_ÐUSMMb)ڍ)Ћ t9Htu1[UM3=#thSQ=#t h:QUS]t;8r1'15ѡt 9Xt @ u1[addino: out of range %d duplicate inumUVSu] t;58rVhR H15sC =سt!9suhR S%E[ ue[^deleteino: out of range %d deleteino: %d not found US]t;8rShlS ,H15t9Xu@@ P @ uShS G]ÐU WVSujWÃtUFBbad name no space for string table U WVS]uhZ A߰֍N9t 9(F$PǃuhZ LASWKe[^_ÐUWS]߰эA$[_Check pointing the restore wfopencannot create save file %s for symbol table fwriteoutput error to file %s writing symbol table UlWVS=ܳthZ hL蟌=8h [ EPEu!h [ 諽URh([ ? Ma E܉EUU;58wKVOÃFut'{ GMQC$Pj3e3[uۋu;58vE;58VÃFu} UEC$EC@ MACt@ ACt @ UBCt @ MAC t @ UB MQjj$EP2[wu;58L1;5s=u E @ EURjjEPI2F;5rŋE E8EԡEȋMMġ04E̡H4EС=E؋EPjjUR1MA @t!hU[ 軻EPhh[ = UR[e[^_Initialize symbol table. no memory for entry table .opencannot open symbol table file %s statcannot stat symbol table file %s cannot allocate space for symbol table readcannot read symbol table file %s lowhighIncremental tape too %sinitsymtable called from command %c UWVS}=ܳth^ hL肈u[8%_ jR!uh+^ ;jjhF^ €JjjWgbÃ}hH^ AWhh^ ; EPS/}h^ Wh^ Q; uVjqEuh^ &;VEPS|jEPS}h_ 蛸Wh(_ : U=Tt$=\4u5P4hr h&s dP46s \4X48T4=TtTjh'ÐCannot have multiple dumps on pipe inputioctl MTFSFUtt=uk=Lths jfEPEP=XtRj-+Phm5H\} ht Dump date: %sthe epoch Dumped from: %sLevel %d dump of %s on %s:%s Label: %s Uh4Pht hLMs=4th4踅t Pht hLs=7t>h7h7hH75D7ht hrh47ht hr%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special fileextract fifo %s %s: cannot create fifo%s: cannot create fileUWVS]P4\4 X4AEyMb)‰UAEy)‰U1yd%=`&= s =/=@ti&==P =tPShu hp=ܳGShu hLp,=t3SNt @ Shu $=ܳtShu hLPp5T4S>jypqt'+hd h~ =+u=ܳt%s%s; too long %dUU+E +=~PRh'5P4h~ jRh'Ðunallocated block in symbolic link %sU5P4h< jeUS] Su5'']hole in map US] h )']ÐUmid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failedEnd-of-tape encountered partial block read: %d should be %d U WVS#;#} }5#=~#Nu=#u =#== 1ۃ=XtW#PW#P5HƃLuB=9#},~(=سth hL~f=#Ltu!~]= 9tPt)P<t=ܳtRVh hLf} #h# he\4<t4<t<t h: ,hQ 5P4hj 5T4hx he=u h ;u j>5= Vj5#=XtjVo.jRP5Hщ1u %th j:~=ܳth hLd=Lu1@#PEP*it= PSh܀ E=#߾##}5##'Pe[^_tape read errorTape block size (%ld) is not a multiple of dump block size (%d)Tape block size is %ld U=~#Hu#=Xt= P5#= P5#5H_hM jY|thPh| jo =#=ܳtPh hLbÐUH|=Xt/ PcNote: Doing Byte swapping 8l4s31l528b1l192b2lNote: Doing Quad swapping gethead: unknown inode type %d U WVS=ԳEPUB=ltHPZ =l=8u(=ܳthυ hLa8MQ7=8=]Sh F$Su1҉󫋅UBB B BBBB fB "fB"$&(B(B,,BHTB0XB8\B@`d@kuSDu 1qE@lUJ(Z,ȉڃu uH=vA}G %f=@u/=+u/ȉڅuth p+=+tMA(Q,щ‰ȋ]C(S,}B$  E ̈ E & ̈ E@ MA(A,19}REA};|8Exu 4UBRh =4tMA$A&=سt ]S [^_oldnewVolume header (%s inode format) begins with record %dDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksUVSu>ul =4t Ph h]|tPh h]hj hq]``wb$( T < ` l H hӉ .h "Rh Rh h= h\'H9tPRh\ h\hj h\1Ƀ>t19}<tA@9| 'F`e[^unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks U WVSP46s \4X4T4Exlt&dURjtH4U9BuڋUH$ x  1ۋE;}5ǁǤ<;t VCU;|dEPtH4U9BubE X4UBT4J8T4>P4 2P4 &h' 354h? E8d~Ph\ h^Zd[^_ÐChecksum error %o, inode %d file %s U WVS]1=8u ;Nu3[ǃNuIu!5P45T4Wh hY1e[^_ÐUE Puh[USM] KxAQKy[ÐUSU] Kx BJJBBJKy[ÐUS]M }ht49a0|\st lt0JwtADBCDuPQEuPQU uC1;y]lUEPhЏ IEU WVS}j/W}tXƀ>tQ>/uCWÃu'jWx0WÃS K/F>ue[^_Ðmktempname: called with TMPNAMEU WVSuF thp VN VePS0u6VYPOlj>ɈN(VPS[^_not on ino listRSTTMP%s%ld%dUVS]1s4F@t9uuh SsVh, h3 hh,C,e[^cannot rename %s to %srename %s to %s UVSu] =u%SV}SVh 虇=ܳtSVh hL6Ve[^newnode: not a node%sMake node %s UVSu~th1 V VÃ=u+hS)0}N@ShE =ܳtShH hLUe[^removenode: not a noderemovenode: non-empty directoryRemove node %s US]{thߒ S"{th S C $fCSÃ=u!S}ShE =ܳtSh0 hLT]removeleaf: not a leafRemove leaf %s US]{thݓ S^C $fCSÃ=u So}ShE >=ܳtSh hLS]Ðcannot create symbolic link %s->%scannot create hard link %s->%slinkit: unknown type %d symbolichardCreate %s link %s->%s U WVS]u }u)=uhVS>}WSVh ,u/=u:VS})SVhД 1HWh B14=ܳt$SV u Ph hL{Re[^_cannot create whiteout %sCreate whiteout %s US]=u)jhS}Sh L1!=ܳtSh hLQ]delwhiteout: not a leafcannot delete whiteout %sDelete whiteout %s US]{th SC $fCS*Ã=u SG}Sh z=ܳtSh hLQ]ÐUS];8s'St xt@u C;8rۉ؋]US]v#Sߺt xt@uKwމ؋]bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %d flags: %s US]u hɗ hOS耼Phؗ hO,sbPh hO CtP?Ph hgO CtPPh hDO CtPPh h!O C tPֻPh- hN K {uF PhP hNsh` hNSGPhr @]|NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTEDUVSu0 0 C0Fth SF thǙ SϓFthЙ S踓Fthٙ S術Fthޙ S芓F@th Ss0e[^%s is not on the tape UVSuV1ۅttK84rVh hLM؍e[^%s? [yn] UVSuVh hMh@ 8BHJȅ}R 8@ uC t08BHJȅ}R uytnb1e[^abortdump coreUE PuhM=u>h u)h uGjUWS]߰Q4tSPli 4h j /=4| 1e[_ÐLost connection to remote host.Uhܜ jtcpshellshell/tcp: unknown servicewho are you?malloc/etc/rmtUWVS=uZh h 1uh jQtdP&3uh6 j'0hǃuhC jcj@54茿Ãt/54V%u jC4jhJ VWph494WB=4= E=~EE]u E}~"jShh54 |΃jShh54ˋEjVjj54诋jhjj54薋e[^_invalid user name: %sUVS]ހ;t< |ѡDu_t-tVh" z1 C;uƸe[^O%s %d UVSuu Vh hSSV[^C closeU=uh h {R%d readU,WVSu h j]SSh" :ƃ } 5P/!719}/)PEP54Ãe9|Ӊe[^_W%d writeU,WVS] Sh juVэAPV54vSEP54ch "e[^_ÐU0WSuh j]S߰эAPS54e[_ÐUu u54Uh L%d %d seekUdSu uh jP]S Sh ]S statusUVS=t12hӡ h֡ 1<CF7v<e[^I%d %d ioctlUSE |/Puh. hSvSh6 ÐUWS] ߰эAPS54‰߰эA9t%uRe[_%s: %sProtocol to remote tape server botched (code "%s"). U0WSj]S/EP/!}Fu GÐ file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged18 Aug 931.2.4%s %s (%s) %s UShF hP 5,hV h9 =t 3hb h9;u]UShF hP 5,hV hf9 =t!3hb hA9;u]UTIMEDIRENTCompilation options: %s %s STDC_HEADERS HAVE_UNISTD_H ASMV UhF hP 5,hV h8 h, h2 h9 h8hU h8hc h|8hr hj8hx hX8.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' UWV蓱E 0m‰,װэA~t uDh E PEPmAtE pjjR%|Ath0 j,jjth0 jjjth0 jjh 5,tRjh 5,t6,p tƿ u48jh% hAMAI B;PσE $ ̵ ̵ ̵ ̵ ̵ ̵ ̵ ̵ ̵ ص ص ص ص ص , ص ص ص ص ص ص ص ص , ص ص ص ` ص ص ص ص ص ص ص ص ص ص ص ص ص ص ص س  ص ص , ص ص ص < p ص ص ȴ ص ` ص 05``48<7j48LgjsDkD[D@AD@%TP H=`эA Bv*5,h] h53Dj( j5`hA芨B48\jPTXjB5,h| h2j' Уhj'jhh< u uT =D} 8D=@} 8@du)ƃ=0t$=Tu5,h h1 Bu =8t~(5`5,h h1j' =Xt=8u L# t0d;U}*E 4d|d;U|=Lt=Tu~jj5l&le^_deread fromwritten to%s: compressed data not %s a terminal. Use -f to force %scompression. For help, type: %s -h stdinfstat(stdin) OK UVS=<=L=8uL@Pt`8 tA RN tD R5,h\ h05,h h/jF% |= f=  BfABA=Lu =Du6hAPɔth gAc4A=8t+5pd}5ld$=Lt5d5p4L(5pdFPCPЃ8t=u 49Au=Pt\=\thͷ hE.?u8hAPB )щ)Pghx h.e[^-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %sUlWVS]޿c u4B4hAS A%f=@ua=Ht,}AS_ EPS*=Th|=5,h| h9,f=t&=Tu|h|=5,h h ,`Afvo=4uf=<u]=Tu7 fvsPAHPh|=5,h h+=llA=Dt =LtA1=4t8=Lu/=\u&  BfABACShjh|=Spu65,h% h*h|=Ll_A=8t5pj d|=Lt)5d5p5p/=4tZ(BWs=8u@= t@=Pu.=Tu%hh|=5,h* h) = u=@ƒ =P|=װэA4װэAE ~C d Rh|=hH hV)%5p d|F5(B5pЃu=8t=u 49Au5p貨=4u5(B蘨tb=du=4h=P=\thO hl(P=8thPB AhAPB )щ)Pa=\u#=4uhhS h'hx h'=4u hA,e[^_Ð%s: %s: warning, name truncated UtSt5p1W|hh h(BuhiH5pۦc]SPKtd5,h% h&hH5p葦5(B胦hlShu1w=8t;=Tuh5,h hH&=lul븐5(BhuhD]ÐUUE P/!=4u=<u PRB PR_z-z-gz.tgz.taz.zzUf2=@u/>jj ==ShdEP\ EP5hE2 =@u=0=@u== tÃ2=@un=CuסB?w*=2f=2J=2=@u=f=2=@u<?w&=2f2J=2=@u<f=2=@u[<?w)A2fA2IA2=@u<fA2=@u;?w&A2f2JA2=@u;fA2=@u_;BS;1e[^ÐUVSuu V5p7ÃttSV9=A؍e[^bad pack levelU WVS]u Cvh =4=41@0=8 u u$/\hhAУ,=tu(=,=_(==wO=,=w =(=t$=1ɻ1Ґ1Av$=e[^_ÐU WVS,=)¡)ƒu =9 $144ϐGv ƀfA fA@=v141ɐv ƀf f@=v׉ڃ=(=u:R,=PAЅtu(= ,=e[^_ÐU WVS1=,=$= 1$=%U4fE4fU4t$)ف~wSYǡ,=9vǐGP)‰PSE)=,=;=0=wgO5F$=1$=U4fM4fU4Ou5X11‰$=,PjE ,=}t:j$)P1|P$=,=<=(=t.j$)P1|Pe[^_ÐUWVSE=4=D$= 1$=%U4fE4fU4=5tP0=9sC)ف~w9SWǡ,=9vǃu)‰=v9PF)‰PE,=B)‰,=45F$=1$=WfM4fW uEV}jЋ$)P1|P $z}tVHPj t>j$)P1|PZ $ E ,=s=,=w =(=t=,=}tHPjc j$)P1|P e[^_UWVSEU (4l0lf=K111Ґ$[,~$X㐉 FKuG~ʸ$XT0E1M[OM~$Y㐉MEKu}~}[u[E~&E$Z@EKu}~LfIy1۸.GfCfL~%.GLf Cf@~fL$.GLfCf@~fL$.GLfCf@~fLhh,Go1ۃ1fdžKjSlfKC~e[^_UAfIyFfIylLfIyf?  сPKth|=5,h eDdtth|=5,h =VЃAuЃ1+h|=5,h< hle[^out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged U,WVSEU EEp(Bjj =ti=u`JEK ELM  URES ETU  Udu1xuh NLh 7=RES ETU  UN5O P Q  ǃ=AtG9Eu9}   SEPh hh  OA;4s<Aj¡=uEMuh c=u{1ۍu𐐡A;4s<Aj~3C~EEE EUE  UEEE EUE=1ۍu𐐡A;4s<Aj3C~EEE EUE  UEEE EUE  Ujhp9Eth< *E;th| =AC;4<= >?  сPK=4t:=Tuh|=5,h h;=luNlBh|=5,h h l1e[^_UWVS]1҉߉EU ڐu] 9]uu} 1E U}uECw<t􉝤9sDžuEt <t싍9vU Džӥ;s'E4)x,C;rދD*)y D*1DžEtxxtuMDžtt<u 9rDžDžtDžxDž|DžDž9\L(Il9?||dd)9v+DžXӥX@9XvbX)XlL/C9sAXX9Xv&)XC;sX҉X9wDžӥ􋵌PvUu!t|p@p}UA|dPtg.\0 |\C\`+닍D\`4؉|9*%\0 ‰\M t9r ƅ\cR;Es=w\+EMA\]Cf`+DžXӥX덵hOpPJT;s(\`4؉|X;rٻTㅝt1녝u1H#hP;t9)ЋH#h;űp91t%8[^_ÐUSEtXPR؃u1]ÐU,WVSE=U(M4HuU PMAA;4s< EAj% E;}rE#EUncNm)σ9sGA;4s< EAjB% E9r](#EV4wNm)σu5FuE}MEE4WU9sEA;4s< EAj% E9rV(M1#EЉEm);}sEA;4s< EAj&% E;}rE#EU rcu Nm)σ9sDA;4s< EAj % E9r](#EV4wNm)ύE9sDA;4s< EAjF % E9rFu)ƺ(M#E)Ɖm)ߐ+];uv);MvM)]E)9r&USPRZ]ރMFEKu}uEZ E}iUM =1e[^_ÐUWVSE߃5)wGA;4s< Aj % ƃvwDA;4s< Aj % ƃv%9t O}}GwGA;4s< Aj % ƃvM}u= E}pE51e[^_ÐUVS|xKy C~C~C~Dž|QRhrh4hh Và tpC~DžtQRhhjjVPà ~xTIt|pxcu xp1X[^ incomplete literal tree incomplete distance tree U<WVS5wGA;4s< Aj% ƃvwEA;4s< Ajb% ƃv@wEA;4s< Aj% ƃv 1ɍ ;<AwEA;4s< AjJ% ƃv ;ywAvDž PRjjjjQNǃ tJu  (-A;4s< Aj% ƃ; r#‰H)Hw GwFA;4s< Aj% ƃvD;J8GswFA;4s< Aj% ƃvD;JGs~A;4s< Ajn% ƃvD ;J tGsDž;5L PRhrh4hQPMǃ0t0h h7PPPhhjRPǃ t;u#h ht J u vh1[^_UVS5uAA;4s< AjV% ƃtEKwEA;4s< Aj% ƃv5uuste[^UVS1ۍupVu?p9vÃ}tՋv ABIƒw A1e[^UVSu] P/!4tJtN54h<S 4hh<VbK4 tu=4u=P/!tA1e[^ÐUVS]M t#TtX2%3CIuT҉[^ÐUA4AÐU4P/!4)R<P5pgJBv4У4=v=4u}t"4AA<ÐUt)Php5(BuÐUtHPh=\u5h5(BÐU WVS} uur)߃VWEPIÃ9uۍe[^_ÐUS]ـ;t$Dt  A9uމ[ÐUS]j/StX؋]ÐUS]j.St9u@H8.u_9u] out of memoryargc<=0UWVSuEEuBEu1E}QÃEPSEà "h S kÃ;tCE;th SzjÃ;uă}uEP?1Ej@P9ƃuh E 80EM}h ]EHE}~+h SiÉUJCuU֋EEtmsEe[^_ %s: %s: %s Uuh|=5,h h V%s: %s: warning: %s%s U=Tu#u uh|=5,h h:=lu l %s: %s: unexpected end of file U5,h;! h=P/!th|=h|=hA! huÐU5,h;! hh =%2ld.%1ld%%U WVSMu ]u1r )ȍMb)‰ȉיƅ}4CPSЅ};C| -Sj-=0Cx{};C|  Sj gfff))VRh! S{e[^_ÐUSu<Ãu h ؋]output in compress .Z format not supported U=Xu.Xh # hE 9Et l %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.U ËM#]EE}u4~h $ S]]UM舑pE|u =\]E9|Z~O=\u'}~!URhpM QnE0$ =4t $ PNU]v4N ZwNM)}߁?~u@+E9~Å~EpSVPA]}?~1=\u!EPhpU RM E޻)EpSVP}A}E9E}EUMfQM EUUM9M}=\u$}~EPhpU RM 1e[^_US]lnflntn9~e)ápnf lnA;4s<Ajbpnu pntn tn)ى tnpnf ln]ÐUSEln)P1؋]ÐUflnpntnjBad table UWVS]܍EpؐfPBv1ҋMA|;Usِu 2fAB;UrfEp߻) fLBvf}t hG* E])]9w5pMfM)щfDB;Uv܃w!])щfSBv|p^MtM9t]fSB9uuu+MEeE9upEU MAxu 2D*<t;]w9s}MEf PB9rlΉMUB+UtM] ]4f8uffǁ]fEutE4 E4Juuf0Etf<xM]9&X[^_ÐU WVS] SEu=S 1;u}TlF;u|jnfNy1;u}ylnf ؍~ulnt Cu~CPTl;uujqÃKxTlFKy널;u}TlF;u|hlljhTlEPe[^_ÐU WVSj Eu;j þrHNyfNy1;umnEll~0ln44t_YTlPMu &ujIX j :XKcpFKyQpF?pF~hj hph=e[^_ÐU WVS=hluFjhlu jjjVajjjC hllnf%Epv3ln44t^Yw;P]؍e[^_ÐU WVSmnEllTl v-ln44t^Y w;PtKS¸؍e[^_ÐUhlÐUxn|nÐU WVS}u 1%Ll03Ll@%LlC9 xny'=u |nh=w 3C9uWxn‰)H%Ll xnxLl03Ll@%LlC9t xny낐[^_ÐUSE] p(B=|nu6hh =\uمtՃPhS]1]invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman treeU WVSnnA;4s< Ajv أnNyA;4s<AjBn~h1 1;nCoA;4s<A jƃC;n~ǁ~h 2 jno19_ooC]~9{A;4s<A j^nNȋ];n~noe[^_ÐUWVS1ҋn~&\p)ooK n ~ pp91oΐ)ًKr Hs9~H=pw[^_Ðinvalid compressed data--length errorUWVSEU p(Bypp pHEnoHEp9p}TpA;4s< Aj أppp;p|pp)ѡp#Epم~)}֐F?x9}NpA;4s< Aj& أppp9|p)p!;\pr;Eu;5nt<on=u)5ps9nt h4 11e[^_UU1ABuUUM :t9u B:u1ÐUVSup 0dT9s9rp pd)ӉУpT9s9rp 0dpT9s9r[^POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c U,WVS]`=dudpppU<-upE?<+upE+hn7 't p ppt 8Z=puspp9t;dt"M Qd9tpddH d;E}U 8-uxtڡdpd;EtcM 4~7 uBPdp9pt@9tM Qc@pEpdd;Eup;pt%dM :-uJu.=pu j`dQ1t -%@‰p&dU 8-x-t }=pEEEEGt<=uE#}uuMM EEtEp)PRQ|0u؉+p69uuEEE}tJ}uD=htdU 42h7 h_5pvp}^dH d?UztG=`=htRPM Dx-uE01h7 h٫'M1M DP1h7 h谫 5pp1aUzuk@;E}M `dR=htU t2h(8 hK5pbp1M9::5p6p}tUEMQt A 1UB }t-dM x-tpPEPum=htMdU x-u5p2hh8 ht#5pPM 1h8 hOp8 d1pEpSEPXp:udt}:u.=htSU 2h8 hܩl1x:x:u:t `j`a:t `Nd;Eu6=htSM 1h8 hhlEE8:uE:U `dpEe[^_ÐUjjjuu uÐUjuuuu uyUWVSt$- =~s)ҁfD;fO;r0+fD;fOf649vSMtPf;3uf;u؍ft2O*N))Ɓ9~5;8|[^_]æUuu u jMemory exhaustedUSu u蟧Ãu h`@ M؋]ÐUSufÃu h`@ ؋]ÐUSu u Ãu h`@ ؋]ÐUSUE у#[ÐUS]U ك [ÐUS]U ك![ÐUS]M 1ҋBv[ÐUU1@vÐUU1@vÐUS]M 1ҋ9t1 Bv[ÐU WVS}1F;r}+1ېPWuf FF;r|ډ‹B9B|2BB9B}FPR0}¡FF@SWe[^_ÐUEU MFFF FÐUED$UED$UED$UED$UED$DUED$UED$UED$UUD%UED$UED$ UU1 t u:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]UWUװэA9FrP5FR'%1}Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [ULWVS11ېFF8FJFGr$$E 4M S S S S S S S S S S S S S S S S S S S S S S S S S \G S S pH tM M I I S S N S S H H H H H H H H H S S H S H LI S S I S S S S S S S S S S S S S S S S S S S S lN S S S N F S G S DH S H S S S S S S S S S S S S S S S S S S S S lN S S S J M ( =FuhD   F(F==   FF t~*F8)~F8\u x)f=F}~*F8|~F8\u x|* " F8  w F@ FF  F FZ  F F. | Fo F P FC F $ F F  F F~ F 9 u =F F7  Fu =Fr F   FM 9> u =F, F   F 49u =FEű FF}|E̍TBЉUA9tUBЃ v9tF9,uAA9BЃ w0| DBBЉA9ZBЃ vu9A9}8}."| ;uF=FuD PF8F FGЃ wYFDGУF=FuD 9PdF8F FGЃ vhD 3,=FuD PF8F FGЃ vFFDGУF=FuD PF8F FGЃ vF|&;F}hD o FFFuK\thD C=FuD P!F8F F}t hD FF  F49FFF  VF 49FFFF 49XFu CHFFF]StS F@uSFP=F}SjFS'F]S1ҡDu_uURVyF~уWuEPFUR(]S=FuD PF8F F^uB=FuD `PF8F FE E[FE=pp]43wt=FtB tB uB 1V׃tEPVF~ڋpװ FI FэAF)‰УFuD BPmFUF F-EԋEԃ< \u?Ft6=FuD PF8F F=FuD PFUF F-=FuD lPF0FFPF]u FF\u?Ft6=FuD P3F0F F=FuD PFUF FEfEfE܉UffE1]ލuܐEfEfEރSVkEPSWURW=Ft>ҡDtEPtEPLDPPuGi}ԃ]}t/URFtEPFPGFURsF=FtqD0t`]SG@tP-G@GHtPGHC;_8|G<GP}e[^_ÐUujMÐU WVSu эy];t!WVSAu C;u1e[^_UEt PUVSut%1ۃ>t4mC<ue[^ÐU WVS]E P$E uSEU 1;t E P4uvF<u1t+PU RuG␃4N9uPSÅt"E DU Rp1e[^_ÐUWVS]t} tjEu 1E;t{EPE P2S3xt:PuAt:t;MvMVWuƒ}tEPSEP_EtC;uEe[^_U WVS]t} u181FE t%װэAPRSÃuЉ؍e[^_ÐU WVS}t} tjƃu1VsEE8tm1U :tQE 4UE4eÃtSVƃSStGU <uEEU<ue[^_USUZJB 2]ÐULWVSEEUB@PEƋMQ|E|F=|F}HMx}ȋH 1Z}U<}|}ȉ|L Ku1ۋE;X}j&jGj GjG ?SOHW=5CU;Z~EM};OUB M "RkL }< +;uE 9lu}w v tF 1ۋFtMy:uC t:;tVװIMMIMĉэyEE9~}1;]}/MĊD9M8D uLIC;]})؋URD8t19}})ߋF9A9|FM16]Ãn66x ;;uEF "E9(1ۋ}E̋G EЋŨ:t>UؐM؋4эQ}эA9vuCŨ<uȃMQ}W4EE 9uԃE06 wV:tqMԋA8tfRiÃN}wSÃ2߰эAPS6S( >F 8tUrvSFMԋA 8uF}wv#FF 8\W :PRPF d|utq~V FVN VFN VF@BAjv 6 tEEU;B}tHj ËU}QcCURP3MATCYT1ۋ};_Ju66vvv CE;X~URde[^_0123456789A:B:C::EFGHIUVX:abcd:e:f:hiLlnqrsuvwxyZzword-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanullno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s US]E t#P覧PS5DGh h/aS5DGh haLG]ÐUu ujmemory exhaustedUS]Stujhz ]ÐUSE] tSP S3tujhz U]ÐUU:t< vB:u5J‹E 1ÐU WVSU] xGH9w@tPR| PtƋ=xG1хt)1e[^_fstatlseekUWVSu}xGEt= hG%Ĉ UmE1uхt )MEEUdGExGuZ] s ى1ut)UM dGUhG9r2%Ĉ 9u#UB;Urh\GR`Gujhz `GtG5lGGPVt5P/!h lW =PGu%f=@u 1f} u=jjjV=|GG=G}.5P/!h 1n|GG |GG GG1=@GtxG1RPSQщ %G Ge[^_ÐUj|GGRP5lG2}5P/!h E}u?URdG`GP5lG"}=P/!t҅} EEM |GGdG`GȣtGEe[^_US]GGGB)PJPR軌ƒu҉G]ÐULWVS]u E}EEEOjj VS0jj VSfÉ uhLG)EEPjWHe[^_%s%cwriting outputU WVSu} ]=Gt#GP5HGh =Gt6VSGGGGRP=G =Gt#+pGGGSRPhL)PjVuX@t5P/!h =Ge[^_US]=GuIpGG=HG)PJPRƒ@u؃j-P5GG~ G9r]--UWVS} JE=Gu=G~URUu=GG]څupG1 G9}M@9vN9v]8^u;E|u =GtI=Ft@;ut;h )E)PEPVÃj-CSVރ ;urӃ}tYE9sB)PEPVʼnÃCu=Guj:SV|E9rUE=Guj:W]SL1=GuGGFe[^_ÐUWVSu JE1]EEE=GujuREG=Gtn9sEPRS"}]EP)PSXGЉƒt9u;uvE8Ft;uu=Gt9sEPVS}e[^_Binary file %s matches U,WVSu] JEURSVN?tS=PGuJUB %f=@u8Vt5P/!S=EPS1GGGGGGEE1ۃURju'P/!u =GutP5HGcEGu =Gtu3pGtG)P1}uPRtE}t=Gu1EGG@+M9vE8BtK9vE8Cu)ډU9sASQdE=Gt ST}t=Gt =GK1ًGGEȉE9}4pG9v+9t5ƉU]GI9vU8Qu;}} 9v;Mu9t G])ˡpGtG)‰)GG=Gt QEPSu+P/!u =GP5HGv pG G=Gt GtG)9}tCEtG5tGpG+]SE=Gt5tGU)GG)УGЅt}t5HGh: Ee[^_(standard input)%d U WVS}u1HGՕ jW,ƃ=P/!t߅P/!uP=PGuGE PWC,t5P/!W=E PWw(=Guփ=PGu7 t u-E PW+uU B %f=@tSW느=HGE PWVTÃ} =Gt9=GtG:P5HGh 蚉Sh 艉؍)9GuG P5HGh Pt%VtP/!tPWH؍e[^_recursive directory loop%s: warning: %s: %s Memory exhaustedUWVS] EtJC9BuuG=GuHG}tMQEPEh[^_ÐUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE -Z, --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . US]t25DGh h*B5DGh$ hBt5DGhd yz5DGh fzhD Yzh$ Lzh ?zh 2zh$ %zh zSoconflicting matchers specifiedUS]Jt!SPtjh %J]ÐU WVS=(tF(01ې4EPuFTGXG <u1e[^_ÐUWVS}M] 1Dt ADu9u8tFAC<\u tCA9tDtC릐[^_ÐU WVS}t}QEEjPEPONjE0E 8PËE 8ESEPEP ue[^_GREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-rwithout-matchunknown binary-files type2.4.1%s (GNU grep) %s Copyright 1988, 1992-1999, 2000 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. defaultU,WVS2E DGt+j/PZtj/5DGZ@DGEEEJ GGGEEE PEPh 9P UU$8 < < < < < < < < < < T ĭ  $ p 0 @ $ w X h  T P ` Ȱ   ` 4 @ MTBЉUUoJ_hGPFjhĨ J'hGPijhĨ Jt'URP6jhĨ hEh ?h 3h 'E;}EU| } EqGaJQGGG-GGG GGGGGJJGJJƿ u G\ƿ u G=ƿ& u Gjh4 jRjhhD u uzƒ <=G}EG=G}EG=Ju DGJ=MytF5J =tOPM Dx-uE01h h-'M1M DP1h$ h,GװэD GUB Myu@;E}U J f=tM t1hd ho,GװэD GUB ?M9::GװэD G}tMU EPUB }t- M x-tGPEPu}=tM U x-u5G2h h+#5GPM 1hĶ h_+G  ?GGVEP G9u t:uR=t6=GtVU 2h h*VM 1h h*ã?wP8W;EEEE9t JQ ;Eu:=tVE 0h$ hD*5?U:::M J 5J5GFt<=u]E"}u]E؉E EE؋ tIG)PRQpu؉+G;эA9u]U؉UE}tZ}uT=t M 41hd hO)GװэD G ?}:>taUzt F5J=tM1E 0h h(GװэD G?}Uzu{ ;E}M J ^=tU t2hd hg(GװэD G?U:::GװэD G}tM܋U EPt@ 1UB GW:x:uG8uaJ`G8uH ;Eu8=tPM 1h$ hk'ã?E8:u:U J GÍe[^_ÐUjjjuu uUjuuuu uaÐUjuuuu u=U WVShHÃh_h jjSC, C S)‰Ѓ }j SC C {9uK(CS !‰S K)ʋs)9~s C C{0thC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S 1e[^_memory exhaustedUWVSE@0EUUM Mm]DtMMU M]]ExEEEtWU:W tGU|ЊM:O sDE?Et]:_ uą UB J)ȃ}jR']C C s9uK(UB‹MQ !‰Q ]K)ʋ[)9~EX UB BtGMA Y)É؃ }j Q UB B r9uJ(MAQ !‰Q ]K)ʋ[)9~EX UB Bwu \G@GMHG@ G@GYCXG@EG G MM|)u UЋ8 UЋx}UuЋD*ЉӀx uNMM]ME<u 2H ]@ M>ʍuЋD)Љˀx tƃ}#|+uD+ЊP ɈH u"|+D+ЊP H t+ЊF tCV)‰9C~C[uv `G0p t"F@9F~FF9F~Fv u1ɋAvSG0p#Dt)1ɋAv%1ɋ1ҋAvDt(1ɋ1Av"1ɋAv1[^_U,WVSEU x4u ;}uMQ<PRoNp<}<]]KM@E UU9EGU)E;MA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvEA;Eu39UB8AuC9{)ڋE)؊8t9hM8A0E)9c]]mA0uAA;Eu59$U8AuC9)ڋE)؊8t9~)UE)9~1e[^_ÐU,WVSUMA495M<MM;uw9t>MƊU<t;urFNU<uc^M<}tK E K 8sRt!B 8utR:t]Uz;] w}uE)991UUE+EMQ89~UUEE)FU<us^Mta9}tK E K 8sRt&B 8utR:t ;]w]Uz;] w}MuE)9o}tU U EBUBMAE[^_ÐUVSuU E]~,u2Du)PRV…ttSF4C SPRV[e[^US]jSS]UVSuM U]uu^EF JVf(F(t Qv$QӃÉ^uЍCFF FCf(e[^ÐU WVSuM U]}uu^EF JV~$N(F(t QWQӃÉ^uЍCFF FCf(e[^_ÐUWVSuFEFV )‰UU E|d9}F(t Wv$WFЃÅuЉ^ECFF@~IEH{EE|FDIy $URv$F S1ɍ{EE;M}FA;M|U9Vu!F(uUBCF(uRF А~}~ f(e[^_ÐUEU @t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSte[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSt菍e[^_UE1ɋPt)Rumemory exhaustedUhh- 5hj 荥5ǖUWS uBH@1ҋ=ِDt B~cH [_UEJJÐSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitUlWVSEEEԋU UԋMIMEEEEhڇEu *E Eu]s cCC{uJtj PWj n}E8uuӇ끐UB M M؉MċU;UE(]BU}t ËuЊ0EEr%$(                                                                           0                                E@U9t$}uWREP(#UE)@R9&MA=vAuv6舅‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9_E E=%U;UMQ]SR'"%}G=vGEp0蠄‹M9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰuE)@V9\} ER$UE&"}uE $ "EE MJM}t EuЊ0E}*tdEu}+tX}?tRH}\uB;M BEJM}tEuЊ0E}+t }?HEEM+E}+t EÀ}?t ËU;UP}V#UE)؃R9$MA=vAuv6Ђ‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃W9]}tUB]  EHƒ}t uF.9tp.uk}te;Us`}t}8}tMA 9t 6 u/]@u'E+E؃PuVj #E#]؃E)؃P}Wj#؉E"uF=vF}w7\‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)؃MQ9Z]S+EPuV}tP#EE} !UB=vBMq1t‹u9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃W9ZEPjURj="E M؉Mȋu }G=vGEp0‹M9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰuE)@V9\}ENEE9EUE)؃"R MA=vAuv6~‰ 9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃"Oʉ9YE؉Eȉ)@9HUB=vBMq1~‹uJ9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9\ME؋E8^uE8^u@EEE܋UE)@R9hMA=vAuv6$}‰m9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9_E E؋}1]؀{uutKU;U,EJM}tE]ЊE䐐EtN}\uH;MBEU}t EUЊEEЊMM 낐U}]u E@9}t}-uK:]^}-u}tҡDu'}t t t}t*ҡD t؉уU}tҡDuE}tҡDu.}tҡDu}t*ҡDt؃U}tҡDuE}tҡDu.}tҡDu}t*ҡDDt؃U}t;}u}t/ҡDut؃UFZE=}tE萐HM}uEM؀I IEEEЊM]u؊Vt'F|uȋM؈At A|t]CE\u 3} Ef}E%=E;Euu]uEEEكU$p   l 0 @ X  U ,MAEU;Uu/PPusED]ۉ]EU}ċu+>9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰU2E)؋R9[MQ]S˃~ +Eȃ+EȃPuVj ]؃SEPjVj E _SE+E؃PURj: EMQS)PVj} E0m];E EE}tE]ЊE䐐E;Ex\u}؉}ȋE uF=vF}w7Hi‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\]Eu}؉}ȋE uF=vF}w7ph‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\]E"uUB=vBMq1g‹u9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9\EEZU4ME)@uF=vF}w7f‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\]Eu`PUB=vBMq1 f‹uR9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9\EEUME)@|uF=vF}w78e‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\]EuUB=vBMq1pd‹u9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9\E E"UME)@uF=vF}w7c‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\] ENu@(EЈEE;EPuuuIU؉UȋM)؃uF=vF}w7b‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)؃MQ9Z]E؊EU؈E5M}t E]ЊE}t~uD0;Euo>tjE€*t^^tY}t\uB<+tB +t6?t1Et :{t~:\rz{hU؉UȋM)؃XuF=vF}w7a‰]9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)؃MQ9Z]E؋uE؋}O}uF=vF}w7P`‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9\]u؈E؋}E;U}tE+EPEPj}u4_u_ ju_Ru^:u^ "u^ u^UME)@t̍uF=vF}w7^‰9t:E)ЉE؃}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)@MQ9j]E؃u]u}+>~1e[^_ÐUMU E BBÐUS]M EUAAQQ[ÐUS] M9tQJIB9uuSu]ÐUS] M9tQJIB9uuuSuv]ÐUSU ]B;Evx\1R(u uu|uf|t[UVS]u\EC1;E s1 t)t-}t t9)tf};|t}tt 9|u[^UUMIx"E9u Iy1ÐUWVSM;U u BEfEfEEfEfEB1ۋEt 1EEUUMffEEPURjEPMQj}tɋU]ɉ]˃}tM E E0}tEсу)ʸˆ1G/؍e[^_ÐU,WVSE@EU2uJMEEeEE1@B $B F$4 ? 0     ( (  ? ? ? ?   h h    ?    x  ? ? ? ? ]KFUpF]م}K0)sM Ky/~EC~م}K8)rUKy1۸Hɀ<uM C~1۸Hɀ<tUC~pMQ HKy]C @u EP AUB.FÍt3<t < FFÍt3UE9tJUFÃ;]sfM;MuB$P9wC$)ĉPuRbEtMɉMUEE]K}tNEEFƒu-EJ[YEu;ut >Mt4UB] ؈€]C$ЈCEAEEt뺐UBM Ȉ€]C$ЈC1e[^_USMU ]tA$ AEBEBaBB[ÐUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t#~< t < uGu }t(E@uPuvn};uUBE];u| E+E3;E| E)])EU }t6;]~X }9BM<uDK;]~=}8BM<t';]~"BM<uK;]~ B}<8t)]uB}t;u| +EUM }t%}8%E8tJ|;uu}t E@tGU(RM$QV}WEPURM Q}W tt~KFCNe[^_ÐUEPuuPu jju,ÐUu$u uuuuu uÐUWVSu$EEԉEЋURUEMIMȋ]Cx}EEEEEeEE$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}uGEEEEEEEEE}EE9E;]s7IUE } E }  $C;]r׃}u } tE EUUE EM MM]]]艍p;uu uuu}}uuE)E}~U9UM MM܋]]uuu܋})}܋EEؐU9UM9M}t]9] w p9v}9}8t E9E U9U}tQ}t7EM܉Mu9u}UMuC;]r}tLuH}}܋EE؋U 9r M9w]]ػ;]su}UMC;]r} ]CuWE@su PPFPPF~}G$ GSuKE@U 9s@PrPM APq|P] C{u >t+F}8VE9Eu M+M E+EEpu=It }<IuE P@Yu V}t9E w 9w+E +EE} W}tu9E w 9w+E }+EECE ;UvE9]]9sM QAC;rE+E]9]tu)u+]+] }Eԃ$  \     ` ,    P   d d <    ! L! H$ $ " # ! @" EEԃ}tEU9UuM9Muu܉M9t}MԊEE܋u82Ku=}9}uE9EUU܉E9tM܊uԊEE8Kuă}EEU9M @;Ev]9]uu9u<}}܉u9tE@ @u*}tUMȀ<  ]܀; u~ }'}t}UȀ<uM܀9E@}EM]9u A;Mv}ԀEE9EuU9UtMM܉U9t}t]uȊ0}܊ËM 9s %}T؃suEԍt0uԀ}E@}EMU9] A;Mvuԉu}u&WEPEP$ȈU ]tuE܁It }UMu܋]4} $EE}uEEUԉUp] ut}E܁It U]uU܋}M$E]9]uEE}7HEԊ0t!‹]ut‹}tuEEEEt EH9E;MEM1E<w <s< t .<u(EUBÍru}t U𐐐UU:z}}Ԋ8BoM}+}tG$] C9s2uU]9ruAUS9rыUruZBÃUu+UO< D99sYǐ$P9 $)ĉPuRSE EEu+E9ruU9w?uHM;Es+8tE;Es8uP@ЉE}uUu+EU+UJ< T99sZא$P99$)ĉPuR(OE uuu+E9ru]ԋE9w=MU}EMU}EMU}EF;uvċUEM EUEM EUEEUE]܉EuFÃEuԐF;Es<w됐F;Es >uאE؉E;uu}G}ԃltUB ƅx t NxÀ{u&x8CtUBUԃlSBMԃl<|C8xs$x%Txs]ԃl,uF }ԃl EÀ{u3FS9K%TȃC<ub1~Uԃl9}<~tC9}.VCA9}|tC9}TD Ѕt9unMAe}ԃl<uR1~9}5C9}-F"Cu%tِB;t}A9} D"Dt9tC9uE@lUԀztB pEUHMLX]\9rJUruED}UBEEDUUruED}I9sEE@ËUԍ\]]+EU+UJ4 T19sZ֐$P91$)ĉPuR KEMɉM]+E9ru]9wMU]EMU}EMU]EF;uvċUEu4EUEM EUEEUEEu^FÅ~KE}Ԉ_EE@@HUZBtKZZnEMAÃEUډUuFÃEEXF}t} 9}2 E9E$}U9UUJ;Uu MEH9u ]S uVH<‰}9}u ]EH9Eu uF}<82}tE 9E U9U}M9MUJ;Uu ]EH9u uV }WH<‰E9Eu ]EH9Eu uF}<8E9EuMEH9Eu ]SuH< A}t} 9} E9E}vUJ;Uu UEH9u ]C uF<?}t} 9}uE9E}UJ;Uu MEH9u ]S uVH< p}9}uUEH9Eu ]Cu<}9}+E9EuU9UMM܉U9t]9]u uEH9Eu }GUHE@}EM]9u A;Mv}9}uE9EUU܉E9tM9Mu ]EH9Eu uF}Ht=E@}u EMU9w] A;MvEk#<EpuMTtU܍x}TUԍX]TUX]DE9rHUruED}UBEEDUUZ]EDuI;MsE}[}9}sTMԊ<w <s< t ?<u9E@Eu^@ÍD3Et 8 8} 9}SE9EGUU<}X[^_U WVS} uUE9<<BEZ@U)BEZ@ÍBE|tU3E|u&VUDPR|tiUډU:tEXPӃVRPJt7]'E#VWEPt U91e[^_ÐUVSE] uE9sC9tVSEP=u 1(AEQ@D EM9re[^ÐU WVS}uE@E$`( ) ) ) ) ) ) ( ) l) ) ) ) ) ) ) ) ) ) ) ) ) 4) ) |) ) ) ) ) ) ) EVu EPuʀ$Јuu1{EPExȉERUZ]JCBEuU Bˉ]Eu 땐E덐Ee[^_ÐUWVSM}u] t:CF88tIu1[^_ÐUEPʀPP5Ju utl  1UWVS}EtEܲE@@h4UBt]h4MAu 1ۉ}ExӡDtK ;CvUB}teMMI E`E$MQˆQQEP} эAPU RʫÃuu2Myt)QquEp34UB؍e[^_ÐU u)PR5J΋t jPLP9sF9r5J蓑t jP!Pe[^ÐU,WVS}JEE 9UUEEEPE)PS5J貘Ãu=Jt-9v U8S;EU8=Jمtt9vSDu`{_tZ;MsaDu9_uMEPNVS5Jutt9vQDuy_uC;]18U)RURPEBuUEK9v{ u؍e[^_UMU ABuAUuu uE_block_table_block_countusage: %s [-n] [-v] [-s sec-per-track] [-h track-per-cyl] boot biosboot device U58h9 hj1vnh:s:open: %sboot: %s proto: %s device: %s disklabel: %sbad disklabel magic=%0x8xdisklabel type unknownproto bootblock bad size=%ldproto bootblocks too bigstat: %s%s: Not a character deviceUnable to get BIOS geometry, must specify -h and -scan't read master boot recordbroken MBRusing MBR partition %d: type %d (0x%02x) offset %d (0x%x) no OpenBSD partitionwrite bootstrapULWVS]u i'DžDžjjxntS htbstvtJT5h/!:Ej5h/!"Ejpjjwh|9 VSl:p+LjDjTjjhjj=jPRPƃ}5jh9 jJ=jtK5jh9 hӫ5jh9 h軫5jh9 h裫 PhedAV+t5jh9 j =WEVtPh9 jfuh9 ]P5j%u j-tPh9 j7=~h : jN;EPV }5jh": jE%f= t5jh+: j:=jt =jDžDžEDžjjWPjSt-  DžDžDžDž jjWPjS- |jj=jt =juhd: j9RV5jt j,_Fjff f jjjV )|h WV'(=wh: jf UtYh: j29K4QQhhB)Ph: hk % 9s{ t{t9r퍅 9rh: j8=juOjRPV(|!RV&;th; j&V'1[^_nlist: %s: symbols not foundnlist: %s: wrong typeread: %sbad magic: 0x%xmalloc: %s: no memory%s: entry point %#x proto bootblock size %ld room for %d filesystem blocks at %#lx U,WVSuEhtV3tVh@ t=ttxj 8ujV߀ǃ}Vh9 qj EPW% u~Utfff=u t Rh@ S]]jSץE܃uVh@ #SEPW"%9tVh@ U E|jUjj=jtKuVhA hzE 0hA hc 55jhDA hEW %E80h@ Q%}tURN| W$1e[^_%s: devread: lseek%s: devread: readU WVS}EjÉ VSW$9u9tEPhlC j۽URu W#;EtEPhC j譽e[^_statfs: %sffsufs%s: must be on an FFS filesystem%s: bad magic: 0x%xfsync: %sfstat: %scross-device installsuperblockBad magic number in superblockBad inopb=%d in superblockNo memory for filesystem blockinodeNo blocks to loadWill load %d blocks of size %d each. Using disk geometry of %u sectors and %u heads. Too many blocksindirect block%s: %d entries total UWVS?j-jEP|ƃ }URh9 j裻PV%tMQhD jvjhD S%t+jhD S%tEPh$D j]2j xPV ! tURh@ j/2xtfff= u  tRMQhED j1VߠtEPhYD j虺EPVtURhcD jq@PM QYt5jhcD jADžhDžlTpDždjjdP`PjhP# |4E}`}9thmD j0E)UXV hD h XAPhJE PFJ0\TthD js0GxPhD j)w0TuhD j10E1ƉG!ww1wxËO`3OdhE w0XAPTPU RE1wxTPw0F<@<@PAQ DHRPDHRPL h E jH/=jtVPh$E h語UBft f tf u =ptjMA,jA8=jt%EX8p,1SVhdE hFP(jDž\Py(LaEPG0} POdXBPSÉ+jy;j~hE j9.\L\ >t LuLOdPBXhE w0XAPTPU RT \;Ot>EPG0} POdXBPSÉ+jy;j~hE jY-\L\;Ot}>t LuEPjjSËURjjS؋j+jyj ;j~hE j,=jtPMQhE h71([^_%2d: %2d @(%d %d %d) (%d-%d) UWVSuE uE U1Su 1? ;E u1v,;V,1v8lj1v,J;V,rF,(UB ]C1v8Ӊ1v,]Cʃ? ‰% f=jt7CDPRQCPWCP5h6L h0UBQ)Ӊډ;E t$tVjjȃPEE UUE ]Ee[^_r/etc/fbtab /dev/%o(null)%s: bad entry: %s:UWVShM hM h.j#V!ÃthM V>É߃jhM SufhM j=ÃtN;0uIPhM S@t-t#%9uhM j=Ãu#؅uM PhM hN jYEPGPuAhN S(EPE PShM hN j =ÃũPhV1P*[^_/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...UWVS} ӍCO U |trEPR08t =P/!tM QEPhO jURMQE P7=P/!U RMQhO >hE PV DVà uU RMQhO jDž)rrO 1t tSֿO t@QR*P| MQEPURQEP0Sy$ƒxS[^_RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s/dev/%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelU WVS]PSqo}} ShR V%%= t =`t^hSSO E߰ъL ‰߰рaT ߰эAv^CPhR hR hSO߰ъL T‰߰рaT !} ShR 0jVEnÃ}d=P/!uCъ DjVnÃ}/} teVhR U} tNVhR > WhedAS}$} tVhR S1VS  8v} tӃVhR 9Ð881Ҁ8t‰Ѝ[^_r/dev/%s%s%s%c%s%s%sUWVS]}tP/!EU EtEU j/SEtE PSlƃlEtcmaPSEPhU hU hhjM =w%E Phjhlƃtj P/!?}ubu]=P/!uTSEPhU hU hhjAM =wE Phjkƅtj P/!?e[^_$Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmpUVSjj hW tkƃ|PVSugju]Sgju EPVjuEPEEPmj$SV$tEURPV@ V\h[^$Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmpU,WVSjjhX vjƃ} 11]e}t^jEPSuHjEPjEPEPtjjjVj$SVj$SV$tVWe[^_$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $US],jhat St4jSjSjS~ S1]UEE@EjjURURjP |EUEE@EjjURURjP|ETERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcap%s/%sUWVSEna uh Z x DžxxuhhZ x:/h,Z Pt hPuh5Z /ƒt6:t1װэA =whLZ RhmZ S3hhLZ mhxRSѪ؉t6< t<:u"Bt< t<:tt9sB:uxt+xth|URj:EPxt2xt,@&|n|t PtCX[^_UEPu5n蝞t EÐUj:u5n苎%ÐUVSUu EBEEEPEP5nUÃ|u6蟨CE1e[^U WVS]1DtϐtBCDu4;.uCDtt0АCDu;*uCu PCEЃ;utO'!fHf w@'!EƉљƅ~(-!PEЃNe[^_OOPSUWVSuEoE]u `^ Do8%t}DosۋUEPFMw$^ a ^ ^ ^ ^ ^ ` ^ ^ ` ^ ^ ^ Z` "` ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ` ^ ^ ^ a ^ a ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ` ^ ^ ^ ^ |a ^ ^ ^ ^ ` ^ ^ ^ pa u `u` ~hc~8}DoZQ)ˆр0EE)Á}Do"gfff)€0ME}Dogfff))À0UE+EE]} ] F9~FFt t u]}u =$-!tNDoу _}t,-!u e^ $-!PhDoC t}Do@EFE ECS}DoME9gfff))Éڅ}S))F]oDoװэD >|RURoe[^_UPС8uÐUSu1=t@:uÅt Kuh(b ]ÐU=TouToULWVSEEU EUUMUM}} EE؉ËMمtIΉ]u}}$UE؉EMمtIMEUEUu}UU]u=9v Љ}u 1Ɖ؉ӋE9v1u׃u9w9ur됐ZE )U܉}ȉM }ȉߋMEEċMm ]ĉe؉uȉlj9wu;]vO1ɉ}ԉM؋UԋM؃}t؉ẺڅtJUЋŰMЉЉ[^_U\WVSE]u EUEU} E؉EڅtJU]u}}!E؉E܋UڅtJUU܋MUMMM؋}EEԉ]ЉuuN9v ؉#}u 1NjEUUEUЃ}EЉEEE9Ev]ȉE̋UȋM̉UM]ԃu;M9Mw9}rUE)UԉUEЃ}EЉEȋUU )މeԉ EԉUeEЉ EeЋEuԉUE;Uw uE9Ev M)UԉM}t8ME+EщMEЉʉm UЉUȋEE̋EȋŰM؉Q}t%EUىM؅tHEċEUĉEUEU[^_U,WVSEU u}EUu99v }u 1ƋEUE;}v1|߃u9}w9ur琐^E )]}M }}MEEUM UeEulj9wu;]vO1ɉ}MEU[^_UE EEPhvtuUEPhwt@uj|EUUE B(1UUE B$1UE `` gPPUE@(UE@$$OpenBSD: swab.S,v 1.2 1996/08/19 08:13:24 tholo Exp $VWt$ |$L$tfffIutEffffffffffffffffffffffffIu_^$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $Uh\ou$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $UE Mʁ`t[! tI tgu@t,jt@ t.Tt4tc6b.-&lspw?@tr-@}w-@ʁ@@t' t3t@t-xSs@ tr-@tw-@ʁt' t3tt-xSs@tr-@tw-@ʁt' t3tt-xTt@ @$OpenBSD: strlcat.c,v 1.2 1999/06/17 16:28:58 millert Exp $UWVS} EM€9trA9ts+u)uэD!?ttAJC;u)3[^_$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $Uu u$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/shU,WVSEEQo ETo EEu EhpEÃttDEP(EP5H/!EPhWo Aj?jjǃjjƃjEPSMÃEPWjVjtEe[^_$OpenBSD: realpath.c,v 1.4 1998/05/18 09:55:19 deraadt Exp $./U|WVS] 1jhp Q}p fhuSƃj/Sjt7x9up H9v8/t@؃Pg`߃EPWQuiE%f=u#hSWXf=@uWp WV%hSt 1Ҁ;/u {Ѐth߰򮉍ыD@=vP/!?Vuhp S讻VS衻􋅜P}P/!,􋍜Q0P/!􋽜W􋅜PaP/!1x[^_$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $UUimNA90%ÐUhÐUE$OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $U,WVS} }uP/!EPDEu U+UUE EIM]EMEGKuuu;u wJE};u sE8SWU҃}FMMEȉEPWU҃Ey} %]ME ËU‹E HEBAKu]U ӋMыUڊBAKuMM E9wYE};usE8SWU҃}FMMM]MM<6BAKuu;uvuE}E}NjEEEEtPEPU҃}]UBAKu]UBAKu땐}MQ1e[^_$OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c U WVSu} ]='!u 8uS'!9})8-uxt,H x-uB v '!:tPSuK'!-u 8u=;:R58h v jx:th/!8uzr8uYP9B v ;:u:I=t5'!58h0v hp?h/! v '!e[^_$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $U WVS} ut4E8SEPU҃u~E<Nu1e[^_$OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $U D/!u\p/y~.hAu&AD/! D/!QED A1Uu uhLpUU u%PRu:Ujjju$ U$WUװщUAEEly EMEEEEPhL茘 tЋ}UEPu uUVSu] C t{u"S!tP/! 3CPSЅ} ;C| t  SVbe[^UUBHJȅ|  R$OpenBSD: auth_unix.c,v 1.12 2000/08/24 17:03:20 deraadt Exp $authunix_create: out of memory UWVSuj( ǃhÃG h_$X/! X/!K PS@CO WGCj8PoG8EEEE EEEuEEjhX4P@VEPV薣uDV@ЉƉsVC t/V4RP"CGCGWMhz hl1[^_ÐUWVShSt4E藅|X xVj Ã}1?~1҉ِIuWSxP|PPX[^_ÐUÐUEU @$JPRA ÐU,WVSE 8UZ$jppuV|CtP)C{ WVtC UCBCB/EWVkCUCBCBEPe[^_ÐULWVSEx$GU9Bu 1GEEjww]SuVS!Eă t\jEPDEȉEEEjS@ЃVSEătUGBGBREVS誠Eԃxt S@ЋEče[^_ÐUVSu^$sCt Pv$Ft PsVge[^Ðauth_none.c - Fatal marshalling problemU,WVSu]~$jhGPS9VSw tF PScuh\ ׉CS@ЉCxt S@Ѝe[^_U\WVS]̋EP BUȋH$M@tEut} }EE}URUM MϰыUL MM9Ms 8uv %G7UB9Eu RMAtB]S9Usu܀~ uGu(9EMA]Dy_9UuUD>_MA9EuAt69Eu]܊ uGuuMDQ_Hu܋];s9FUDuG~_tA EMuEP]M%=uEE}u(]9]D}uu9uE&MEBM%U=Xw,=H)w=8tH=P-=pYw=h=xU]]CMÃ| u | E \)ˋE)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@EPURE@PMQuVEP U܋MD ]CU܋uTU܋E@E|MAU܋u;t:u܋M4QEPE)@PURVMQ/ `U܋E@M$MAu\3EPSQURMQuV P%=CK%Ë%=uK룐UBLUMU܋M+Q TEPURE@PMQuVEPPUBUML1mMATL UMU܋M+Q TT EPURE@PMQuVEPuUBUMTL 1e[^_UWVSE EEU;BtHMEMeEPhPURQM1*EEE uEUE;Pt  ME9EuUU11ۃ u M@uuE@u UX,} u M@u}u%E@uuNjUX0t+~)MQWQEPURM1YE Kځt"ҡDu)_t$}tUDu}_ut@%Du_u't}tEDu }_t{w!EPWPURMQE0E EMu4U9Ut,EMQURPMQEPU2WEE/UMQu1E@e[^_UWVSE@0EU UEM;QtBEEMeEPhPURQM1EE ]EUE;Pt M11 u U@uuMAu Up,} u M@u}u%E@uuNjUp0t)~'MQWQEPURM1E Nځtt|ӡDu)_t$}tUDu}_ut<ËDu_u't}tEDu }_t{w!EPWPURMQE0\E UMsEEU9Ut1M9Mt)ERURPMQEPU2EEAEe[^_ÐUWVS]E EEeE9GURU𐐋MEсPw}(w/  8w0N@HxwB`fwX\hDp8<$wt`tp9EE}t }EE~E}E}Eq}kE\сUJ}FE"A4E%#E Éց}#U ӨM)uEMe#E É#E#E É#E#uEEMTсt&}UEEсuދM >#E ÉсEȋU%=t#E #E EMɉME9E[^_ÐU\WVS]ȋEP BUċH$M@tEut} }EE}URUM MϰыUL MM9Ms uv %G7UB9Eu RMAtB]S9Usu܀~ uGu(9EMA]Dy_9UuUD>_MA9EuAt69Eu]܊ uGuuMDQ_Hu܋];s9FUDuG~_tA EMuEP]M%=uEE}u(]9]D}uu9uE&MEBM%U=Xw,=H)w=8tH=P-=pYw=h=xU]]CMÃ| u | E \)ˋE)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@EPURE@PMQuVEP U܋MD ]CU܋uTU܋E@E|MAU܋u;t:u܋M4QEPE)@PURVMQ/ `U܋E@M$MAu\3EPSQURMQuV P%=CK%Ë%=uK룐UBLUMU܋M+Q TEPURE@PMQuVEPPUBUML1mMATL UMU܋M+Q TT EPURE@PMQuVEPuUBUMTL 1e[^_U,WVSEX(P,U@0EU UEE;PtRUUpjSEShSURPE0ËU,pSEPEUUEUE;PtEEދ}J1t uEE11} uBu}uE@ur,} uBu}u E@uur0t'~%SWSUREPU2à Nށt#}U졘Du*}_t$}tUDu}_u}t>EDu}_u't}tEDu }_t{wSWSEPURE0à U<u_E9EtWUpSEPBUpEPS-SUREPUREPU2E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjSEShSURPE0E0uEEU;BtUE1U u@uuUBu Ex,} u@u}u'E@u}uEUx0t*~(SEPSUREPU2]à Oہ}t"ҡDu+_t&}tUDu}_uEtC%Du_u*}t}tEDu }_tEE{w SEPSUREPU2à E<tUUUދ}Ht[U9UtSpSEPUpEPSSUREPUREPU2E Ee[^_ÐUWVSuE EËU9}WE %=Pwx=(mw/=== r=8w=0<R=@=H24=xw;=`tw=Xs =h=p=w=P==tU=tf9E_}t }EzE~j&}ZEK}BUT3})EUJ}E"AE3Dρ) 2 22M)}]3T3T03EtyELϋE %=uU0B3EDEȋ}W%=tU0 3DECU9U%[^_ÐU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQRSVWQGe[^_*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xU?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNULUWVSuE$EtU tMA;E s +} } эyhSÃu D@FPŨF FuS+ ^U ׉~FFMCPEUUe~ VH1 IyCCCC MKC(C,C0C<C@CDC4EC8}1@CHjhV[FHC }thV*Ut V_hhV jhVNIK$SVSVVSVSVCLECDUBZ eC(tjV~t MQFh[^_UWVS]EsS;Cs<|t;E u9sujS;Csy8|ut@}t"VC)@PhxSPuEC+EPhSCPU)PWS{jhSG}u%C)PWSC+EPhSe[^_ÐU WVSu1FECX$` H H H ĺ H H H л H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H  H d H H H H H H H H H H H H H H H H H H H H H H H H H H H H $ F9rjVJF@DFXD  V FShhV;Fs8)tj)V  VHFShpVp;Fs <)jVjhV8FH(F@,jh VFH(F@0jVej VUF@t Vqjh(V_VwRF9rjV ';FsDtj VPVN9uC<v-?t({^B9SRD?tj Vt+ *t?{URF)@PhHVF+EPhPV EPF+E@PhXVF+EPh`URF)@PhHVF+EPhPkEPF+E@PhxV}F+EPhV F+EPURV jhVjFHPVjhV VNj;FsG8,uBPPDt%VÃ9~j V SWEPV;Fs 8}u@FV9s8}tыB9s z}uF9rj Vj VN9s5C<v!?t{u"B9sRDt j VFe[^_ÐUS]C9rjS PS C9r]U WVS]CE1;Cs98^u4@jhSPCH(C@,VSj1K9sB9s;E uB;Eu΅t#Kjh SCH(C@0E9Cu jSHe[^_UWVSuFE8\u"F9rjV8)h..te*[t({tt91!}F@tV jh(VvVej V=SF@DFXD  V FShhVN9s"B9s :\uz)tj)j\V  VHFShpVPN9sB9s:\uz)u jV jV ЉEFHE<t:]]UWVSEP EMB;As&jhg Rfujh4EBM;As4jhn R0ujhuVU;BsI8^u @EM;As0]u@WP]G]-u@MWP-G-MIWuVN9sB]tB9sـ-uԀz]u΀-uBEWP-G-M;As<]tjuVG Ex'@@t_XKxCӋ"Gt3Dt'Sȃ9tщUWuOKy tWEP }tjUBpNx.ۋ Gt ˆ (O ˆ GNyӋUB@tG B G tWMQF WuVN uWV PVAWV  WEP Ph0UR e[^_U WVS]} s19s-t[uA9sQj #:t=;CrjS-t]ujSyWSlC9rjSWK9sB9s::u z]j;CrjS-t]ujSWSC9rjSK9sB9s:=uz]u jSSEK9s<8-u7P9s0x]t*x-uE-S{E EEE:E~ j S+Mu9ы_OA9~e[^_ÐUWVSE0X]9s. DtЍZ};Us @Du})@ tSVP萢u<u݅ujEPs^_щUu Ruu N Cu݋_;t*S} WEPk߰ˀ;u׍e[^_ÐUVS] j=uƉҋK Ce[^ÐUS]C9rjSC9sB;Cs:[uz.u Fj.S=EK9sB9s:.uz]u jSEE]U WVSE0x9sAF9s;E u~]t(MB9sB9sB;E uy]u9rjMQH)=t%WV3谠u<t!;u݃tjEP1 Ce[^_ÐUMѡDt u LDPU WVS]E 3{UUSEE]ES]3{e[^_U WVSu] Fx8@t1ӡDt"SU9tSVy'PhV&<;u FP4;@4e[^_U WVS]3{EUSE^@ @]@S3{e[^_ÐU WVS]u {{}~}uU}~B}uB M$T  ( )){iVC)@PhxS1EPjFPSC)PhSC)PVSjhSjCHPSjhVC)@PhxSC)PhS]C)PVSMjhS=jCHPS-jhSGPFPS‹EHPjWVC)@PhHS5C)PhPSBWVSm‹EHPWVSY‹MQEHPRS jS e[^_ÐUUzuE BpBp1ÐUWVSUBH M@ EPJM@9EMA}zuP舏PrM‹MAPUBxuWR‹MAPNWp ‹MAP1Ƀ;M}+1EPZȅ}AEB3A;M|؋UBxt@tMQj)PvEj EPMQurE}MȉMJ)EMFFFF e[^_ÐU WVSu UBP UPUx19sˋF (^C9rE9u UBH [^_ÐUWVSu FEUBP HʉU@E9szE8CuT9tP1;}sD"C‹"F1Шu*G;}s!ҋ"C"F1Ȩt;}t;]r;]sVURދUB+pe[^_ÐUVSE] @H19s3[„0t B9r1[^ÐUWVSE} @@E119s7GEŠM 0tCB;Ur[^_ÐU WVS] uCEыU CS u P脌 PRNu+C t PߌC j uH!C VUDP3SC De[^_ÐUÐUÐUVS]S B}Bu 1ҋC9}<t  BC9|1[^ÐUWVS}W B}BE EEE1ɋW9}uu8t1AW9|[^_ÐUWVSEU z8xusFE<>uWVU RtCE @4EU B4>])<;uSVE P0tU;C~ًu~e[^_ÐU WVS]{u+u t;CPSZS ECЋM MQRP衕se[^_US]{u1C9C|@@PSSC M M C]ÐUWVS}_uu WG ]G E_HUUE]u;E|@uu;E|@IyكG+EPW MPD PG Uue[^_UEM xuP % EÐUVS]u 9s}/Ps uj SC se[^ÐUVS]u CFCPs 趉Fuj SC Fe[^U WVSE} x1ۋO%=XtAw=t,=Htpa=ptdw =ht[L=xtAuqCA %=`t=t=uI=u;_@~u_@1ہ[G@ta@PG]܅t&VEPM Qss  tʋ[uۃu}e[^_ÐUEEEEEEEuuu jEPr/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerU|WVSDž}uh h *P1ۅt>EPURE PURS uSm1]S[==u }*DžEPrV h VH ǃ􋅜p踠h VFOÃW蟠1URV} dE%f=t  NPCPg} 8 )Et;Bt M Eth ='!Sx[^_ÐUE EEEEEEuujEPuÐUWVSDžhSrFي<#8< t[< tW< tS9D(t DPA< t< t< t 9r9< t< ukA4A tǀ u9r9ϊ< t6< t2< t.5DA< t< t < t 9r9GU?t߰эA=<+uuCt<@t\uURE P_1RjPCPBCP<-Ct <@t WuURE P1tQRjPCP/CPURE PLSURE P3ƃ<+uRBt<@t5PURjPPƒ@Pm<-u\BtH<@u'PURjPڃF@PEP1҅u' REPƒЅtt~3~.~ ~1'REPKÃ[^_U,WVSuƅj!jjhSu V, }FEEDžPEPh uWt}uitLƅj!jjhWss uWP谁t[uTu1[^_Ðrcmd: address %s not listed for host %sU,WVSu} qqƅjjjhSWV (j!jjhSWV FDžDžDžPPh hqTVt*tqtLƅj!jjhWss uWPt[u@uqPQh jss1[^_%x.0.%x%02xUWVSEfEffE] }EffPh, hrhrƍFE } u9s C;u9r9uf}h/ VHPCh2 S>tF>uPh6 Va9rփEP:ƃf}tEPh2 V/FPre[^_ÐUVS11ۋM9 B5$| ^ ^ ^ ^ ^ ^ ^ ^ ^ c c c c c c c Y Y Y Y Y Y c c c c c c c c c c c c c c c c c c c c c c c c c c T T T T T T A9t uHA[^ULWVS}j1u ]S;nEj#Smƃ tE#=j.EPmƃj:EPm tt9s E:E.tF,ss,ssBCBCjSEPt<EPV-tGRSQPURh Q7ǃ ~%EPU RWMQhhsEEPURSMQEPURh MQǃ -EPURSMQEPURh MQ赝ǃ ~'EPU RWMQhhEPURMQh EPgǃ ~QEf%EEf%EEf%EURM QWEPhhvUBM9xFKZ$ EN0EEN>}tE EM/M}u<0uE EE Eքt E؊Fu}uE}~EMIVUUU)zUM؍tE̍\9vSURV֚;]wSMQEP贚URM QWEPhUR e[^_ÐUWVS}U~;111r;M}E~C} A;M|M ~19}EA9|[^_UWVS}] U ‰UE1HPE @PIE @B< w ƒЉELJw E8B<w ɉE%uu<vw G w$ , \ H N p 4 p p p , GCXC*E U BEECUU1EEEECEUC ;]U BD(ˆЋU B)Ӊ]vEe[^_ÐUWVS}-tGRSQPURhu QWǃ ~%EPU RWMQhhsEEPURSMQEPURh MQǃ -EPURSMQEPURh MQՓǃ ~'EPU RWMQhhEPURMQh EP臓ǃ ~QEf%EEf%EEf%EURM QWEPhhvUBM9xFKZ$l EN0EEN>}tEԱ EM/M}u<0uEԵ EEԹ Eքt E؊Fu}uE}~EMIVUUU)zUM؍tE̍\9vSURV;]wSMQEPԐURM QWEPhUR e[^_ÐUWVS}U~;111r;M}E~C} A;M|M ~19}EA9|[^_UEU w =w =w ffUEff|%t%%U WVS}5'!R#^;tW3mt%;u蕚ƅtW6lu='!u;e[^_UVSu5'!ۙCÅt9su='!u؍e[^U,WVSƅME AfЉAft˃ u4AT/!QSh\ODžttsDžƅhVP\ƅ C C ƒuq ulhVSRMQ6ǃ V訢0sx?;s7hVSRMQ躽ǃ |V0(}t}t$sstssƅ11ۊN.tGC?.uu0u tnƅڅtSR…tPRPZt D SQ*GRPtss T/!1[^_bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpaU,WVS@-!u+uE PURIjSh.!ujhSYDžVE PURu'<1[^_ÐUWVS@-!u)uEPjSh.!ujhSW1fPhhS ߰у;M^SURUBt t;UBfftuuWRExu/xuB@ u;Uzt2u+zu%ztUBf=t Exu}}t\hSRP߰;Mw>SF0pRڦt/װ;Mv uRURatSu#VEPURPUR7t##URURRP'u1[^_ÐU WVShVu ju ӍC;]wAVURMytaE tZPhVQWǍD;;Ev 4UDWVP^E%:MD1[^_%uU WVS]uKSЀf=t fu-v(E PQ臊ǃtэAsh VE P—e[^_no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid errorUE $\( n1 fL ^ V N F( >@ 6h . &    *LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGCU WVSnXu,=dzuhRQdzt dz8u dz^}} u}eEx\yVS 9~E 8E4Q߅t8u5Pt8uhpPt8uujP]xPLMx}Ex E4~Pt8uxjPVLƃx E}~B}t*jE P]xPLƃxj/E PBLƃu9x \yjE PSqLƆx 9~E~/u F~/t~Ex+] ~SE PW ELEƀx Eu >/u E E 8/tE Ft%E}?~EzPz]Ȉ3kz}E}7~Ez] \E}/~EE}}؋EEe BU . ] }EU1ۋMEtGL}    }E E C~EEE}dEUԉU]؉]E~ En E^ EN }}uu1ۋMlzEt't D}  D}T AC~Ƌ}}uu1ۋE؉EU)UMٍCÅUt-ztH}  H}T ~EEEEE}]܉]E}}\E}~1Ex} EЋE̾1ۉGUЁ}Et  BC~}~E~[^_ÐUVSu;5@}t75@}<}1۹t Iy<}[^ÐU\WVSE}u !}~E}E ~]EL~E~EmUU M }%E EM M UU  ME % }e M M܋ }M䋹  u M    u m#<}EċUUMMEuNu% % % % % ‰% ‰ ‰ ‰1#]ĉ؋u31EE31ڃE ~̎̾  ̞ ̮ 3]}߃m}]UUEE؋MMme u  MmeE  eMM     "  & }ȋE * }؋. } 2 U 6 } : > B F UM J 1[^_ÐUWVSu} =uuHE]VSMffffuEPEPRQUEffEEffCUGȍe[^_ÐU\WVS]=uJ ffSff t; ̎ u ;Ў  ̎ Ў EMmeN E P ]Mmeu䋶R uɉMe}T }UmEE؋V MX ]%Z uҁ\ }]싳^ ] ` u}䋿b }]d ]u؋f uh Mj El UEEU:EMMԋMeԺ)ʋE Eԋ]]ЋMeЉ؉ Eи+EE̋]]ȋ]uԉum en } p umeU r eMMľt 1}Љ}mev M   x  z euu| >uȿ}7L~}̉7~ u ̀ } ̂ ̄ u ̆ ] ; ̈ ̊ ̌ } 7Uȹ ~~ủE}1[^_UWVSM]11ҍ~$At B~~ՃSe[^_U,WVS=u jkU1EE1D=1ۉ$Bt  D)C~F~у} tPEPEPpuKE1}}1ۍFE}4 ؉#‹}8C~u~ȋEe[^_$OpenBSD: sigsetjmp.S,v 1.3 1996/08/19 08:12:34 tholo Exp $L$D$AtjbL$A$Yai qy1ÐT$zt rbT$D$ Zbj rzu@ $$OpenBSD: setjmp.S,v 1.3 1996/08/19 08:12:34 tholo Exp $jYbL$$Yai qyA1ËT$rbT$D$ Zbj rzu@ $$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:12:14 tholo Exp $D$$X`h px1ÐT$D$ Zbj rzu@ $UU u1EBEEEEPuhbU\WVS}Wj}dEMh )ʍUEE]ĉ )ًUUBWjd|zE<] )ٍUBE<]ĉ )ٍUB j]SJu"E<[ )ٍe[^_$OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $?%5%.%#%%%%$$$$$$$noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappndUWVSh9Eu1t}M16# $EFEt9;Mv,A$$$u BA:uE $!Nju vEe[^_ ,UWVS} t E }t UUEEEU2>E $EE$CPVFu%t}te?E 8\} tV?U :MSVZFu't} t/?E 8&}t?U : E E} p}u #h%EPƃ1e[^_UEtEUBEPR_E1U WVSE fE}NLP] ޿ftfuBRhP`/u^FCF $<tr <t<tCCCCF uCfCCTT~ t 8aLP)\t2\@v@SVEPU)9XQhPH)T8[^_ÐU WVS}u 1CwVWЃte[^_UVSjju݃Ã|u SƃS9)e[^UP/!jjTHu =P/!uEPjjFUWVS}U uuFuFЀF EFF]t. 9siWt_f9sRBuH 9s5Wt+\uBu\J@f9sBufuVPzVP [^_ÐU WVSu} f>{u,f~}u%f~u0E4EPWVS0tj{SZ ÃuكWVe[^_ÐUWVSM] 9tf9uDžqf>tgf[u/f]tftf]tfuf>u*&f{u f}utf>uuf>uEPR U Dž9[t ,ti{tC}tFكf]tftf]tfuf;{tjtf;,tX~9sf9rFf ffuEPRUK9E1[^_HOMEU WVS} Ef8~E@ EtG]9s%UBA9sftf/u?u6$uhBu.ϾP聍tW跈uEBH9s9tffA9s9u9sffufe[^_UWVSE PhSURƋE ߃?*[!uf>tj]VRuf[!f[!uf!شff>-u^]tf-شf]uNjE H f]8U J f?)E H 9tf*tf*شffE PRunU ;u0B u %=uE PUR5<2U B u&hEj+PBBP=1[^_UUE 02@'ÐUEf8tu PPP 1UlWVSu M}EffW]SEP.t1G tIf~/tBE%f=@t)f=u.WSEPEuE%f=@u f/fFGWEPwf/t(f}Efftf/uڃ}u,މf/#ff/t WRQVEPe[^_UWVSu }fP/!WEPuEt7SUR5P/!SGЅuG t 1DžDžvG @Gvz.u Ef8.udfBf ^ftffBfuUREPVsuf WURSEPuR҉ƒnG @tPGR"[^_U WVS} GWtPRH PcÅuGt PEu W~J|Iy_‹Ef8t fu+URƃtVEPG4G1ue[^_U WVSu] ;]=?tX=*t=[tQ;]tEPSVt fu1fuꐐ1ftf;!%t,'f;-uf9w f;Kw f9uf]u9 놐f9tf>%e[^_U WVS}Wt6G4Ktt Pswe[^_.UVSEu f8uJfSPF @u Pl PF Ѝ[^ÐU WVS} uSuF @uWSUw WSF$Ѝ[^_ÐU WVS} uSuXF @uWSv WSF(Ѝ[^_ÐUUM 9tfu1UMU BuUVSuxWÅt3V u؍e[^offonsecurelocalrtsctssoftcarmdmbufwindowUVS= uu 1+$ 5 hSR4tуj Su9 BHJȅ}R>+ tu뙐$ Dt CDuo<#g  SyÉ ;u  9SGÉ ;u Sà  ;jhwLS uSDt % _jh{LSuSDt  +jh~LSuSDt  jhLSpuSDt  jhLS<uSDt  jhLSuSDt  ^jhLSuSDt  .jhLSu.{=u(S SaÃ;W= #t;#uC t t ;u  j S Åt e[^ÐUVSM1G t t u5 A t t uWA t t tAAt6"uu 9\uy"uACtу#u #C[^Uj=u t@1r/etc/ttysU u!hPhP u1PU u  P?)% /dev/tty ULWVSjhh 9t*ܟ }tƃEP*E뮐ܟ td trEPEPEPEP5 RhW5 cÃ5 t ܟ Eܣ E EPEPh h hW5 oà ܟ d}EPEP}аэAPURhW5 ܟ MQEtucuVu=u ܟ 1E0u5 hV'u 1u؃j VBuC BHJȅ}R u>+F<:tt< j8 }uܟ X= uh 7}t9EPEP}эAPURhW5 ;à HM QhW]SEPEP߰эAPShW5 Ã0uVu腿uE0u؃hW]SUhWSMAhWSÃ?}t=j EPSZ#Uԃ:9 UB8E MA'j t[hWEPjÃ}t}tURSpܟ CPEЃhW]SM}t}tURPChWSըMAhWEP辨à j EPS2"Uԃ9:UB}t}u ;E 1ۃ}E̋MA U̍9tNM؊<,ut/1#t< t< ut!uE؋E9ue[^_BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksUWVSE]h]ǃ?j EPWzuMtyu}MtXGt)t_iKt/akt' gt Rmt+IE]@UE]AE]-@ Wh]F@9~jh^!؃ށ*Wh,^E]؃ ؃URPhI^jh DUvE  e[^_.UWVS] tP/! j( ƃ EF U V$tV$MQ=vEPPVjh_VE\f@2EEU:MװэAPRVfC2USK@KF$PSVv fC4 fufC4}t EC]C}u]UZ]EEM9\}t}~EPURVo Ejh_V t>MHf@4 F$ujjh_`F}N$>P/!EPNUR vV1e[^_ÐU WVSu F&fF$ǃGP^@SEpD j/Sƒ t+9u{t!BװэyQRS f~&UBFFF,B e[^_ÐU WVSu1t9f{2|$ڋCuCÃRf{2}߃SFt P7 Ft PvvF$u(v%1t=P/!vF$utV2=P/! V1e[^_..U WVS}G% wV8fF8ujVW fF4lN4ucAfwZjVW fF4fG$jjh_^F }P/!FfF4]N6TftG$@tCG 9C,t;C6ts GtP GfC4GtatW$P Gt=jSW tRP/!CK6wt?F@Fvu*jWiGuG% o1wGvPFf~2uLG$tv-#t uw"VW|F8ftfuVjVWfF4fu7G$u1jjh_\F }P/!FfF4N6fF8OFP$@|/uT /BF&@PF@PRKpPDf~2uV1P/!V$Gf~2u*G$t vxw!fF6tDG$u.v g!tP/!v ?P/!.v )'u G$uhc!t O% ~tfF47e[^_UUw E fP81P/!ÐU WVS}] ttP/!7P/!G% F4f uFfGt PVu O%f~2uF8/tG$tSW\GMjjh_wZƃ|.SW0GV uVG1e[^_ÐUtG}t} u P/!UBMI6EP/!EUREE EEH$M@|/uMUB$tMM̋BE̋U/EEMy+}UB2@EEEEEMA$ u#~.u~ F%=.FPFPEPKÃt*F9UzMDPRtL5P/!t SEPURMfA4EH% 5P/!1UB9tEB$tEE̋My+}FE=EfC2UCfFEfC$~uK6}t)}tfC4 MKfC4 UBC}t}t(F<t!tC@MA$tCCfC4 eE@$t#CCC&@PC@PURK@KjSEPfS4}~BfvfuMC}u ]] UZ]E}t(MQ ƃEP }tURMQE@$tU;Pt}uM̋M}tk} t }Efx2uUB$uHru4MA$u+hctEf@4UJ% }uZ} MfA4S{EPURMfA4EH% P/!?|Uz t}~MQEPR|EEe[^_ÐUlWVSE} @$]ڨu_E$Ft>эQ9vӃ>uC[^_ÐUlWVSEu ]]@$t 1} jjvPÃ}lEPSt3E9F,uE9F(tP/!Sǃ5P/!}} S5P/!e[^_ : xxswufsswap ,rwrqroUWVS5 hh u1hLrPܺhOrV t8#thOrj hOrju‰ RrC ֿUr1t \rtXr hOrj &j SPx;:= hOrjj SV9:=$  6harP( 8#harj harj harj  $ harjj SV9:= harj?tBj SP趹;=:4,=!$ h5 S.EherS pmrǹUrǹRrǹherjRtPuʸgrǹtjrǹ= 1t jO[^_ÐU= u t u1 ÐUVSut-"V 5 u 3u1e[^ÐUS]It.#S5 u u1]/etc/fstabrUh tPuEPhwJuLE EtE%f=tP/!O*hwhwּ t 5P/!:1ÐU tP fstab: : U4WE`xEEwE EhxEulj}IMEkxEjEPju}UEPu uDRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxUWVSEEyuEPEPq}1xhh, z4 E܋MC D ]܉D]؍uԉHuЉLủPuĉTuXu\u`uduhuluputuxu|u@uu9s=4 t1<|t-<:t)֐U܍BEA9sBt E܊<|t<:u܋EWhyu{hH hyu{DPhyu{~uܿy u  u܅tz u j:hzukot Shzu0tU؉T HShzuEԣ\ LVhzu~EУX PPhzu~Ẹ` DShzuz ~hu'f0 (EPhzup~1҃tUf0 TVh zuE~uX \ Eģd XPh#zu ~ud ` Eh \Sh&zu}tUft `Vh)zu}tUfv dPh,zuy}1҃tUfx hSh/zuN}1҃tUfz lVh2zu#}1҃tU| pPh5zu|1҃tU tSh8zu| tU xVh;zu| tU >zfE@zEAzfECzEDzfEFzEGzfEIzEJzfELzEE` EaEEEEEE|V@Pu{u EEPEPu{EC EPEPu{1҃tUSt+EPEPu{u E1sC C EPuVuU{tUS u0DPVuVw~h uC EEE}pfEf MzfEOzE E0EEuV@Puz1҃tUE}4~, WEV WEVu, ([^_ÐU WVSu] ߃;t3Vt;uDu1) V_e[^_UWVS}E]Cjj}WjjS  }t} tyuLƃupjjWVjSǃ uP/!VP/!9EHPVE PUE DV^E@ P/!1e[^_./UWS]t;uĥ \A߰эT B9vz/u H9v8/t9u8/uĥ ^fĥ GJ9vz/u)ЍXwSRhĥ ĥ P/!?1e[_U(EUBEBB EPRj} }tEE$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $USU ]tEBEB4ES1tEPuuts]ÐUEPEPjuEÐUEPEPjuEÐUEP$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $UEtu P$P/!$OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $UE Phu=2̀ø1̀̀r̀r̀r<̀r$̀rx9̀rd̀rP̀r<̀r(̀r`̀rR̀rS̀r̀r̀r̀r̀r8̀rt̀r`7̀rL̀r8̀r$̀r̀r̀rj̀r ̀r̀rùrd̀r'̀rpQ̀r\ÒrH/̀r4̀r +̀r {̀r|̀r#̀r ̀r)̀r̀r̀r"̀rl ̀rX̀r$OpenBSD: sigsuspend.S,v 1.3 1998/11/20 11:18:30 d Exp $D$D$òr1$OpenBSD: Ovfork.S,v 1.3 1998/11/20 11:18:29 d Exp $YB̀rJ!P/!U@WVUE ut} Mu$tt 6t-Vht,Vht, Vht,R P/!e^_$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $UWVS}@M Awt 8tAu)[^_$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $UWVS} Ep@A8t u됐)[^_$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $UVSMȩ ~(gfffK))0 у ޺gfff))0 [^libcUnknown signal: U WVS] jhkAƃ}w2hE4HPjVPS ƃ^hhphjVPSƃ߰Ѹ)PEPPS V؍e[^_$OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $Uhԩ u uÐUWVSE}u u1Z@M 9tAuu 12p@M A9uu1@ u֐[^_$OpenBSD: setenv.c,v 1.3 1998/02/02 22:44:53 millert Exp $UWVSu] ;=uC߰IMEPV0Et>}wUװэA;EUCEuC=H/!Eܩ ?tE?ut)MPRǃ=H/!Eܩ }PǃtrEPW5H/!踌=H/!H/!UDUu EMt<=u)u}UD:Pr‹E H/!uREEMFS E}Ft<=uE=EM }CEu1e[^_ÐUVSu]UH/!BuSVbuӍe[^U1ÐUdW}fE}}эAEEEhEEEPu EP=w}UWVSEu }EލEX]EEEPuHt +]1e[^_UVSu~(uP/!tV臹F ujjjvF(Ѓu uGFPVTN t!N)ڃ~0t&N<)tt +Nڍe[^ÐUuKUSE8eupX ti;EuaCt PCt PxCt PeCE| uHEUB=w RVS5ƋE>#tj#V]Ãt5 hVQÃhC}C< t< thSƃtFj WS肓U9: = Džt@;t9< t+< t' shS蛑Ãt Ct;u e[^_r/etc/networksU uh$h&蓘 P;E t Xuʉ]u1U%Et.t Xuu EE]G~UUЋEE9EEEE؃uMEPɾ5E+EU܍EP"EuMQ茾EEȉډUU܉USjQEȉEfEUԉUЃE9nMЀyHA 2AA fE‰˃TUĉŰMJUЋBMĉACUЃ\PREPrCUCDEEMĉA UBTPSMQ> EЀxTtBT$EEMAȃ|fEvf}jU‹Ef9P t/f}JMA=ŰBMĉABAAuЃEu1MăMG5%UЅBt>t XuƉ]u1%UЅB>t XttktKcEMĉA SVPFMUĉJ>uEPjQWUU&SVMQUEĉPSVR]GJEMĉEċUEЋEE9EMQûEE9ErUMEUR菻1e[^_ÐUusgethostby*.getanswer: asked for "%s", got "%s"-_/UVSu?C<v5C<v.C< v'Ph_u.u>.u1 Fue[^Ðgethostby*.getanswer: asked for "%s %s %s", got type "%s"ULWVSDžE| UM } t }t} UBfȉBf$ u ftT/!RQVPURà |uT/!{t}t}u1Ӌ| )EDž  Dž  DžDžJ;VQEPà &u ރVVЉV؃}t } hQVPUREà cQIދӋډ)؉;PR]| ؉} hRVQEPGà eRKދ;)P ]ډ)U;}tCWPMQPjPEPhФj%蛷ރ0 } t"}}R^tMQVPURà |yu^ރu | ) s)5| ]t%5| h0j%Mރ; usu(| װʉ)P)‰=% r [l ru?;SRVo)ރu~;s %.!t&~}uQh | =| uG};^EPY| ؉)A-! tPPVT/!T/!1[^_ÐUVSuh4|X@-!u/ujV )A-! tjV4ÃujV Ãh4&X؍e[^bfUWVSu@-!u跂uE PVq } t } t*DžGDž3T/!P/!/1NT/!1<U  j.V˯uVxtD>~.h, VE PohVh$ 謯# Dž$ Dž| | $    ,   A-! tPPSe T/!Du9.uA9uy.!DDtj:V蓮u >:>~.h, VU RWhVh$ 蔮# Dž$ Dž| | $    ,   T/!&DDu <:t<.uA9uy.;jSh.!)kujhSͭ1Dž%PЃPhSVÃNy١@CjRh.!IhujhPDžDžT#tj#V迧Ãth VwÃdCh, Vj~EWh, VjA-! t$h, h, zE E9  ;E ,     C< t< t|  փh SvÃt@Ct:2< t+< t' sh SvÃt CtuA-! t}EEPEPh| T/!| e[^_ÐUS]A-! tjSu jS]ÐU WVS}j#^;tW3YPt-;u%ƅtE 9FuW6,Pue[^_ÐU WVS} u= 5 jcÅt9suWEPC0vNun؍e[^_ UWVSu|    E EL ǁ}س Eh VtÃCUEEREVUC< t< tރhxVatÃt; uEC| u 5| !VP膳t  s7ރ}<8< t3< t/< * sh SsÃtCtu=| tE| 1e[^_%u.%u.%u.%uhosts.byaddrUWVS]1=t uht 贬u 1CPCPCPPh]SN س t Pس EPhس ߰эAPSh 5t 諯 u5س ƅu T/!e[^_hosts.bynameU WVS]1߰эA=w=t uht 贫u1vܳ t PFܳ EPhܳ ߰эAPSh5t ֮ u5ܳ ƅu T/!e[^_ÐUVSu j]Su8_ع FIyFFjVP_e[^ÐU WVSEu }xucx u]@@ X;tGȃ)B9} *щ)63N;ue[^_ÐUiÐUlWVSEU1E 9E1.!؍?EMGEBE9s/#.!9.!t]Ӻ.!F;us #B9uEf4}u~ Dy9}}}U;} |}t_} 9}}WuNE@E|;uL+f9A~%yfAf9}T__D__NyҋEE} 9|[^_%s: US] 58hh*tuSh+hhU*u&Ujuu uCUjjujC|qhOH>+пƿybJ4޾ȾUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0UVSu>u1FjBÃt.VEthCh1S苞e[^ÐUVSuht&V3譫u  [u1e[^UVS5ht!^6V ޅuhe[^U WVST ` ̽ T tI:tDϽ װQSRY`=T ˃`VtB:t=װQSRX`X~˃ `@`FBF B FBBVtB:t=װQSRRX`X~˃ `@VtE:t@װQSRW`X~˃`@V t1:t,װQSRW`X `@ `V$P$ e[^_: UWVS}M EMEE9tUZ]<:uEzuMhEPAh]]SAGhSAƃ&j ]SVU9 :GhEPYAƃj SVкU9:G } hEPAGhEP@ƃ toj SVjU9tY:uT=M=~FGhEP@ƃt)j SViU9t:u== G$GGG$h]S>@Gh]S*@GhS@G `th=dt @tG u `@G u `@ G `@tG`@tG`@ tG 1e[^_master.passwd.bynamepasswd.bynameU EPEPEPEP5 R Jt5R5 Ã5 Pt5  Et P%EE裐 E죘 oEPEPh h rJt5R5 :à + EPEPEPtu Uc:ZEPEPװэAPRJt5R5 à u|p7EPEPװэAPRJt5R5 襡 5p迖ptEP蚖|uh uQurE ERhT ^-T 3 E2j]EPh Q]ԍE@P> =ltT +u^Pt@t$ 9 P T @P<po-8PZ@uOPsu}]Et8t P[VWS u@P21e[^___YP!+U0VSEuFE1j]EPh=P]]C| jEPVRB Ѓt| jURSP@ Ѕt1e[^U VS66ơtt9< u 95@ = u'h nu< @ aEPEPEPEPh55 6 u*uϓ< 5@ t< 5@ t1e[^ÐU,WVS=| u5 u 1hsE IT +t-_= uh fT @t <@tN- tPޒ h h }эAPMQ- tP薒 }uT PEPEPEP7E܃uE:Ut:th h װэAPRJt5R5  t Pؑ  tP貑 T BUh h װэAPRJt5R5 ( t% t PC +5 h 5 L RhT 5T ftpPtb@uPP}u]Et8t PWVSeu@PMQT 5T 訝u== u| P@| ` }^ = t;E2j]EPh YK]E@P t= u| P@| [`1E1}֍F~11P]EPEPJ]EpPsÃ= u| P@| 1tT e[^_%umaster.passwd.byuidpasswd.byuidULWVS=| u}u 1pEEPh]SK8 QT +t-w= uh 薕 FT @t <@tfE tP h h }эAPEPhKA tP讍 }uT PEPEPEPOEȃuE*U܅t:th h װэAPRJt5R5 ٗ  t P  tPʌ T BU܃h h װэAPRJt5R5 @ t% t P[ 5 h 5 G RhT # 5T ~tpPtb@uPPu}܍]E܅t8t PVWS}u@PE9\ u@= u| P@| `T }n = t;E2j]EPh F]ЍE@P+ l= u| P@| `1gE3EẼj]EPEP F]ЍE@Pà = u| P@| 1tT e[^_ÐUE  t P `ÐUjÐU | tP@|  t P腉 ;`/etc/pwd.db/etc/spwd.db%s: %mUS l+Et9jjjjS荤| t '=D uShRj'D 1]ÐUWVS| j]SuP@ Ѓ߅t 1BuG;H vKH P5L ňu&L t PTL 1L L T FCuX FCujh\ V~Cjh` VkCjhd VXCh FCul FCup FCut FCujhx VC+E9Gvjh VB  e[^_$OpenBSD: getnetgrent.c,v 1.9 2000/08/24 17:04:02 deraadt Exp $*netgroup: %mUSj kÃuhj(CCjP8uhj(؋]ÐUS]SB9CuEBCP3džu(t PYhjU(KE C]ÐUVSu} t1;^s4C;^r6Ve[^U WVSu} 1;^s$W4uC;^r1e[^_U WVSE8t.Du uGtDu tt<;E t4Du# tFt;E tDu uEt=;E tKDu} uCt;E t%Du t;E tE1YCE)Fu ~;VÃuhj&E PWSE D1ۋEe[^_UVSujÃÃuhj?&Sj,V~tXCPj,Vht0CPj)VRt3Ct PЃt P较S貃1e[^netgroup: db getnetgroupnetgroup.byusernetgroup.byhostU,WVSE= } ֍^S貂NJEGVU RP躍}MY  jEPQRB Ѓt Nt9GW߂u)M hj$h<W蛂}tv}2t  }1t )}3tEE E!EPEP} эAPU RMQEPu 1e[^_netgroup: Syntax error `%s'U WVS]} 8#t*PHtPDu t݋3(u1e[^_netgroup: Cycle in group `%s'UWVS]SE PtS胀Sha:SE Pj1EPSEP txEE}u]WVS=ttO吃t/t؃u 3EP E벐uE PEP-똍e[^_U WVSUu }]ttRPu5tCtVPیutCtWP迌t1e[^_ÐU,WVS]}uSE PQtS!Sh8)SE Pgj1EPSEP EEEEEEEEEPEPEP ԃtsuuVWEPËEt Pq~E@t P[~E@t PE~u7~`&VWEPuE PEP 8u}u}1e[^_%s.%sU WVS}u EP9}ÃuhjЅt>tPЅt?tPhEPS؍e[^_(%s,%s,%s)UUBu=PBu=Pu=Ph>u uRU WVS] Ut߰эqtװ)FPRSuEPWu@ÃW|1tEe[^_ ,U WVS]}t-WSEPEPVƃuKWSjEP@ƃ1u0WjEPEP"ƃuWjjEP ƃtq} эy<9t{,u<tPhyuCV{!E PS{!ÃuV{1e[^_ÐUaB |t Po{@t PW{@t P?{5.{|u tP@ /etc/netgroup.db+USE=|t5= u!jjjjh3 tj1EPhj!uEPf umzub!uhj`PSu|jS]ÐU塀t8EPE PE@ 1UWVS} ]uE= u2jjjjh- uEPy3j1EPhj uEPOuXy t u1j3VW t$j2VSEPu t Au8ƃjSWEPPVuÃjV1e[^_/UWVSE E}t$EuP/!EEEPwEuWME/)xxPEPEP3pP7xE}P/!"'ExxHEx@EEPgwptpE.p@]ShEEEEP/!EEPpPh}]9]u 9}E;tr5EEPpPzw!pEEtE.EE.EEpP}EEPE0dE/EDž|9]u$EPƃk9>uEPЌƃG~.u~ tۋF%=.t̃F@PEPFP1EPpPW t$|u P/!|P/!y9]o9}fF]+]}t @9| f9}\}x+}EEPEPuEÉ]ExW)SEP0]}u ME/F)EPEPFP0EPE E=P/!u|P/!u P/!}tEPtptpPt}t EPl1X[^_UWS]u- t Pt  1V߰эA Qs t SP1P/! e[_ÐUVSu ]Ut!B<:uAB:uu9uߊ<@u1&:ut<:ulj9uB1:@t[^ÐUjjuju EPu %s.dbtcUlWVS]} ~ vDž} twURPuc Prƃ5 VXDž Hh7rƃDž;PDž}|(jjjUR1{Dž#1hhSnjjjjS襍0EPPR}QAЃ}VqӍ{SqƃSV-|P‹BЃ }M 9E0yjj2\EDž+ u'9y\9rv))SVpu9t VdpP/! ;EPx*9!hQEPxÃtURjxEDžuR<#|EPV7d} tVU R FDžuC9u$V#o.@(DžoÍPMAt C:uC)jQPMQPRW Nj tZ})tURvV \Du /Du<:t <#t = t|\u | \u% #P׃6 FBt<:t<\u1tg:F򐐃P5 ?Ãu. t%@ @wPN 닐Dx΍ABt<|t<:ujjVjU RSEPÍC w7C[^_ÐUWVSj=u uÃu jdJgEuP/! }EdU :^u$\wC :A<w81BEMI|CNt  6 . & :C CBMIMuG+uFdPUR,fu} EPeEEd<:tt<^C<:tB+EX}t4PUReu}EPCeEEU؍e[^_ÐU WVSj=u uǃu jdndÃuP/! Ed؊:tMtIG@Mu3)ރFdPSdutSd뱉Edр:tu@)؍p}t*PSdupSBdbËEe[^_ÐUVSj#u uu s90uA:tF>:u^FPup^e[^UVSUփ}t Azu$)ĉE $ED$tABu5H/!Sue[^ÐUVSUփ}t Azu$)ĉE $ED$tABu2Sue[^ÐUVSUփ}t Azu$)ĉE $ED$tABuSue[^ÐU5H/!u uPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shU<WVSDž}AE85j/EP_tEDž,hbƒuװэA$)ĉRPp:uװэq}эy7=vRDžDžDžDžjPjgVSR/WDPEPmD 5H/!E PPbP/!=$ZPZZZ1ҋM E 8t BE <u$)ĉ$*D$PCPQ5H/!Sh-TDžh Pbƒqt P/! =P/!u P/![^_UEPu uDt:эA@w$} tU :tװэA@v UM]EUUЃMQVt U,]EuUŰM J}UB`@M؋]SQ]ShLMQhjr`Љǃ t1Eԃ}thEp`]E@hUuǃEU@P[Mu %U2uP fMMEU@PZMu#U2uPeMMShLBue[^_$OpenBSD: fork.S,v 1.2 1996/08/19 08:13:32 tholo Exp $ìrJ!$OpenBSD: strrchr.S,v 1.2 1996/08/19 08:13:22 tholo Exp $$OpenBSD: rindex.S,v 1.2 1996/08/19 08:13:10 tholo Exp $ST$L$ 18uBu[$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $UWVS}u11Ɛ@M A9uu1@ u֐[^_$OpenBSD: strlcpy.c,v 1.4 1999/05/01 18:56:41 millert Exp $UWVS} u]tNtBCtIuutBu)B[^_$OpenBSD: bcmp.S,v 1.2 1996/08/19 08:12:52 tholo Exp $WV|$ t$1L$u L$t@^_ULWVSE DžDžDžDž DtC]KA u~V/quEDu뚐%Dž1x$                                                @ @ @ @ @ @ @ @ @ @                      x                          X     , {  -        u~Vn E9 MIB?;lu}\CЉeDžTDžIDž<Dž&Dž<VPP& @@1 Dž<DžtEUBftE]C0EUBe DtDžTDž u~Vl @uSE=UBpr~A EPlU Du$H \  $Lu Džt]1MY;s*)Qlt؅<+EXkMQSjEuvt 4u Džt]1ۍE<8t6CMApqBtԃQSktąt}EEpU ǀ<:t^]KFtIExPjt;!M<8tIFu+bu DžtQ1ېuDu+CFPVAtЅуV0uEFtt}uEPUREPU RjWP9}t ET/!$}tT/!}t T/!e[^_%.*s.%.*sU WVS]} @-!u u T/!uH߰эyt.<.u(w WPSƄ/)#WhShh%P uuuuV [^_HOSTALIASESrUWVSA-!h&z:#Azrh&S ǃWjWZ| uHB=RSVB0ـDuC;Dt;EPQsup CDu;tus{tCDuʐF>t DthSh 5 W>R +PW ÃWR1[^_UU h%PRuUWVSu}}t}w} ?EV!V0tF@9t R6F0FF^ }v6\}t_EPEPV; Ãu E }} uYW5E uCEE9tǃW5E } u!f^ FFCFFWˀ;}t}uf^ E F~ttF߉~~ F'!`IEe[^_UlWVS}$u(@-!uu T/! j Wfx-!ffE$WˆW@-!$ˆWg_ }Em} }t`}VMEPEEPVSu *)ƃSEPTSEEP@ fG}}EPEPVSEP蟕 ÃSj SEPߙSjSjÙfG E 9|nG _ SEP蕙_SEP脙_Sj莙_SEPe_ }tEPSEP]fG )؍e[^_ U WVSE UfUfEUft/}utEfUfɉșfuE[^_ÐEنUWVS|É ɉ%,R)f f c|  f H|  f hy%Pj f  ؉f1ffu{f1fftf= {ú&) ))Ѝ) t\5 ,fu1ۉf1fuft$ ,fCfw1}f1f4~fufw@ѾuhPjf fhjh ”= Ǵ= f=jfje[^_U WVSjh xf=h/uw 9 ~= u z à h=/u~19= E= y K%EIuKf f hh f3 %P Pf3 f j%e[^_/&fLOCALDOMAINr/etc/resolv.confbf;#domain lookupsearchnameserver%dsortlistoptionsconfRES_OPTIONSenvUWVSDžDžDžDž=8-!u 8-!=<-!u <-!@-!u @-!L-!I-!fJ-!5H-!H-!'!jVS9D-!.!$ .!.!jhc/h.!%-87Dž|-!he/f0phP|R,.!Dž|p |-!-!Dž-!ap< t< upDž+tp;DžDžppt4-!s< upppt < t< t< u⋅phq/hs/C jh/h.!+ƅ B= RpQS7h/Sp ޅtJ jh/Sn9< t<  ppp< t< tꋍp< hQh-!*.!h/h-!Vp tDžjh/V8< t< 1ۃjh.!v pDž.!F< t< t<,u(t.=-!uShS *u8j.S!pt h@P|P;!.!|-!-!-!-!1|p=-!tp9.uFpp?u㋅|p"j.pR_ @pN-!s*t A-!,h/#pth/Q* @-!1X[^_ndots:debuginet6U WVS];C< t< tjh=S9.uf{j EPWƃM9tyD$td.!$Ј.!H .!w E=w]w Mv1*  ƃ} tffU 2[^_@ATAΉ};7u%WtGt9Su9tEEE8}ȋCtt UUuI}uu{uC} WS(Eߋu󥐋}EA=A!ߋuuK9tFC}W9tGtC uV9tFtu}C{u UBtC{ u MAtC }uEPu VS?EP} WEPSE}j}tUBtEt@uEM9Eu}u EEA=Aߋuuu9Cs}O9tGtC }W9t}}GtjtubutK{ u UBtC EPM QuVSE}}}tUBtEt@uMM9'EtE}ut u1%EEt P}Ex[^_fbfU WVS1EPEPIt 1O@-!uujhG](j]Sh.!}ujhGSL1ur؀}tftt}uE PjWP=}tUT/!'}tT/!}t T/!e[^_%s.%sUWVS]u @-!uu T/!uL߰эywZt'y<.uWSQƄ/VN߰҉эD =vT/!(VSh_PͨuQ[^_UVS]ދ[Ft PVu؍e[^UEPu uXÐsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console U< WVSutVhaj#i84P/!u 54WDvDžVh6aRSA ;|)W軔Ph;aPS4 ;| H), t=0u80t250hEaRSbA;|H),t3vPhHaPS'A;|H)=0t&~:C~  CH<%u8U zmu/E PPhEaWV@ 9|G) ~FOE U uuPRSi;| HÉߍ), tJ)+DžMaDžjPjh= uj5,50jWR5(jWP5(}|,tsjjhOa>^ƃ|Yj>RX))߉Dž\aDžjPVVX[^_ÐU(tP3( /dev/logUWS=(u/jjj^(jjPx>=(tv um}fEjEjghe]EP@EjjS5(à u5(g(  x[_UEUt0E ,tu4,t ÐU5(( ÐUU8t8UE EUB EjjEPujRt1$OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $US]= ,!uEP}ut ,!h ,!/|t1]$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $US]= ,!uhh ,!pt  ,!1]$OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $UWVSu]EPo Et%EU9B|M Mt 9A}}u@jE}}1҉ t}E UBtPMA}G tPG S3UBt+MQ}G uwG1EXUPSu pMquq  }t-Vwt1wVGVUBzEMAe[^_ÐU WVS= upS ESE[EPn t?E9Cu.EPsus} MuC9E~u1e[^_yp_match: clnt_callUtOэA@w9} t3U :t+װэA@w}t}t }~ 4UMEEЃURVqt Vh ,!EPEPMQEPU Rw thEM@PUuuwM1uPEMuzw1X,EEuU UMMEEEEE}G`HE؋URP]ShEPhjw`Љǃ t.Eԃ}thVjEp`E@huoǃEU@PMu aU2uPMMVh ,!+ u*E0U2MQEPU R* uShuve[^_yp_next: clnt_callULWVSuEtN>tIэA@w3} t-U :t%װэA@w}t }~ U ME$UM؉MȃEPVot Y,UEu܋M MUUMM}}؋G`HEЋURP]ShLEPhjw`Љǃ t/Ẽ}thmEp`ñE@hOulǃEU@PzMu %U2uPsMMEU$@P0M u#U$2uP+M M$ShLuse[^_$OpenBSD: strftime.c,v 1.7 2000/09/06 23:05:11 millert Exp $NqJqFqBq>q:q6q2q.q*q&q"qqq qq>qqppppppppppppppppppp{prpipZpWpTp EPURM Aw oqP] Eu EPURM A w oqP! Eu EPURM A w oqP Eu EPURhqE HlQ)Sl EuE MQEPURM Q5,pzE uFE8  URMQEPU Rhip;E uMQEPhqU r EuMQEPhqU r EuMQEPURM QhqE u\EPURhqM q\Eu5EPURhqM Y*)R)R9u QEuURMQhqU B@PEuMQEPhqU rEuMQEPhqU Z*)R)R9u QdEu=URMQhqE p<EuURMQhqU B@PEuMQEPhq#EuURMQE x ~4p0pPEuURMQEPU RhqE udMQEPURM QhqE u8EPURhqM 19Eu}ԋu EP讉Phq]S萐EPURSEuMQEPURM QhrpE uEPURhqEutMQEPhqU BZ)ù$Iэ )PSEu,MQEPhqU BuP"EuM)ٸ$IӍ)@7M ylAEQUM MuFU9]}Ou>Q)ڍ9u)ٍ9u EnEmu=Q)ڍ9u)ٍ9u EnEmEM)$I)))Y$ImM)Ѝ))щ)ȃ}E9EG4u U ztuM y u5}VuURMQhqP{}guBEURMQhqQ))W<5URMQhqW!EPURMQE Phq;E uURMQhqU BJtX)˺$I )X$I)QEuqMQEPhqU rpEuIMQEPURM Q5$p~E uEEPEPURM Q5(pKE }uEEċuFU;MEPURhqE HlQ))QEusURMQhqU BlPnEuGM A(t"URMQPyEuU B uF MQURи46EuFM y Y$} rrURMQPE)ӋUREPhq) ))Í QgE uCURMQEPU R58pzE uM9MtUMEFu>`Ee[^_ÐUWVS}uuu ]SsVWSe[^_USMU ]B9s Au[$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $U,WVS}]E CDu-u EE+u Ctu0u>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed UWVSu@-!uۣ] EE .!MQt utdMf%P4DA4hĊV[ FPVЅ|  Vj %|.!tt.FHNȅ};F| ;Vj;{.!t hVb[E@thVH[UBthV.[MAthV[E@thVZUBth VZMA@thVZE@ thVZUBth#VZ.!ttMAf%Ph'VbZ UBf%Ph2VCZ MAf%Ph<V$Z UB f%PhGVZ.!t t&FHNȅ|  Vj 5zUBfm.!tthSVYOH.!tthbVuY;.!ttVM QEPSÃ0hPSRMQ0 qÅg;K.!tt&S5%PPhfVX0; .!tt&SH5%PmPhrVX0.!tt(FPVЅ|  Vj xO;hVj MAPSE PQà tt;w\hVj@UBPSM QRà tE;w-hVhUB PSM QRà thVWh΋VW[^_ÐUu huÐU WVSU ]hVEPEPR.ǃ }1Iu/CPSЅ};C| .Sj.]w SVxE[^_ÐUuhu uS.U WVS]EPSEPEPu .ƅ|!߰эQt|.t;M|1fEe[^_UVShVhu unà tuVw1[^ %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) UWVS}@-!u觛uT/!1hShE PWFǃ tЃURQuW}0(Wh0Wu0ÃWK0Љ$.!ttSh`MQrS.!ttV-PheEPJS (RPheMQ)S (Hen$T@hDd@Ht j,PW$u ,5PheuV{ $,y5ƃGW-%PSVhiEPP P$BUBHJȅ};B| u EPj pURM QS $>EPhRr7G 9PhSt5UBHJȅ};B| u\EPj\ZpGMApq} ;A| t MuVRp ~9aUBHJȅ};B|u"EPj"o9 7GURh2q 9Ph?t5MApq};A| U\MQj\FoGuFHNȅ} ;F| t uEPR o ~9aUBHJȅu;BlEPj"n (  URh&phMQ)N uFPVЅ};F| M uVj RnEPU RWǃMApq};A|U MQj muVE PW6ǃTURhȒToW*ÃSh̒MQHMW)ÃSPShݒuV!MW)ÃSPShVL$W)ÃSnPSh VL$W)ÃSJPShVL0& WG)%Ph7EPLURM QLW)%Ph7uV_LVE PWǃUBHJȅ};B|u EPj rlURM Q$>EPhm7G 9Pht5UBHJȅ};B| u\EPj\kGMApq} ;A| t MuVRk ~9aUBHJȅ};B|u"l EPj"FkS UBHJȅ};B| u EPj k$:9 MApq};A| U"MQj"j7G 9PhOt5uFPVЅ};F| M\uVj\VjGMApq} ;A| t MuVRj ~9aUBHJȅ};B|u"EPj"i9UBHJȅ};B| u EPj i9jW$R'PheMQ$̵44444444̵44444444444444444444̵44444444̵4444444)U)‹E)ЍU48+u)U)‹E)Ѝ)1C2$L$000000000000000$0000000000000$000000000000000$U E  U ADuADtDt ADuE[^_ÐU\WVS]EEEEEEEE]߰э| EP]SEEPSƃ UMu-uu UUu }u}u ]]u 1E8-u E@EE8+u@EU ]]m]m]m]]m]m]mDt"]DBЉEEUDuU:.uGBEB Dt0BEEUDtUTЉUE]UE܉ÁÀU Du?]m]m9sBEDu9rEDt:U]m]m9$ BEDt9r9}UR%EكU  BEDu9rEDt*U9 BEDt9r9}UREۃU  BEDu9rEDt&U9s3 BEDt9r9}sUR5EڋE UوPUۈPUڈPUPÜPUԈPUPUPUȈP UЈP UP UP UĈP PXe[^_?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smUJyA}} +E@E? ‹u;ur;u sEE +E9E|FP}}+uuE[^_ÐUWVS]} }EEEE}t@M MECt7MM9tEM9uMMOEC։Å}tiEPMQEPCP]|(W;U z 3CN}tE9EsM9EEG.t˃\u3Ct;}s(G3Cu܉)ЍHu1>v}t)M 2;}r}t E G+} e[^_ÐUVSu] 𐐐9s!@tʁt t@9w)[^ÐUU|ʡDtDHUWVSEEuEEفttZKx4<.tv<\uFPFtEPGd 9EuLKyFu ?uE+E I.t-? Ë} Gx>u E )EEEE9E@e[^_ÐUSM.AtYA.tH.t .tuBv2Bv*BЃ v"1+BvBv BЃ v-uމЉڅu[ÐUE8*uP.u u PSÐUSM1ۀ9uMAt3B߃]w0$1 \uAtB߃]wuރ.u݃.t1 Q]ÐUU ߃]v1 BuÐUEff@ ÐUU B B B UM UfQÐUMU BBJUUBЃ wBBU WVSu} E<.<+t} 9wVWu; P/!1e[^_%xU|WVS]1҉߉UEЉEMMM}UME)¸)} \E}~EEEEEU<u}u UE0E*}t!}tM9M~ UMUMEE}~}t}tM9M~ EUEU}t }E]E}t&U9U|E9E}9M:C~}t:C}uT}uN}t}uB}u9+E.)RSE Pt߰э\ (UthS=ÃE}I}tEEu:CC+];]wMQ} W`9E P/!1x[^_%d.%d.%d.%dUE PE PE PEPhjh U?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~UULDP  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UUDPUS]jEP} tEE]UE EUBEjjEPujRAt1$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $UVSu] SVRtCPVx1e[^$OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $UVSu] SV`Rt%C PVtCPV1e[^$OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $UVSu] SVPSt%CPVtCPV1e[^$OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $UE hPPuq$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $Uj@u ur$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $UE hPPup$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $UE wz$  1E >6. & $OpenBSD: yp_bind.c,v 1.10 1999/08/17 09:13:13 millert Exp $/var/run/ypbind.lock/var/yp/binding%s/%s.%dclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDU\WVSDžDžjhQÃu jSNu =P/!#t SߊΐSӊ躊ơ0tW9tS,!t:Q`tBR@ЃWu,!50} t E }tu (,! t!Pu踎uUjl΀u 1҉߉󫋅@\PhDžzhjuhfhvhSjSÃjSKLƃ=P/!#DžDž jPSK‹9tSȈph!S諈S蛈|􋕸RhAh@UDžDžDžƅƅDžDžjjPjhP4à u3hRC􋽸W;f%= ffu1CS@Ѓv􋅸P~b,DžCQRRh ,MQhD-jSЉƒ tTt tuhh-CS@ЋGh=CS@ЃQf%= ffu#􋅸P}kBHBLBPBTBHBIAfBJQLfAXAhj@uȃP{GD,,DžP`tBR@ЃB\Ѓ\PRPjhHP~*B` u"h@Ahjjw\u h&t,!,!} t M 91[^_US]C`PPBC`C\]UjuyÐU WVS}1,!tLCPW[u0C`PPBЃt,!S{ ދue[^_GMTUS]1ɀ;}1Ґ B~[UWVS ~$H B2@ 4Iu1ɋ 9}3 9D H @ 2A9|[^_../etc/localtime/usr/share/zoneinfo/U,#WVS]tRtE;:u'j/Sxu,hSc u;/tj.Shxt1ۅu ;:uC;/ЉDž҉эD =PVQ hVWHSVMHj.Sw t DžtjSEjSǃdhSWrƃW  PPxPcU POM AP:U B P%M A $ 92?ʋJ2&zr29t 9t ))ƍIBM A 919}+] PMFU ;r|1M ;q}0ʁM ;A;F;q|1] ;s}oLPCCU ;B FM ;q|1M L] ;s }ʐFE ;p |1U ;2}HӁLQ-PC FU ;2|1] K9}FځLtB v^B F] K9|19}@U LtBv 벐BF] ;s|1[^_ÐmnUMAtƒЃ v,t -t+u߉ÐUVS]ut= Ѓ w01ҐTP9C Ѓ v;U| E 1[^ÐUVSu hj]SutUU)9:uCAj;jSQ^t%E+E9:uAjEPVƃtpE Ph~Ãt U >uȃVƉuM)M}v$t+<,t'<;t#EPVƃuHEEЀ>u t<,t<;}F]SVƃtF<,u]SVfƃt>uU BBMىLǂPE@TMى`ǂdǂh׃ցEEEuԍEPURMQuЍEPURMQ 9~FFFEEu<Q])ڍ9Eu)ٍ9EuEM)EE}1.GE1ۋUBUE H9}]E Pƃ<2uE LډU+C9}&E <0uU L؉EE19}cE E Pƃ<2tE LډU.C9}&E <0tU L؉E19M Mu PEЉEUԉU1M EM PM E M\u)1tE Xu E+EE+EM D9M Lڃ<0tUUCE ;XuMًU LǂPǂTE؉`ǂdMhB>EE @@UډLǀPǀTMAMUE P }tMċUD M A E x ] LURMQSj]C}tEPURSiM1x[^_US]ShtjShu]U=!|5!h jpth ÐUhhTZUWShlÃu i=!~Sh!x߰эA=%!tSh!;u=  @ H hh@ ?h SRt,;:tjh Sth Vfe[_ÐUhMhCÐU WVSEE Ot;G}1ҍuD 8t<B;W|1/u9}; | B9};} LEPW3VSEP CLUB(e[^_UVS]u hqVjS(h[e[^ÐUjj,h!h?tPu1UVSu ]h =!u!h h Sh Vut C( C( !e[^ÐUS] Sjul؋]ÐUjj,h!ho tPu1Uh!u u!U,WVSuEEIEPL9|k@Eu[Eu U;T~E}t6LPE~!I:@9;u 2@93t؋MMIy] E.‰<)׍))E +EyOQxGQų )‹]S)))‰S))M O$I)))ȉC}CE)EE}MU+Uҍ4UJUy]QmE)))ƋMIMy]QmE)))))MMP1]u9Q)ڍ9Eu)ٍ9Eu;<]ÔMYy6A;|MA+?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UVS+M] Au1#2C80t0C0)‰[^ÐUWVSut9+U]  8C89t9C8)‰BtNu1[^_UVSu] CCC t{u$SK=tP/! QC);S|Sr@u1KB;St C t u SD@ue[^UhEfEfEEEEEEPu EP@‹E: U,WVS}]ޅt)?t$}IKE E]P5P/!;lj;IK C)CPVj][^_U$W}}эQUEPEEEPu }$OpenBSD: clnt_udp.c,v 1.16 2000/08/24 17:03:15 deraadt Exp $clntudp_create: out of memory ULWVS} ]$1j TEt"DdPSƃu1h h'! P/!'!D`FXjEPsEfxu*jURE PURcfCfUfBE@,pUFBF BFB FFEUFV F$F(~T^\1EEEE E܋UUjWvX^8S2EPS6 F#tj#V4Ãt5$!h(VƃgF< t< th(VÃ=Cj EPV7U9: =f%,!0!4!(!ƃh(ScÃtBCt<4< t+< t'!sh(S-Ãt Ctu$!e[^tCàr`CìrLC̀r8C]̀r$C̀rCx̀rBv̀rB ̀rB̀rBb̀rBh̀rB!̀r$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $Uu u|$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $UVSu] SVt-tu!CPVCPVW1e[^$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $UVSu] jSVtjCPV|1e[^$OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $Uj@u u6 $OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $UWVSE} " Btp9u Bu@u1[^_$OpenBSD: strcat.S,v 1.2 1996/08/19 08:13:12 tholo Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $Uh!u$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $U,WVS}uEFDu-u EE+uFtu0uu_SVtNCPVAt:CPVmt&C PVYtCPVE1e[^ÐUUE wR$xCCCCCCC8 0 ( @PÐUUE tt @PÐUVSu] Ftt,Fu aSPSv FCtwt ( t!FCFFC FCF Ce[^$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $Uu uX$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $UVSM! ~(gfffK))0 у ޺gfff))0 [^libcUnknown error: U WVS] jhE ƃE;s1h4SPjV PSƃ`hhEhjV PSƃ߰Ѹ)PEPPS V ؍e[^_$OpenBSD: xdr.c,v 1.5 1998/03/19 00:27:27 millert Exp $U(UEu EPÐUÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUS] EEPuQt E1]ÐUS] EEPuyt E1]ÐUSM] t,r tFK;ƒUQEPQB*AURQЅt}ƒ1]ÐUu u<ÐUVSuM UӃt )؉Ëu0FRQV@ЃtTtWFSh!V@Hu0FRQV@ Ѓt t#FSh\V@ t1e[^xdr_bytes: out of memory U WVS}uE VW6;uvuut rFtQgu[u,VËE uhLh諛)VSWtSE 1e[^_ÐUE hPPu-ÐU WVSu} ]WV,t{t9t{u}u1EPVCURVUҍe[^_xdr_string: out of memory U WVSuE t u߰IMEPVqE;Ew~Pt rEtQktZu,RËE uhuMh35EuSV( SOE 1e[^_ÐUju u NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGCU WVS}tE8u j/EPrtEPuhNÃuNhNǃuN;O;:D%C(s$OTPPxPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPstZ]9sSBAtG9rAUst5]9s.BAt#9rEs9s Es9sAt<:P)u;tC;[^_ÐUpVSjuqƃEPV|t VjjjVjjujÃVt3ff=uj ƒt EЉBuSe[^UWVSEuCP/! 0EPffMTMDffEE1UBffpU9>RMffM )UB ffMDEE|ffDfft89X>RMffM)yrÐz뻐}r0z(E[^_US]uP/! ts3sSR 1]$OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $\\\\\\y\b\P\<\)\\[[[[[[[x[I[:[)[ [ZZZZZZtZeZYZ8ZZYYYYhYWY8YYXXXXxXWX8XXWWWgWMW1WWVVVzVXV8V+VVVUUUUU|UjUVU@U&UUTTInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strchr.S,v 1.2 1996/08/19 08:13:14 tholo Exp $$OpenBSD: index.S,v 1.2 1996/08/19 08:12:59 tholo Exp $SD$L$ 8t@u1[$OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $UVSuUt$] CAuJtAJuJu[^$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $UVSuMt%] >t B:uCtBIu[^$OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $U\WVSEE܋UuMuЉU EE} }}EE U‰E9k}}}[}uMD}&u]Nu]CAN}E9EvUR+]SMу߅}ċEE9fE E}NjE HE} %U܉UEЉE} (M MmEEEÍ4BSRMу},VSU҃|GVMQU҃U܅}2.VSMуVEPU҃}UډU+]M49WSU҃}+VWMу|FVSU҃‰؅}3/VWMуVSU҃‰}NjEu)Ƌ]+]SVMу}/EPSU҃|KMQVU҃}7U2MQSU҃MQVU҃U}ډUWMQU҃}7MQWU҃|[MQEPU҃‹E}AEuSWEuP/!jj&}t)EPWVOƃP/!}t UBuX hVQÃV tu+>au#FHwj h| Ѓ;F@t OVF(љdžPV F V T0DJNRj8P}tUB t P hV0M01t%4dž$j$uP/!V]p@~@|@ (@ ă@@ԇ@l&t^VP/!1e[^_ÐUVS]tsFƃSe[^UEu @u P/!ÐUlWVS]U uEC8CC C CCCC4X {D1 󫍻t-EPRBEC P*Ctmt.P*KC =~ P/!PFtC4Ft FtEFt=t=uCEPSu1e[^_ÐU WVS]E H{4@}P)SDAK C$jP APS tMVS0S(uC,K@C<Й{@Pg);C~CPS e[^_U WVSuE4jV-tP/!EtO0PtPuɃVt}uP/!E1;}$8t PC;|䋆t PVX}u1UP/!e[^_ÐUSE} tP/!@tX4t+jjSs,u҃Suǃ01]ÐU WVSu4aFj h| ЉF@SV jjjW5ut2hSWt=tP/!Odž,O:1ۍ8t jjXPRVT uC~1[^_ÐUE@}uuu jPP/!ǀ,ÐUEM@t!tP/!ǀ,AuP/!ǀ,uu uRP`ÐUE@}vP/!ǀ,,tju jPP/!ǀ,ÐU,WVSEp URUM MjjRQP-PEP`&EuUU%MMIEXE9UCfv4)9uuuMyNjMsE뼐fu#jEPPUR%E}fwEPURMQEPURj E MMEPEP!f ju%PURE%EsXEMq } w2} r,URMQEPURCE`:Ub(} r,} t} MaEXUf|SwjMQRPEP UDS؋MECDK)‹MQEPURMQ uEPURMQEPXtXUbSMQEPUR< t02MaE` Ub1e[^_ÐU WVSEUpt*t%t P/!dž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV#ƒt zf?t͉$;^(~dž$9z(f|Gu>jR(GPV" ƒ!zdž(ftf?udž $+f?!(f|Ow#jEPM QRV!O BU OfvDO)ЋM A N )ыE HTG QMGDG)‰Qff;vdž $dž( É(1e[^_ÐUWVS]C(PS(ЉEEC0!EKu;|eS9|)<WPPt"{js]‹u VC(@P C 9~ SDK C,9Ev C0 EC,UREPSe[^_ÐU WVS} ]S4ƃt2WE0V)Sj7PE0~E0e[^_ÐUS]uu #C,;C(~#C0]ÐU WVSujv\tjNE P\ǃuP/!VP/!+1;] } NC;] |1e[^_ÐUS]M CCACAACACACACAC AC A C A CA CA CA C AC ACACACACACACACACACACACACACACACACAC#A C"A!C!A"C A#C'A$C&A%C%A&C$A'C+A(C*A)C)A*C(A+C/A,C.A-C-A.C,A/C3A0C2A1C1A2C0A3C7A4C6A5C5A6C4A7C;A8C:A9C9A:C8A;C?AA=C=A>CUP?P@UMQP@QPAQPBUPC]PG}BECBCBCBEAfEGAENy[^_UWVSu1Lhhxt=sjtt W Džt|uDž| }uE\}uNLECDž| DžlDžhLUDžtE\DžxE=t =h$Ã1ǃEǃ|Eǃj$5Ɖs[1 󫋅L9t ^FFF |F ̘FDFF}tXE  tt uU RMQ0,e } ~ jj[EP裺>E EjEPl}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=E_x EEgxu0Ex=w Džxxv Džxhu  ǃǃ xltxIt!ȍDlx9lsllJ1HG1tffw fǃHQjKtz uShh3KStKE t!@U@t!}}"PP/! P/!Ot3Ct P6t PS1([^_ÐU WVS}jj7nLÃt9f{u&;u!f{uS7KP/! j=P/!P/!j]S7JƃtxjS7JÃtb}u\CCfCfCC jVGjV7MjS7M1e[^_TMPDIR/tmp%s/bt.XXXXXXUWVS1uhXÃ؅uPhhS DžWPjS2 ƃt So jWj[^_ÐUÐUSEX{tjs3LC u P/!]U WVSEX{tjs30LC}tP/!~EPu S>ƃu[}uj63K@jPujjVS"Aǃ !@tj63KCe[^_UWVSE] "} uSEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u;CEUUMME܉E}ؐ֍ EfEEDSEDSUEMAABABEBEMAABABEBt?BE܋MAABABE܈BE؊GGBGBE؈BfFf;uC[P1f;uDCEUЉUM̉MEȉEUĉUMM}֍ EfE֊E׈DSEֈDSUEЋMAABABEЈBE̋MAABABËB BtMEȋE@E@BE@BEȈBEċE@E@BE@BEĈBtAEMAABABEBEGGBGBEBfFf;uh[^_UWVSEu } uVFfEF 8fEẺtUȉxMĉ|]]EEUUMf9M^]EEUUMM}UM 0EE@E@AE@AEAEE@E@AE@AEAtEAEE@E@AE@AEAEGGAGAEAM fEEDVEDVfE]f9]+ỦtMȉx]ĉ|UUMM]]ZfEEf9EGVUMM]]EEU܉UM؉M}U]S 0E]CCACAEAE]CCACAEAAtMEE@E@AE@AEAE܋E@E@AE@AE܈AtAE؋]CCACAE؈AEԊGGAGAEԈAMQfEҊEӈDVE҈DVfE]f9]E̋tBBFBFËFFEȋxAFAFAFEȈFFEċ|CFCF CF EĈF F EUBF BF BFEFFfEMAFEFFfE]CFEFH[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6\CFjW6QCFtP蕽F Ft Pqdždžt PGdždžV!WS1҅tЍe[^_ÐUSEX{tjs3VBC} tP/!@ Ѓt1+tS"t3Bu ]U VSujj6?ÃtZEb1EEEE %EjEPSjS6{A1e[^P ̀r<\̀rUdSE] }UfEfEEEt CEEEERuEPE…tEЋ]Uu jEPutUÐUjjEPuvtUÐUS]jjjSN1҅tډЋ]ÐUS]jjjS&1҅tډЋ]ÐUuÐU|WVSu} t}tP/!;tC;u+]K9sP/!E;Xu{trgfffmE))EE0KM;XuGu<ɸONUmUR)MEGEAK;XtCE} u }tJK9vC;/uEPV/E%f=@tP/!} tRhh VkU |# ʐAÐa뻐=P/!tW}t"hV,t=P/!t,jEPVt=P/!%E] t6Zu 9t-aC됐DizX9H1x[^_/dev/arandomUWVSj]Sjh(Sƃ t!jxEPV*V]XDžxx@%1Nj]Fw-DžtjjtPDPjW u͋E1ދU 0sZssD*]CC02C 0G~CX[^_ÐU=4-!u+u !HIyt!u!4-!ht!ÐUWVS}u =4-!u t!1ېt!t!v!Mu!EؙE:u!t!u!v!v!u!v!C~t!u![^_ÐUS=4-!ut!t!v! u!u!v!t!v!u!v!v!t!t!v! u!u!v!t!v!u!v!v! t!t!v! u!u!v!t!v!u!v!v! t!t!v! u!u!v!t!v!u!v!v! É[UM19s @9rUSE 1ҋMX$_RE8+AAAAAAAAKu[UWVSuEE}t$EXtU 9S t1ۃ}uNEE~O#} NE 苖EÃEEu 0uEu\EPU RVÃt'jEP}%PU RsVt1D}u9U ڋE,CBSCC؍e[^_ÐUWVS}fEuFtyj[ƃt.jhVw 7F uV褲1w hv豽wHkFBV~ u FINf9t DAfEFtjPv QWz oFEt@_KF !ËO苗0tUut  FFCE;C Kf9t DBfECtjjs QW C CCBS@CXCStCBu E;B hE F F}t EpFFFF0e[^_ÐUSUB E HJ}[U WVSuuÍ9C …uCt(}t!CtjPRsVt u} tKCtv jPs CBSSЯri1e[^_ÐUS]E @@ @PQHRPBP[ULWVSExtjw74G tP/!}t r }u G($<tP/!АEE HȋUB99vZ]SM QW-ڃ=EE]CjRPyjE PEPdM] UBM A9vr]SEPWF-ڃEE܍]CjRPjEPEPM] CU B9}u+jw7L1ƃOfM]؃tSEPU RW5EԃuSM QW%EԃPEԋ0PfU҃}u }tVjV72}t6  t-EPVM QW ÃujV72UB M AXFN)ȍS9s.EPSEPURM QVW 'FAU҉Uf9Es%)PDVPPofFVF)fFMfJ^U BMAËCr2S#U ZMq1S G($ <u9GuGf;Er@fGuU~u'FH9Eu@LJEf!~u"f}uLJfLJjV7 1} uUBP0WM# 1e[^_U WVS]j3.ƃuǃsf{ E@ U B$VN)ʃ9u`~S AH9{WE PSW'ƒ|ltC Ffs @fAC f3~u>fu9{WE PS'ƒfǃ‹EӃǃjV3/1e[^_UVSEuX{tjs3v/C tP/!t tu S|sFt js3-Et@uVEPSsFPujSƋUBuuRSt17%Pu3x.P/! u e[^U,WVS}jE 073.]SEPW '0U9VUbG,E萃jV7-EGj37+ƃSFH9jV7-E싇;Et P1ۅumrYUFP\0f@jV75-jS7,+ƃ t2fEmsjV7-jEP7*ƃ u='[Cf]UfPAU9VU9jV7,EPEPW t0U9iFE[W,U萐jV7/,E>j37*ƃCfjV7+E싇;EtP1ۅumrgEVB\0jV7+jS7)ƃ FHfEUfPmsjV7L+jEP7@)ƃ u3AHfEUfP=U9tFEjV7*jU27(U %e[^_UWVSEEEEPE PEP.Ãu1}}uj3E0Q*uEE;SE PEPG!CPWE PEPiE  t>GuWEP.jWE0)ESG9`SG9uEC/CPWE PEPƃtsCfuEfKftSE PEPQ tGtKjWE0)}d1GjWE0(.jWE0(WEPe[^_ÐUWVSbj6E0&ÃvfuEESU4FtF PEP"ǃFCu`;u#fCUfCC SMQSEP #> C؃)VPP#f{UM4уEf9sffHf=uCf+EQf9sffHufCjSE0B'+E,M9t B1vU :u.jRM1&1NjSE0&51ۃU RMQuE PUR!t؍e[^_UWVS}UB($ <u09Bu)B;Eu EPWu Rt EO:EMCtC PUR Ct  PEP C pG)SPPLfwUEыEf9sffHf=uG+EQf9sffHufGUB($ <u9Bu B;EvfJ1e[^_UWVS}gEE  } u@UUEUfPjjj]SSPEPe E] }t2UU]EHfCSU REPu O8UBH9Es2U]E@fCSU REPu O}uqUBtgjPE0L"ƃu]FHfCSU REP6u OjVU2#UBH9EBjPE0!ƃu u]fCSU REPu(OjVU2t#ECfGLjVE0P#UUUEfB}ujjjGPPRURuO1e[^_ÐUVSu] Ct,jP6 ƒt3CBjR6"Ct3jP6 ƒu CBjR6"1e[^p̀r\̀rH̀r4̀r t̀rULWVSE fEE 8u UR}WuV]SPMQ3!]S}WuV]SE PURX E؃};MU؃]C+EfCfJC]ËE }'UBM Cr2SGUBMAECr2S讪UZMq1S藪 ] ;uWE },uuSP0jURM1 uu] SEPU,UMMԋEEЃj3U2E؃SBfUMЋA tBw t]C؉E8 MAȉE܋8 EtgMAu^E؃xufvOUBDBЋMQ EU܋UBE܃ ERQӉẼ $9sE MQK)ʍG9sZ] ;uWEPURMQSEPWURMQ]SE PUR E؅EEDAf9Es*%U)PЋM؍DAPЍDAPZ]fCEUЋB tnw tMU؃]C)fCfJEB]ÃWEPSާUЋCMU؃]C)fCfJEB]Ã}u U܋M̉ UЋE܊H CE̅uU܋PE܃ PSYMA=q ]SB f}tEU؃DB]ÉEPTPu؃EP. UԋCUMA)fAfVEFÃEP UЋC f}tEU؃DB]ÉEPTPu؃MACU]C)fCfVEF]ËUBC }M 9u9] }uuQSauuE PUR tqjMQ]3:jEP3* U;Et H1ۅRju]3ju31ajEPU2jMQ]3 juE0juU2Mq-e[^_U WVSEPEPǃu 1MfGUfG] CGGC G {u:]] C9u$KfGEfU];EǔƃujWU21]hV5U FBFfFfFZ ^ Bt?jPE0KÃuV赔1lCjSU2u]SWVE PURÃEVU R[9u] VTU EE8؍e[^_ÐUWVS}EPW ƃtEPWÃu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÐU WVS] }UfCfCC4G t G WFCfCfCC4E@ tBEPDUFfCC $ C jSE0W1e[^_ÐU WVSu UMfFfFF0CF tuUBNj $N)fFfFF0C7G PS&Gtaw EPuJjMQʋ F)fFfFF0QRSӠUC 軓fFF $ F jVM1(1e[^_ÐUBtB tBHfG1e[^_ÐU WVS}_CtEPE PGPW jw7q}t} tXCuPsFA9YjQ7tUjS7 t]1sCt$CU CfB_sfuKYjQ7u9jS7 u ApNE fp1e[^_UWVS]SE PURE; M  wEp8؋M9tjSE0 Ur MAfƋEfxu}]9tjWU2jwM1 ǃu'U9jSM1E8GUfBMfIQE PURs ؋9tjWM10EpyMQ A9uQϋ_jWE0 u @jSU2 Džu MfA9MQMQ1e[^_ÐUS]CtPC CC($U SUfS C(]UWVSU,EjSE00 ǃu1`UzfEGftcUUfuƋEfp URE PURuG EE~FfuKfuG U  u[f}utEPU RWEP@u-UG9u$tURE PWURtEpEEUfB ЃUuftNEUfp֍GP\8jWE0 e[^_UVS]u jv3 Eu1XEf@PuStju3\ 1'jV3K EUCS Ee[^ÐUVS]u jv3 Eu1`@UHfBRuStju3 1'jV3 EUCS Ee[^U WVSE }uPAPCt,FPVGPC PEP t} u U!@tV;Fv/u P PRڄF3C P6TG GK }Ct:EPEPEP PUR uQMU} u M!@tnC@U;Bv6u PO PRuLMC@As PU2脒CMAUCMA É1e[^_UWVS}EfxuyuA u 1A t@QB@u@QB@t p ]P UEPÅt5PPCPVW t ESu Ѝe[^_UWVSu} WF9v‹r8t)‰ACsGv)Ɖ[^_ÐUWVS}E PG9v‹E r8tCAFsGU ;Bs@[^_UWVS} ]ujWEPÐjGPEP豐E U9 s6uQ PRu~EUEU> ߋFEjuE0ƃt]E9vÃSFPWjVU2E)؉E u1e[^_ÐUWVSE UMEUxMM EE]URMQÃu ECCC fCfCu9vVEPCPL}tUBjRM1 U)]jSM11e[^_ÐUVSu] jSEPێjSEPɎju6Jƒu [B tjR6!Bju6ƒt)]BERV9]w1e[^UMU BB jR1ÐUVS]u t4jP3wƒtB jV3e[^UlWVSEPE PluE%f=tP/!1lh(jÃt[u1C@IyE WVEЋURPQUE ؐe[^_USEU M] $[Ðmpool_new: page allocation overflow. UVS]u uhhGrSu1m}uAAAATQ9RuJH YCA 9u CHKAe[^ÐU WVS}u NF\V9u FCFBQQ9uA GA B Q 9uAABQ|1e[^_ÐU WVSE PURgÃCMT 9uCBCAK9tS9RuZXS;Uu C UBC B S ;Ut2CBMKAC 9 u UBXMYK-CUʐ|MQÃtcE U1jWV79u<9u8MsJM9t'~P/!1Rjs:E CEuCKCMTS9RuZXECUBC 9u MAXEXUtss$ЋCe[^_UM QQEtˆQ1US]>P9u @ C @ B P 9u @@BQz 9uSz1]UVSu9t"CtSVHt"[9u1҅tЍe[^ÐUVSu 99CtSVCL9u CA CBS9t7S9uC FC B S 9tCBCgCǐ[9iPWxÃt.PhSރCCC1e[^ÐU WVS} tU rr$ЃU B1jVS9u49u0E p;uU b1e[^_ÐUM AU9t9Hu@u9u10_̀r$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $UVSu uVvÃt VjSs؍e[^UEPu ud$OpenBSD: vfprintf.c,v 1.9 1999/08/22 17:06:35 millert Exp $US] {tSut)CC C1]ÐUlWVS}G $fEGfEGEċG,EԍEEEEEuu uVÃ|V*`tE@tO @؍[^_InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.ULWVS`E@ txu(UR(\tP/! -MA f u fy|}WE PQU Dž DžM}}EEDž$jQWZÃ~$%u+tVpuEHMȃ~%EP}W}EDžDžDžDžƅ  XJ$,HTXId$$$$$$$$$8p0??w<^ƅ RC1ۋBЋ w\BBЃ v⋅8$us u)0 PQ} W t MEE@B&t MEE@TBƅ+3 *1ۋBЋ w!\BBЃ v⋅8$uo u)0 PQ} Wb t MEEXB"t MEEX,Dž1ۋ & \BЋ ȃЃ vԃ $u; 0 PPU RDžs1ې \AЋ Ѓ vփ $uA )0 PQ} W@8lu P t EE}GPƅ  tE}_wt* t EEMA`@t. t EEMY- t EEUBÉ}ۃƅ-uDž( gt Guu Džt0 t EE Ehݝ. t EEMAݝ't-ܝEuƅ-Dž<'t1Dž$ P RPPQW^ gt Gu;~;~E gue Dž g e=B QPEPƃVJ fu3~#փu tDt18,9|֋tFp)pᄈƅ- t: t EEMA8xt5 t EEUBb@t6 t EEMAf8" t EEMA8 tEUZrt) t EEEX[@t) t EE}_& t EEMY11 t EEEX1DžDž x@ t EEMIu Dž|=WjP#t+9װэq tE}_wt* t EEMY\@t* t EEMY' t EEEX1Dž Dž tEMYqt* t EEMY\@t* t EEMY' t EEEX1t tƅ|E u*$r3$$P0 uޅ"00ᄈ0jj VSS0jj VS oÉօwu w0ᄈ؃8 uEDžװэq℈b+pR  P Pƅᄈ9}t t+~pBEEx}~%EPEP! U_]EPUЃ~'EPMQW }t[@EEHMȃEP}WT Evtiƅ0 GEEPUЃ~&EPMQ~ }%=+~]@EEPUЃ~&EPMQZ }X]EPUЃ~'EPMQ })~_@EEPUЃ~&EPMQ6 }X]EPUЃ~'EPMQ? }u ru e݅D@K@EEPUЃ~&EPMQB}9|C BEEx}~%EPEP1UK~\AEEx}~&EPEPjUY]-AEEx}~%EPEPIU9AEEPUЃ~%EPMQ}ۅ~_@EEPUЃ~&EPMQ*}X]EPUЃ~'EPMQ3}AE;P9AEEPUЃ~%EPMQ=})Å~]@EEPUЃ~&EPMQ.}X]EPUЃ~'EPMQw}BE BEEx}~%EPEPMUGEEPUЃ~'EPMQ})Njy)‰EEHMȃXEP}WuE/p@.GEEPUЃ~$EPMQ}݅E@t,IHEHEK ~\AEEx}~&EPEPFUY]Ex}~}EPEPUW9AEEPUЃ~%EPMQ5}UHMEx}~$EPEPAU+~]GEEPUЃ~&EPMQf}X]EPUЃ~EPMQuz;}}tEP}Wu@EE}tEPURu E t09t R\WMA @u[^_ÐU,WVSEEEEEEE@M EE%uE1MEBX$H  | | | | | | | | |      d           @g1ҋ]ЋM wTPCЃ v;$u9|EPEPEF;u~uurEE*1ҋ]ЋM wTPCЃ v;$u9u9|EPEPtEF;u~uuC]9|EPEP@EF;uwuoBЃ lMEBЃ vV1ɐLBЋEEBЃ v$/@ ;u|EPEPE t%;u|EPEPpE xt$;u|EPEPCEK@t$;u|EPEPE;u|EPEPEt$;u|EPEPE;u|EPEPE  t$;u|EPEPwE t$;u|EPEPKE S@t$;u|EPEPE';u|EPEPE t%;u|EPEPE t$;u|EPEPE@|;u|EPEPoEw;u|EPEPKES;u|EPEP'E/ t%;u|EPEPE t$;u|EPEPE@;u|EPEPE t$;u|EPEPoE zt$;u|EPEPCEN@t$;u|EPEPE";u|EPEPEF;uu}~UPWOM;MUU Ewa$PPPPPPPPPP@@P@HPPE E E A;M~EtM9t P/Oe[^_ÐU WVSu} Eu"S}N7PEPh SV2O)PjRY1e[^_U,WVSE]M}u fuetEuCEu -EPEPWSR$}%mgtGuEtF fu90uE@tCD@u U0EE9r؋E$U)ʉȍe[^_ÐU<WVS}M E} G-G+w ~>Kgfff))0 у K0 9sCF9r 0F0F)[^_UWVS}E xG tuW3tP/! U U]rEG t`WO,uEE]sEtvPEPRщÃo])ދU B)؉BuR4G Ou]]]sEt%Bf=BuJ9sFG)‰U_X9rPQLƒ+GGW_U_G t 9sSEP7V)_s;Wv-9v)SEPRoVW5 }C_9r!SURwG,ЉÃTSEPRV)_])ދU B)؉BEEuE]]EpEt}u1Vj UR5ƒt EH)‰U^]EM9vG_;Wv'9~#SEPReUW4 uw=9|SURwG,ЉÃ~U˃SEPRU)_)]uWZ4u#E])ދU B)؉B1 O @e[^_UEPEURPEU RP EUU|WVS]u UM u1 1MԉM؃}Ur9wu9v}tMq11}EEЍE܉Ẻ]ԉufEEfGEfGEfGufwUԉM؋UEfPE؋MfAEfAufqEfM}u{EHG1fEG ‰1G ‰1G ‰1}t E@U ‰U؉ ‰UEUfzjEM)MfuMft]Ӄx uf^Ky+EU̍BUEuNwEɁv}~,EPEEPWUREHPEЃPEMIfMʋuvfuȋEEMODOtOfuf;UuEuAM<% uʉ1EĉӋMAMUUĉE 9v Mv1ɋ]~DuwEEEu^E))ʉыEf)ʉɃEKˋuw)ȉf wtDM1ɋ]~1wuƐEUZEEEfKڋUf WEċMufNUUM9}ti}t5]9~&+u_MD_ f_K;]f_EU ЉEEU ЉEԋEԋU؋MQEU ЉEEU ЉEԋEԋU؍x[^_ÐU WVS]uEE 9E}5)MKMDK ‹MfKEE 9E|ՋUSfS[^_U1Ef%=uE u}tÐU1ҋE %=u }Љ$OpenBSD: memchr.S,v 1.2 1996/08/19 08:13:01 tholo Exp $W|$D$ L$t uG_Ð1_$OpenBSD: bcopy.S,v 1.2 1996/08/19 08:12:54 tholo Exp $VWt$ |$L$9sL$_^ONL$_^$OpenBSD: strtod.c,v 1.13 2000/04/30 04:58:22 bjc Exp $UVSu !t $PGC‰rZBB Ѝe[^US]tK ![ÐUWVS}uGE_EM E Љ ȉEU9U|ȅtI;W|4G@PËGK W PRQMWIߍGU4UBWe[^_ÐU WVS]} M98)1ɸ~A9Q‹EBB  ~$ PCj RƒF9|C ;u}#E)ƐPCj RƒNuЍe[^_ÐUU1uuuu|@@u ÐUMt't1`t NB1fuuuuu @u US]j,X@]ÐULWVS]u F9C}]uC{VUU;S~@PEEEU‰Eԃ]Ѝ^M9UsuE9UrEЉE]ىM܋EE؉E9U2uUċE؃E̅tgUЉU}EuU%‹E4umMMEMmfOf7U9Uru7EPUt^uЉu}EUEWЋU4fwfUBE EMmu9urEĉEỦU؋u9}}M}~?tUEPEe[^_ÐU WVS} tj4EPEts !uuM;uv>t]UZE PUR]C]EE}E܉Eu]E%] ]m%)EE})UU}fWfE9Evu>uM;uv>t]UZEe[^_InfinityNaN0?aCoc?`(?yPD?$@@@?UWVS]EU EU| !t) !JBR| !}} eE%=uKU'E6}u]uE6} tMEUztЃ] 2ED@u'EE6} t U 6E EPEPuuE}t#UM?ElEE썸2 ~@)U⍈E )U1҉EUmEݝpptpt݅p%6}E 66 6}fEf fEmUmEuEE@tME}w!EEŐ&EuMEE)X| E] ۉ]E}|EEȉEEU)UU]E} vE}~E1E}w}]$999 :,::3:EEԉE̿E@E}E}}̉} EEEȍx}ԉE̅ !v1ҐBۍC9v !5 !|| !‰U}0(1UM]ȉ]ċEԉEE~R؃Ő&tE5h'E]tH'tE GuE]@ut9E Ő&]t H't EE ]Gu}t4]Eu(}~"}:]̉]ME 6E]EM6]E}uBE%6EEU]EE]E}]74݈&e]E}fEf fEm]umuEm|0]|C]E]Eee]E*;}(6E]EU}f]f f]m]umuEm0]]EE]Ee]EG;}|]E ݈&]6E}fEf fEm]umuEm0]]E;}uA7E]E%e]Eu&MU:0tE&GE]v؋|]UMEĉEȋUЉUԋE}]ݐ&}}8}2EE}t 6]bmE}fUf fUm]umuEmE0]E;}u[EUEtD@3'ME89u|9uE0]EE 6]EE@G=UUuEE}tf}}t 3<6+}/]K9]|u) +]]]1}ԅ} ]])}1}}jE}~}~};}~})})})}}~e}tI~3VEPEURSÃEP ]])t!SUR ]SEP\EjHE}~URS1E}0}u#EutEEE E}t']SJ؃4} )}Gt )ǃ~ }}}}~EPUR9E}~]SEPE}tOUR]S}8Mȃjj SE}tjj EPEỦUԃ}`}~Z}|( jj]SEPEP ؋U҉U|1|C]E}}~EPUR0E܃EPSOÃUREPEx uPUR$EPu }uEu}9tp~E܊Uw|uR}uLEuF~;jEPEURSƃ  uEܨt E܃}:tU~$}9uE9EU‹]E܋UE;}|Gjj ]SLEGEPUR0E܋]E;}|ÃjEPEURSà  uLEܨtEMU:9u|9]tME89tU&Eȋ|1|C]ME80tEURj}t2}t]9]tEPGUR8؃]S#|9Eu0|@EEUE@]} t] |X[^_$OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $UEt8u1} t ÐUMU u1'}u t:%ÐUUtE 1UVS]M U1tAtFJu[^ÐUVS]M U1tCtFJu[^US]= -!u(C uEust1S0tC@9t R!C0c CCK {u S0C tCC؉C1ҨuSS1]UVS]C u)EPEPSjƃu uK CCCC:'!`I΀CEC}tCPtf s e[^UlWVS]u }f{|EPCP} E%f= ƒEu0C uCLE%f=u{(buЍe[^_U WVS]CPu1/PXPKx׾ !XKye[^_ÐUS= -!uCKIxfx t)XIy;uj Xtː1Qf@ @@@@@f@@0@4@D@H]ÐUSp+C~)=t+C~;u~ P]ÐUhI}ÐU'!`I -!UEuhIB#@ tPP/! ÐU WVS}G tPwtI)7uGG3O @+GSVwG,Ѓ~)ƅ1e[^_$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $U=H'!P '!P'!P '!P'!P'!P '!P$'!P%'!P&'!P''!P ('!P!)'!P"*'!@#+'!H=Lt'&!B'!B'!L&!qKpKpK.KKKKKKK$OpenBSD: flt_rounds.S,v 1.2 1996/08/19 08:12:20 tholo Exp $<$$ KU@VSujjVu)EPV؃jV}1ۉ؍e[^ ((((( AAAAAABBBBBB $OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $Uj` ̀rUu ht,@u  error: U0WS]M=8}IM=|'!}IMUIM]IMjEPj\'!' warning: U,WVS]iN=X'!tSM =`'!uf=8}IM=|'!}IMuIM]IMjEPjIe[^_ÐUVS]j S9 u/ +0'!P4'!t'!;<'!rRu1e[^ÐU WVSE p=<'!jjjhj Pjuà t?<'!P58'!SW 5<'!8'!8'!WP1e[^_/etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. U\WVSP/!EE}u2j?uVhPÃEb3?}u*E=h+P5ǃ}u=@/!E@E >$PQ`R SLR S S|R S S S S S S S SR S S SR S S SR S S S S SR SS S S S S S SlR S S S S S S S SR S S SR S S SR S S S S SR SR-X'!X'!d'!d'!p'!zp'!n`'!b`'!Vh'!Jh'!>l'!2l'!&X'!X'!hXPKX'!Gt EEb=l'!t p'!jjjhjhj8'! uhxPMj 0'!<'!,'!=u % j]x'!EP/!e[^_U WVS1]1 D'! t4A9ruqtABQq3Q)؉A uSƃtQ +0'! 8'!9sDB9r=p'!t ShVt=x'!u =x'! We[^_ÐU,WVSEwEH8'!tEuE<dhǃ@MEU9v(]SÃuWB1MfCfK MfC fC{CE1 }vS E)w;u} { F;u|;[uD1}~$lcccd8dPd ddddde(e@eXepeeeeeeef$f8fLf\dtddd`fEEPj UdEE@;EE@fEPj랐EE@BEE@*EE@EE@EEE@!EE@EE@EE@EE@vEE@^EE@FEE@.EE@ EE@ EE@ EE@ EE@ vEE@bEE@NEE@:EE@&EE@EE@$jjEPEPjEP1tMEuF?P/!,jjEPEPjEPtUU(UE EEEJvP/!d/!uEEPEPRA|Eỳr̀r.̀r:̀rl̀rXÌrD%̀r06̀r̀r̀r̀r̀rUEU RPjuuuu ujhU WVS}jjW't ,uE URPjWjhÉփjW؉e[^_$OpenBSD: sigprocmask.S,v 1.4 1998/11/20 11:18:30 d Exp $L$u D$ L$0̀r L$ t1$OpenBSD: brk.S,v 1.3 1997/09/17 17:23:38 weingart Exp $L$9 r L$̀r 1 dU1ÐU1ÐUÐU$OpenBSD: memcpy.S,v 1.2 1996/08/19 08:13:05 tholo Exp $$OpenBSD: bcopy.S,v 1.2 1996/08/19 08:12:54 tholo Exp $VW|$ t$L$9sL$D$ _^ONL$D$ _^$OpenBSD: memset.S,v 1.2 1996/08/19 08:13:09 tholo Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $U WVS5D/!t^Kx~Ky6u桐'!tЃu/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binUVS]u EUM;tuQRPVShJtP/!/{u%t:;v%<t0jjjjtщƒ F$E؍E@UU!tVj]SPWGЃsu;CjEPURWGЃt_EEj]S3E܉ECEjEP‹C@9u_jEPURWGЃtU؉V$tBjjjxut$RPu !1e[^_U WVSu]}tnw?ujjPdžjEPCE PAPCt'PPGPCPVOuAn!@to@;v?uP PRu@@3CP1G G1e[^_U,WVS}G,EEjUR7hTA tOE +EfG G[AfEQUAU䋇EUƋUBFf;ut E;E v݋UEJfP[]}t%r }t5@ƋUDB j ƋUDBjjQ7wUP/!E}tsw,7}uSAP SAPjQ7%U9tP1ۅtj37RuEP/!1e[^_U WVSuU >B\N)Ãr2PGfFEf+Xp0PGfFf>E)fLFf\Fe[^_ÐUWVSE pUMf|NwP]S}t UDVMA Nj]f+|^EHUfU9ts\FڋM QщMMDN)PR]S5M;M8NBfufBfBfZfB;M~DFUfVf|Vf|VMf]K8E H1e[^_ÐUfEEEGp9UOfEBOEDOA9~1e[^_UWVS}G EuW9Utn}t7w ~^]U ECCBCBEBIu1] p19"U] KfEBKEDKA9~}t%]_<}tME@P\@7M G<\utR\@jؙO t1RPEP?ut,UR] SEPt;Eu1P/!Oe[^_ÐU WVSEp ǃttUuNFSjWMA )PhSeMDUE MfJE8<1e[^_ÐUM1t@vÐHASH: Out of overflow pages. Increase page size U,WVSEx DJ]KU}C HE!Us$u;uE8EuVEPqE;uuM UB H;uu#]C XE#X$yC11EE&B 9~F;uhMD ]C$ X U΅t+\~AG~j1hHjLEx  2 0 2EUB H9Eu`E}MQj PEPxU2C~PGrMy 0 01,EM})UMM }EPÉyC)M UB \3;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÐU WVSU B f ft ‹UL@QM;Q$}Q$EHA X!Ӊ8uǃ $}jU RDFPS[ @f8uN$ǃ EU 9B u(EPFBP}URP/!e[^_ÐUWVSujEP]SVEP u`suUR;EЉUEPEPU fB ft*juB PEPU BuE @E }tEHpX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHfvHsLC|CfƒfLCf|CuUR9fsE}tU U B1e[^_UWVSE]p~tjv6i7F!S9?9s>u P PRs3VS)PPRgEUB ESEP} E$̮$$خ$$$F(tR~$aU 8uUEGU 8t%7U 8t;w-'P/!;! uWVЃ@9!t>蔯Et]CPPu.EE@jSPVrEP9w!tu薯EPURGPV1u"} u~$!jE PWjVe[^_U,WVSuUM9AvFEPQR,.UUMAEE]CBEMEU E;w tu PM Q]Su 6xtItEU E;s7PSMQƃujS]33GEPUeCK)ȋU9s7PMQEPURjSMQ`]Af9s%)PDsPP踼fCSC+EfCfrC؋MQU@q1PyM jS121e[^_$OpenBSD: crt0.c,v 1.3 1997/06/24 17:15:49 tholo Exp $ l#l#l#(-x@edz;4L|x`wrli d_ZW0TLNHB5`+L$(,25:F\\\ x/ x/ 5 B     P h   D@ D@ D@ 8 L@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.9 2000/01/22 20:24:45 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.12 2000/07/31 19:02:38 ericj Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.14 2000/02/20 23:03:55 ericj Exp $0D-$OpenBSD: utils.c,v 1.14 1999/05/06 17:19:47 millert Exp $$OpenBSD: args.c,v 1.8 1998/07/09 18:39:23 deraadt Exp $$OpenBSD: conv.c,v 1.6 2000/06/30 16:00:04 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.8 1998/04/30 05:55:02 deraadt Exp $$OpenBSD: misc.c,v 1.7 1997/09/12 04:33:24 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.27 2000/10/18 20:37:42 mickey Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.69 2000/06/30 16:00:08 millert Exp $zzzzzzzzzzzzzzzF{A{8{/{'{ {{ {{zzzzzzzzzzzg{g{g{g{g{g{g{c{]{Y{g{g{R{g{M{g{g{zg{g{/tmp/EdDk.aXXXXXXXXXX$>$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.74 2000/10/22 23:59:40 millert Exp $>:5-(# ztm>h`[VRMFFDISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk direct- ly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first installed on a system. This flag does not work on a num- ber of architectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SC- SI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This similates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installting bootstrap code with the --BB flag, if the names are not explicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 2.8 October 27, 1997 5 $Id: dhclient.c,v 1.11 2000/10/30 02:35:33 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. Q;;;$Id: clparse.c,v 1.5 1999/12/04 00:15:08 angelos Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: raw.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: parse.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ;Zx0N$Id: nit.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: icmp.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: dispatch.c,v 1.3 2000/07/21 00:33:53 beck Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: conflex.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: upf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: bpf.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ( 0(EHC$Id: socket.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: packet.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: memory.c,v 1.3 2000/07/21 00:33:53 beck Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: print.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: options.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: convert.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: sysconf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: tree.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: tables.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ''`;''`;''`;''`;''`;''`;''`;''`;z''`;n''`; ^''`; D''`; :'8'`; .','`; !'8'`;'8'`; ''`;&8'`;&8'`;&&`;&&`;&&`;&,'`;&&`;w&u&`;^&[&`;M&,'`;;&&`;)&'`;&&`;&&`;%&`;%'`; %&`;!%&`;"%u&`;#%&`;$y%&`;%b%u&`;&L%&`;'A%8'`;(5%'`;))%'`;* % %`;+$'`;,$'`;-$&`;.$8'`;/$'`;0$'`;1$'`;2~$u&`;3i$&`;4W$&`;5@$'`;6$$!$`;7$8'`;8#,'`;9#u&`;:#u&`;;#8'`;<# %`;=# %`;># %`;?# %`;@# %`;Ay# %`;Bo# %`;Ce# %`;D[# %`;EQ# %`;FG# %`;G=# %`;H3# %`;I)# %`;J# %`;K# %`;L"8'`;M" %`;N" %`;O" %`;P" %`;Q" %`;R" %`;S" %`;T"'`;U" %`;V" %`;W" %`;Xz" %`;Yp" %`;Zf" %`;[\" %`;\R" %`;]H" %`;^>" %`;_4" %`;`*" %`;a " %`;b" %`;c " %`;d" %`;e! %`;f! %`;g! %`;h! %`;i! %`;j! %`;k! %`;l! %`;m! %`;n! %`;o! %`;p|! %`;qq! %`;rf! %`;s[! %`;tP! %`;uE! %`;v:! %`;w/! %`;x$! %`;y! %`;z! %`;{! %`;|  %`;}  %`;~  %`;  %`;  %`;  %`;  %`;  %`;  %`;  %`;  %`;  %`;t  %`;i  %`;^  %`;S  %`;H  %`;=  %`;2  %`;'  %`;  %`;  %`;  %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`;w %`;l %`;a %`;V %`;K %`;@ %`;5 %`;* %`; %`; %`;  %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`;z %`;o %`;d %`;Y %`;N %`;C %`;8 %`;- %`;" %`; %`;  %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`;} %`;r %`;g %`;\ %`;Q %`;F %`;; %`;0 %`;% %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`;u %`;j %`;_ %`;T %`;I %`;> %`;3 %`;( %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`; %`;x %`;m %`;b``;249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~~3u3k3a3W3M3B383.3$3333222222222222t2i2^2S2H2=222'2222111111111111w1l1a1V1K1@151*111 1000000000000z0o0d0Y0N0C080-0"00 00///////////}/r/g/\/Q/F/:/./"// /...........z.n.b.V.J.>.2.&....----------~-r-f-Z-N-B-6-*----,,,,,,,,,,,v,j,^,R,F,:,.,",, ,+++++++++++z+n+b+V+J+>+2+&++++**********~*r*f*Z*N*B*6******)))))))))))v)j)^)R)F):).)")) )(((((((((((z(n(b(V(J(>(2(&(((('$Id: hash.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: alloc.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: errwarn.c,v 1.2 2000/06/29 00:25:42 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: inet_addr.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1983, 1990, 1993 The Regents of the University of California. All rights reserved. $Id: dns.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: resolv.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. /etc/resolv.conf$OpenBSD: buf.c,v 1.10 2000/04/01 17:19:09 deraadt Exp $C$OpenBSD: cbc.c,v 1.5 1997/06/18 19:22:35 kstailey Exp $@ $OpenBSD: glbl.c,v 1.7 1998/04/30 05:55:05 deraadt Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $v$OpenBSD: main.c,v 1.19 2000/05/01 18:30:52 deraadt Exp $4wHwH$OpenBSD: re.c,v 1.7 1998/01/21 03:51:50 millert Exp $$OpenBSD: sub.c,v 1.6 1997/09/01 18:29:31 deraadt Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $$OpenBSD: dir.c,v 1.7 1997/10/06 20:22:31 deraadt Exp $ ... ...$OpenBSD: inode.c,v 1.14 1999/08/06 20:41:06 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.16 2000/01/22 20:24:56 deraadt Exp $$OpenBSD: pass1.c,v 1.7 1999/03/01 07:45:17 d Exp $$OpenBSD: pass1b.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass2.c,v 1.7 1999/03/01 07:45:18 d Exp $$OpenBSD: pass3.c,v 1.3 1999/03/01 07:45:18 d Exp $$OpenBSD: pass4.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass5.c,v 1.7 1999/03/01 07:45:18 d Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.7 1999/08/17 09:13:14 millert Exp $BBBBBBBBBBBBBBBFCAC8C/C'C CC CCBBBBBBBBBBBgCgCgCgCgCgCgCcC]CYCgCgCRCgCMCgCgCBgCgC$OpenBSD: utilities.c,v 1.8 2000/09/30 16:06:34 aaron Exp $.p?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@l@l@l@lA$OpenBSD: cmds.c,v 1.34 2000/06/21 19:22:54 itojun Exp $|wwwwwwwwww~wizhz$OpenBSD: cmdtab.c,v 1.14 2000/06/21 19:22:54 itojun Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modefnMXdE\|C0UCT|OCzJCCCpz?KX:D7\D2|D,DĪ&E#EİKEeE|E̝EELKXF`{D|LKF\F4F,F=FīCpzFDISK(8) OpenBSD System Manager's Manual FDISK(8) NNAAMMEE ffddiisskk - DOS partition maintenance program SSYYNNOOPPSSIISS ffddiisskk [--iiee] [--ff _m_b_r_n_a_m_e] [--cc _c_y_l_i_n_d_e_r_s] [--hh _h_e_a_d_s] [--ss _s_e_c_t_o_r_s] _d_e_v_i_c_e DDEESSCCRRIIPPTTIIOONN In order for the BIOS to boot the kernel, certain conventions must be ad- hered to. Sector 0 of a bootable hard disk must contain boot code, an MBR partition table, and a magic number. These MBR partitions (also known as BIOS partitions) can be used to break the disk up into several pieces. The BIOS loads sector 0 of the boot disk into memory, verifies the magic number, and begins executing the code at the first byte. The normal DOS MBR boot code searches the MBR partition table for an ``active'' parti- tion (indicated by a `*' in the first column), and if one is found, the boot block from that partition is loaded and executed in place of the original (MBR) boot block. The options are as follows: --ii Initialize the MBR sector. --ee Edit existing MBR sectors. --ff _m_b_r_n_a_m_e Specifies an alternate MBR template file. --cc _c_y_l_i_n_d_e_r_s, --hh _h_e_a_d_s, --ss _s_e_c_t_o_r_s Specifies an alternate BIOS geometry for ffddiisskk to use. The DOS ffddiisskk program can be used to divide space on the disk into parti- tions and set one active. This ffddiisskk program serves a similar purpose to the DOS program. When called with no special flags, it prints the MBR partition table of the specified device, i.e., # fdisk fd0 Disk: fd0 geometry: 80/2/18 [2880 sectors] Offset: 0 Signatures: 0xAA55,0x0 Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ---------------------------------------------------------------------- *0: A6 0 0 1 - 79 1 18 [ 0 - 2880] OpenBSD 1: 00 0 0 0 - 0 0 0 [ 0 - 0] unused 2: A7 0 0 2 - 79 1 18 [ 1 - 2879] NEXTSTEP 3: 00 0 0 0 - 0 0 0 [ 0 - 0] unused The geometry displayed is the BIOS geometry unless another geometry has been selected using the --cc, --hh, and --ss options. This disk is divided into two partitions that happen to fill the disk. The first partition overlaps the third partition. (Used for debugging purposes.) _# Number of partition table entry. A ``*'' denotes the bootable partition. _i_d System identifier. OpenBSD reserves the magic number 166 decimal (A6 in hex). If no 166 partition is found, it will use an older FreeBSD partition (with a magic number of 165 or A5 in hex). _c_y_l_/_h_d_/_s_e_c These fields provide the starting and ending address of the partition in BIOS geometry _s_t_a_r_t_/_s_i_z_e These fields provide the starting sector and size in sectors of the partition in linear block addresses. _N_O_T_E: The sectors field is ``1 based'', and the start field is ``0 based''. The CHS values will need to be in the BIOS's geometry for the system to be able to boot and use the drive correctly. The --ii flag is used to indicate that the partition data is to be initial- ized. In this mode, ffddiisskk will completely overwrite the primary MBR, and start with a fresh one using a default template, or one given by the --ff flag. It will set up partition number 3 to be an OpenBSD partition, that will start at cylinder 0, head 1, sector 1, and extend to the end of the disk. This mode is designed to initialize an MBR the very first time, or when it has been corrupted beyond repair. It is almost equivalent to the DOS command ``FDISK /MBR''. The flag --ee is used to modify a partition table using a interactive edit mode of the ffddiisskk program. This mode is designed to allow you to change any partition on the drive you choose, including extended partitions. It is a very powerful mode, but is safe as long as you do not execute the _w_r_i_t_e command, or answer in the negative (the default) when ffddiisskk asks you about writing out changes. CCOOMMMMAANNDD MMOODDEE When you first enter this mode, you are presented with a prompt, that looks like so: _f_d_i_s_k_: _0_>. This prompt has two important pieces of infor- mation for you. It will tell you if the in-memory copy of the boot block has been modified or not. If it has been modified, the prompt will change to look like: _f_d_i_s_k_:_*_0_>. The second piece of information pertains to the number given in the prompt. This number specifies the disk offset of the currently selected boot block you are editing. This number could be something different that zero when you are editing extended parti- tions. The list of commands and their explanations are given below. _h_e_l_p Display a list of commands that ffddiisskk understands in the interac- tive edit mode. _m_a_n_u_a_l Display this manual page. _r_e_i_n_i_t Initialize the currently selected, in-memory copy of the boot block. _d_i_s_k Display the current drive geometry that ffddiisskk has probed. You are given a chance to edit it if you wish. _e_d_i_t Edit a given table entry in the memory copy of the current boot block. You may edit either in BIOS geometry mode, or in sector offsets and sizes. _f_l_a_g Make the given partition table entry bootable. Only one entry can be marked bootable. If you wish to boot from an extended partition, you will need to mark the partition table entry for the extended partition as bootable. _u_p_d_a_t_e Update the machine code in the memory copy of the currently se- lected boot block. _s_e_l_e_c_t Select and load into memory the boot block pointed to by the ex- tended partition table entry in the current boot block. _p_r_i_n_t Print the currently selected in-memory copy of the boot block and its MBR table to the terminal. _w_r_i_t_e Write the in-memory copy of the boot block to disk. You will be asked to confirm this operation. _e_x_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. _q_u_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. Unlike _e_x_i_t it does write the modified block out. _a_b_o_r_t Quit program without saving current changes. NNOOTTEESS The automatic calculation of starting cylinder etc. uses a set of figures that represent what the BIOS thinks is the geometry of the drive. These figures are by default taken from the in-core disklabel, or values that _/_b_o_o_t has passed to the kernel, but ffddiisskk gives you an opportunity to change them if there is a need to. This allows the user to create a bootblock that can work with drives that use geometry translation under a potentially different BIOS. If you hand craft your disk layout, please make sure that the OpenBSD partition starts on a cylinder boundary. (This restriction may be changed in the future.) Editing an existing partition is risky, and may cause you to lose all the data in that partition. You should run this program interactively once or twice to see how it works. This is completely safe as long as you answer the ``write'' ques- tions in the negative. FFIILLEESS /usr/mdec/mbr default MBR template SSEEEE AALLSSOO boot_i386(8), disklabel(8) BBUUGGSS There are subtleties ffddiisskk detects that are not explained in this manual page. As well, chances are that some of the subtleties it should detect are being steamrolled. Caveat Emptor. OpenBSD 2.8 April 4, 1993 3 @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.40 2000/08/03 07:34:41 angelos Exp $7$ D(Ԟ̟@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.20 2000/08/20 18:42:39 millert Exp $5555555p5k5T5llll e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular fileaܰb $ğBl|<cïdDjeP<fۮg|<hHAխi\j>kHĝlHHmn"ͬoxOmpHP0dq<r!|s!@U8S!H(tTu"ܪVw!|<x$XAܩy|z[<?L$ (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tt290@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.14 2000/07/19 19:27:36 mickey Exp $P.$OpenBSD: print.c,v 1.15 2000/01/06 21:32:40 espie Exp $$OpenBSD: util.c,v 1.6 1999/05/05 07:06:01 deraadt Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.9 2000/02/02 05:09:01 ericj Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.8 2000/02/28 17:03:26 millert Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.20 1999/05/31 17:34:42 millert Exp $@|fQD3  @ = 3 $OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.11 2000/07/31 01:57:06 pjanzen Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.10 2000/06/17 20:23:24 niklas Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.12 1999/04/20 23:06:47 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.7 1998/12/21 16:14:40 mickey Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.7 2000/01/22 20:25:00 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.15 1999/12/24 22:38:06 angelos Exp $$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.22 2000/04/30 05:07:46 bjc Exp $_HTHQHNHIH>H8H4H/H*H#HH H@H @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.14 2000/09/22 19:21:30 millert Exp $......$OpenBSD: ar_io.c,v 1.20 2000/06/09 16:37:54 espie Exp $$OpenBSD: ar_subs.c,v 1.14 1998/09/20 02:22:21 millert Exp $$OpenBSD: buf_subs.c,v 1.7 1997/09/01 18:29:46 deraadt Exp $ $OpenBSD: cache.c,v 1.7 1999/04/08 03:50:58 deraadt Exp $$OpenBSD: cpio.c,v 1.5 1997/07/25 18:58:28 mickey Exp $$OpenBSD: file_subs.c,v 1.13 1997/09/01 18:29:48 deraadt Exp $$OpenBSD: ftree.c,v 1.9 1998/06/09 07:28:41 deraadt Exp $$OpenBSD: gen_subs.c,v 1.8 1997/09/01 18:29:51 deraadt Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.42 2000/06/09 16:37:54 espie Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ8||DXS}8LDXSu8np  DXSn8n   DXSj8(lVLV8d8(l؟XS$OpenBSD: pat_rep.c,v 1.11 1997/09/01 18:29:56 deraadt Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.15 2000/06/09 16:37:54 espie Exp $$OpenBSD: sel_subs.c,v 1.7 1997/08/17 23:05:09 millert Exp $$OpenBSD: tables.c,v 1.11 1999/04/29 12:59:03 aaron Exp $$OpenBSD: tar.c,v 1.15 2000/01/21 05:11:36 tholo Exp $$OpenBSD: tty_subs.c,v 1.6 1999/08/09 22:22:52 pjanzen Exp $ĠĠԠԠ / P1  ވ ڈ Ј ˈ ƈ ˆ     i d ] Y O J = 9 ) $      އ ه ȇ Ç    | g d W R : 5    ܆ Ɇ Ć   z v h | _@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.41 2000/01/22 20:25:04 deraadt Exp $8x.? ɚ;@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.18 2000/04/30 17:30:34 millert Exp $@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.9 1999/01/02 08:38:58 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.40 2000/09/24 01:02:24 millert Exp $0123456789abcdefR }p dp @p p o o `o @o o o n n @n n pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD$|      x r j b ^ Y P J @ < 8 3 - ) %            ׃ !Ѓ "Ƀ # $ % & ' ( ) * + , - .| /؆ {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $ , @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.9 2000/01/05 01:58:03 pjanzen Exp $$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.8 1997/08/24 06:49:30 deraadt Exp $ H  h      p  ,  ,  t (  h  , $OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.8 1999/10/26 22:53:52 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.7 2000/10/06 02:49:55 aaron Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.11 2000/07/27 20:06:00 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.19 2000/02/01 03:23:37 deraadt Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.11 1996/03/15 22:39:39 scottr Exp $$OpenBSD: interactive.c,v 1.10 2000/01/10 03:08:05 deraadt Exp $$OpenBSD: restore.c,v 1.5 1997/07/05 23:10:21 deraadt Exp $$OpenBSD: dirs.c,v 1.17 1999/08/17 09:13:15 millert Exp $##.$OpenBSD: symtab.c,v 1.5 1997/07/05 20:51:25 millert Exp $$NetBSD: tape.c,v 1.22 1996/11/30 18:31:29 cgd Exp $$OpenBSD: utilities.c,v 1.5 1997/08/24 08:07:25 downsj Exp $$NetBSD: dumprmt.c,v 1.10 1996/03/15 22:39:26 scottr Exp $\ <  ܦ |  ܥ  | < " a c c d d f h l Lۨ n֨ NШ qɨ q r S t T v V 1 9 Z bl | < \ | < ܪ \  A% A%            <=,G,4FK$L,           #+3;CScscc !1Aa  0@` ?? 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-9D B 0D B 'D B D B D C D ,C D DC C \C C tC C C C C C C ݆ AІ G B  b C c d~ Ey ff lR LE F7 F2 8G& i n x @G h s Z z܅ q҅ r˅ e v q a U u V Hw w?@  N. 0 4 . 0 4 . D2 4 . D2 4 . 6 D7 8 8 Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q rR mR dR [R SR LR =R 6R 0R )R Q $R R R R R R R Q Q R R R R R R R R R R R R ~R R yR R R R R R V W X $NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: termcap.c,v 1.6 2000/10/09 22:01:26 millert Exp $$OpenBSD: tputs.c,v 1.1 1998/07/23 21:10:28 millert Exp $5MS7) $OpenBSD: tgoto.c,v 1.1 1998/07/23 21:10:28 millert Exp $$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $k k n n o hp r ds u  v w xx $OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: fscanf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: fputc.c,v 1.3 1996/10/28 05:32:54 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $z } } 8} } ~ $OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.5 1998/03/19 00:30:10 millert Exp $  Ѯ Į  { d X ; 0   ѭ ǭ } o d @ #  ¬ ` $OpenBSD: regcomp.c,v 1.6 1998/08/14 21:39:35 deraadt Exp $Ӳ T > ; 5   u Z T հ r k T Ƶ µ           u r h e U R O K G C ? ; 7 3 / + ( $           ! "ش #̴ $ % & ' ( )~ *t +n ,g -Z -S .I .C /; /6 02 1. 2( 3# 4 5 6 7 8 9 : ; <޳ =̳ > ? @ [ \ \m ]b ^P ^E _< _/ `$ { { | } }ݲ ~ٲ  $OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ns_addr.c,v 1.4 1997/07/21 20:31:05 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.3 1997/07/09 01:08:39 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getnetnamadr.c,v 1.13 1999/06/04 06:38:10 niklas Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: setlocale.c,v 1.6 1997/07/09 01:08:21 millert Exp $K@7+  CCCCCCC$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: setmode.c,v 1.9 1998/11/18 23:28:34 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.3 1997/07/09 00:28:23 millert Exp $$OpenBSD: popen.c,v 1.9 1997/09/11 18:51:04 deraadt Exp $$OpenBSD: nlist.c,v 1.34 2000/10/12 12:47:58 art Exp $\3<;$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: glob.c,v 1.8 1998/08/14 21:39:30 deraadt Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $$OpenBSD: getpass.c,v 1.7 2000/01/13 19:36:21 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $$OpenBSD: getlogin.c,v 1.5 2000/01/06 08:24:16 d Exp $$OpenBSD: getgrent.c,v 1.13 2000/09/24 14:35:10 d Exp $$OpenBSD: getbsize.c,v 1.6 1998/06/23 22:40:25 millert Exp $$OpenBSD: fts.c,v 1.24 2000/08/24 17:04:12 deraadt Exp $$OpenBSD: fstab.c,v 1.8 1999/09/03 16:23:18 millert Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: disklabel.c,v 1.5 2000/07/19 15:25:13 deraadt Exp $JyFyAy9y4y/y)y#yyyy yyyxyyyyyyyyyyyJytylygyby^yYyRy yxyyyyyyyyyyyyyyyyyRyyy$OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: basename.c,v 1.4 1999/05/30 17:10:30 espie Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $lP$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $`̊L$OpenBSD: sscanf.c,v 1.3 1997/07/25 20:30:12 mickey Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $` $OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $u`@$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: gethostnamadr.c,v 1.42 2000/07/30 14:07:14 itojun Exp $$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.19 2000/04/25 19:11:48 deraadt Exp $T$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: getcap.c,v 1.16 1999/02/25 21:40:17 millert Exp $$OpenBSD: exec.c,v 1.11 2000/08/22 18:46:04 deraadt Exp $$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $X$OpenBSD: vfscanf.c,v 1.6 1998/01/20 21:25:39 millert Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $($OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $ $OpenBSD: res_query.c,v 1.13 1999/09/27 23:58:26 alex Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_init.c,v 1.19 2000/06/22 07:31:18 itojun Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: syslog.c,v 1.9 2000/01/02 23:35:58 hugh Exp $$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $fDgg@(#)strftime.c 7.62Lo$$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $$OpenBSD: res_debug.c,v 1.10 2000/07/07 20:59:47 deraadt Exp $ d'@Bʚ;$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $zrkigec[SJB90(ҿʿgec$OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: inet_pton.c,v 1.3 1999/12/08 09:31:15 itojun Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $,D @(#)localtime.c 7.70$OpenBSD: localtime.c,v 1.19 2000/04/16 16:24:03 d Exp $WILDABBR@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $,d$OpenBSD: wbuf.c,v 1.4 1997/05/31 22:41:32 tholo Exp $$OpenBSD: sprintf.c,v 1.4 1998/01/12 06:14:31 millert Exp $$OpenBSD: perror.c,v 1.3 1998/09/10 06:44:53 deraadt Exp $$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $ D Ll,$T<$ '4((<(H(P($OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $++x,-\-..$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.3 2000/02/21 22:11:22 millert Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $|5H788X99<:: ;x;>?T??<@|@@@????<@|@@@?@ABDEF$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $XSP]^^$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $lm$OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.4 1999/09/01 23:19:41 deraadt Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.4 1999/08/07 17:35:58 millert Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.3 1999/02/15 05:11:23 millert Exp $$OpenBSD: hash.c,v 1.8 1999/04/18 17:08:07 millert Exp $$OpenBSD: bt_open.c,v 1.7 2000/10/03 18:16:48 mickey Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_close.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: snprintf.c,v 1.6 1998/01/12 06:20:56 millert Exp $$OpenBSD: mktemp.c,v 1.13 1998/06/30 23:03:13 deraadt Exp $$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_func.c,v 1.5 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_buf.c,v 1.8 2000/10/03 18:16:48 mickey Exp $$OpenBSD: bt_put.c,v 1.6 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_delete.c,v 1.5 1999/02/15 05:11:22 millert Exp $@(#)bt_split.c 8.10 (Berkeley) 1/9/95$OpenBSD: bt_seq.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_search.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: mpool.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $| 0000000000000000$OpenBSD: fvwrite.c,v 1.10 1999/08/07 17:42:48 millert Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.2 1996/08/19 08:30:42 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:12:31 tholo Exp $`} E$OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $$!!bbbPbLbbbPb bbbPb$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $HJ$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $dK$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $tK$OpenBSD: infinity.c,v 1.3 1996/09/15 09:30:42 tholo Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp $PLTM$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.40 2000/04/10 19:36:29 deraadt Exp $`\a$OpenBSD: stdio.c,v 1.3 1997/11/09 23:40:41 flipk Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $$OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $l/!k$OpenBSD: sysctl.c,v 1.3 1997/08/24 21:25:46 millert Exp $l/!n<$p$OpenBSD: res_send.c,v 1.9 2000/06/22 07:31:18 itojun Exp $$OpenBSD: scandir.c,v 1.4 1998/08/14 21:39:32 deraadt Exp $$OpenBSD: rec_open.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_get.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_close.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: hash_page.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_bigkey.c,v 1.7 2000/10/03 18:16:48 mickey Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $P C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??# # Internet (IP) protocols # # $OpenBSD: protocols,v 1.11 2000/09/28 17:56:00 mickey Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # See also http://www.iana.org/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol ipv6 41 IPv6 # Internet Protocol version 6 sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 IPSEC-ESP # Encap Security Payload ah 51 IPSEC-AH # Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol mobileip 55 MOBILEIP # MobileIP encapsulation skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro# $OpenBSD: services,v 1.23 2000/04/27 15:28:10 millert Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. x400 103/tcp # ISO E-mail x400-snd 104/tcp csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp portmap rpcbind sunrpc 111/udp portmap rpcbind auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol loc-srv 135/tcp # NCS local location broker loc-srv 135/udp netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap 143/tcp imap2 # Internet Message Access Proto imap 143/udp imap2 # Internet Message Access Proto bftp 152/tcp # Background File Transfer Proto snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) photuris 468/tcp # Photuris Key Management photuris 468/udp isakmp 500/udp # ISAKMP key management submission 587/tcp msa # mail message submission submission 587/udp msa # mail message submission # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cswap: \ :pc#961632:oc#0: \ :ph#656208:oh#143136:bh#4096:fh#512:th=4.2BSD: rdroot|ramdiskroot|RAM-disk root FS image:\ :ty=ramdisk:se#512:nt#2:ns#128:nc#16:\ :pa#3510:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#0:ob#0:tb=swap:\ :pc#3510:oc#0: stallboot ${ROOTDISK} ) populateusrlocal test -x /mnt/upgrade.site && /mnt/usr/sbin/chroot /mnt /upgrade.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 rsd2c%rsd2d%rsd2e%rsd2f%rsd2g%rsd2h%rsd2i%rsd2j%rsd2k%rsd2l%rsd2m% rsd2n%!rsd2o%"rsd2p%#sd3a\%$sd3b\%%sd3c\%&sd3d\%'sd3e\%(sd3f\%)sd3g\%*sd3h\%+sd3i\%,sd3j\%-sd3k\%.sd3l\%/sd3m\%0sd3n\%1sd3o\%2sd3p\%3rsd3a%4rsd3b%5rsd3c%6rsd3d%7rsd3e%8rsd3f%9rsd3g%:rsd3h%;rsd3i%<rsd3j%=rsd3k%>rsd3l%?rsd3m%@rsd3n%Arsd3oBrsd3p%Dnst0\%Eest0\%Fenst0%Grst0\%Hnrst0%Ierst0%Jenrst0K st1Lnst1\%Mest1\%Nenst1%Orst1\%Pnrst1%Qerst1%Renrst1Scd0a\%Tcd0c\%Urcd0a%Vrcd0c%Wcd1a\%Xcd1c\%Yrcd1a%Zrcd1c%[mcd0a%\mcd0c%]rmcd0a^rmcd0cwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: dialer:*:117: nogroup:*:32766: nobody:*:32767: . etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP pim 103 PIM # Protocol Independent Multicast ipcomp 108 IPComp # IP Payload Compression Protocol vrrp 112 VRRP # Virtual Router Redundancy Protocol reserved 255 Reserved #  ...MAKEDEVconsoledrum\%kmem\% memnull\%xf86\%zero\% io tty klog\%!stdin%"stdout#stderr$ksyms%% lkm&tty00%'cua00%(tty01%)cua01%*tty02%+cua02%,tty03%-cua03%.ttyC0%/random0srandom1urandom2prandom3arandom4 wt0C st05nwt0\%6rwt0\%7nrwt0%8fd0a\%9fd0b\%:fd0c\%;rfd0a%<rfd0b%=rfd0c%>rd0a\%?rd0c\%@rrd0a%Arrd0c%Bwd0a\%Cwd0b\%Dwd0c\%Ewd0d\%Fwd0e\%Gwd0f\%Hwd0g\%Iwd0heJwd0i\%Kwd0j\%Lwd0k\%Mwd0l\%Nwd0m\%Owd0n\%Pwd0o\%Qwd0p\%Rrwd0a%Srwd0b%Trwd0c%Urwd0d%Vrwd0e%Wrwd0f%Xrwd0g%Yrwd0h%Zrwd0i%[rwd0j%\rwd0k%]rwd0l%^rwd0m%_rwd0n%`rwd0o%arwd0p%bwd1a\%cwd1b\%dwd1c\%ewd1d\%fwd1e\%gwd1f\%hwd1g\%iwd1h\%jwd1i\%kwd1j\%lwd1k\%mwd1l\%nwd1m\%owd1n\%pwd1o\%qwd1p\%rrwd1a%srwd1b%trwd1c%urwd1d%vrwd1e%wrwd1f%xrwd1g%yrwd1h%zrwd1i%{rwd1j%|rwd1k%}rwd1l%~rwd1m%rwd1n%rwd1o%rwd1p%wd2a\%wd2b\%wd2c\%wd2d\%wd2e\%wd2f\%wd2g\%wd2h\%wd2i\%wd2j\%wd2k\%wd2l\%wd2m\%wd2n\%wd2o\%wd2p\%rwd2a%rwd2b%rwd2c%rwd2d%rwd2e%rwd2f%rwd2g%rwd2h%rwd2i%rwd2j%rwd2k%rwd2l%rwd2m%rwd2n%rwd2o%rwd2p%wd3a\%wd3b\%wd3c\%wd3d\%wd3e\%wd3f\%wd3g\%wd3h\%wd3i\%wd3j\%wd3k\%wd3l\%wd3m\%wd3n\%wd3o\%wd3p\%rwd3a%rwd3b%rwd3c%rwd3d%rwd3e%rwd3f%rwd3g%rwd3h%rwd3i%rwd3j%rwd3k%rwd3l%rwd3m%rwd3n%rwd3o%rwd3p%bpf0\%sd0a\%sd0b\%sd0c\%sd0d\%sd0e\%sd0f\%sd0g\%sd0h\%sd0i\%sd0j\%sd0k\%sd0l\%sd0m\%sd0n\%sd0o\%sd0p\%rsd0a%rsd0b%rsd0c%rsd0d%rsd0e%rsd0f%rsd0g%rsd0h%rsd0i%rsd0j%rsd0k%rsd0l%rsd0m%rsd0n%rsd0o%rsd0p%sd1a\%sd1b\%sd1c\%sd1d\%sd1e\%sd1f\%sd1g\%sd1h\%sd1i\%sd1j\%sd1k\%sd1l\%sd1m\%sd1n\%sd1o\%sd1p\%rsd1a%rsd1b%rsd1c%rsd1d%rsd1e%rsd1f%rsd1g%rsd1h%rsd1i%rsd1j%rsd1k%rsd1l%rsd1m%rsd1n%rsd1o%rsd1p%sd2a\%sd2b\%sd2c\%sd2d\%sd2e\%sd2f\% sd2g\% sd2h\% sd2i\% sd2j\% sd2k\%sd2l\%sd2m\%sd2n\%sd2o\%sd2p\%rsd2a%rsd2b%md # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP efs 521/tcp # extended file name server timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # kerberos-sec 88/udp # Kerberos secondary port UDP kerberos-sec 88/tcp # Kerberos secondary port TCP klogin 543/tcp # Kerberos authenticated rlogin kshell 544/tcp krcmd # and remote shell ekshell 545/tcp # Kerberos encrypted remote shell -kfall ekshell2 2106/tcp # What U of Colorado @ Boulder uses? kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos-iv 750/udp kdc kerberos # Kerberos authentication--udp kerberos-iv 750/tcp kdc kerberos # Kerberos authentication--tdp kerberos_master 751/udp kerberos-master # Kerberos authentication kerberos_master 751/tcp kerberos-master # Kerberos authentication krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' kpop 1109/tcp # Pop with Kerberos eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth # # AFS Services # afs3-fileserver 7000/udp # AFS fileserver afs3-callback 7001/udp # AFS callback server afs3-prserver 7002/udp # AFS protection server afs3-vlserver 7003/udp # AFS volumelocation server afs3-kaserver 7004/udp # AFS kerberos authenication server afs3-volser 7005/udp # AFS volume server afs3-errors 7006/udp # AFS error server ? afs3-bos 7007/udp # AFS basic over-see server ? afs3-update 7008/udp # ? afs3-rmtsys 7009/udp # ? # # Unofficial services # supfilesrv 871/tcp # SUP server rsync 873/tcp # rsync server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting webster 2627/tcp # Network dictionary webster 2627/udp canna 5680/tcp # Kana->Kanji server icb 7326/tcp # Internet Citizen's Band hunt 26740/udp # hunt(6) # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol   [X= t1[ke\/bsd.old/obsd/bsd>> OpenBSD/i386 BOOT %s /etc/boot.confboot> booting %s: failed(%d). will try %s Turning timeout off. U WVS]5L1E0hhp>hPSShVh`}(PTX\Ãh7>[t1ۃh`h>5P5Xh`"#G LuE15LƃhVh`'V5h= }\[=\th=\0  p H  timesttysetrebootmachinelshelpenvechoboot#U`5\hhTu `4vopen(%s): %s non-secure %s, will not proceed %s: %s UlWVSj5T P3ǃ}2t_tZP~'Ph`h;1EPW .}uEt$h`h4;W3t`jVW4Ã~F< u}$5&Ph`hU^; F~ +ÅtWX3؍e[^_%s: syntax error US1ɻ4]d=`At< t< t<#]EdhQEPEud](xut Exu tE\-}t4QEPEuE0hz2:1cEE`Eh hdQtdBvӡdǀh`@Ћ]ÐU WVSu} WE1ۃ?tC<;u 8tS0WQu8uEe[^_ÐU WVSu}~x1[EEdu.Mb)ʍ)Gu[;E|cu4jhV"j FNV9QctN t<tA t0Ntt.@K9vѐjMK9w뺐CG9vjMK똉)E H9s C뇐jMjM h)؍e[^_UE@t' t u8t@ t t8u1 %sUS];t3h7 ;uj M]commands:Uh 7h4 machine:Uh>Q7h\-h1%s US;d} 4hhl7C;d|j jL1]%s speed is %d %s not a console device US=du jjMPjLPN5lMÃu5lhq6T=du jSMP5lhG6*1ҋ p TBA< vRSSM1]UXE=duEP)P51/.stat(%s): %s opendir(%s): %s UlWVS}Wlu P}P}%5 Ph`h o5E%f=@tWh`h`ƃ}&5 Ph`h 5`=`tC;u/CFWh`2}#5= Ph`h 4 WSRSVq}V1e[^_-fc-d-b---l-s-w-sSx-tT %u,%u %lu %s US] Cf - PICf-trR|ICf-twR]IC@tA t> B t? P(ICf-trR ICf-twRHCtA t> B t? PH-CtrPH-CtwPHCtA tD B tE PLHus0ss hG 2]ÐU=u1 %s:%sU=d~1l8-t'u`PIjst112j^uh`hPh h`1ÐUMʊt<:tBt<:u::uhQh`QhPh h`1`Rebooting... Uh 1lJ1rle4aD[tS|timeoutimagettydevicehowtoaddr%d U=dt5\hw1jj5l#\1>> OpenBSD/i386 BOOT %s %s UShh0=t!3h0CЃ ;u1]%s U=dthPh.W0j5lhP?1ÐU=dth`h.0h5lh`1%p U=dt5Xh/jj5lR"X1%s not a console device switching console to %s %s console not present US=dtjEPh.C/g5lEÃu5lh/95lh.SY t5lh).1]ÐU=d=Pt{j-DPt jaDPt jbCQt jcCPt jsCP@t jdCj C j61howto: bad option: %c boot: illegal argument %s UVS] P5d9h:-B:w|$\dl|t3+#@PhB:^Rh,C9 P1e[^empty %s=%s UVS=du+tP,h,5h5lD‰=tC;=u)9}ЍP tC; u;tCR5lVuuhv5ƃ=dupP5lhV+1e[^U WVSu ^ S$5NjE_VEPG P]]<G=<e[^_ÐU WVSU <t {[u9slj:<ut,S9s%RSV\s[t S2+E9re[^_1.26aoutL""#BIOSU,WVS] CEPUr0!4E-KMEPuVEp0Eu1UF!NMFE1vxE~`eEENdPjsuFЉÃ0uaUB09Et OEM1qx} u EIyEǀUr0MQ3؍e[^_ÐUWVSu ExWU D4U-E;|+0E};0}}u(E1MT9dU}E}tU9S(tj{uEp0N2C+EPEPsEp0GHdEPjEpBЃ uKUB09CZEC(K}~ ;EEM\UE1e[^_ÐUWVSEp~8UU!MV_P tE @N9wu;Fw_0]#^@#_LE;EPURMQ uw01}t8s*EPPSOdEPjMqBЅt`SjKREE U+]ME1ۋFV+V9wu9v v)ƋU21e[^_UWVSE pEP5?EFE1EPEPE PHut]}9sC;t3F(CC;EuCPEPtC9rEVVF9wu 9Fve[^_ÐU<WVSDžDžhO/hjPPU Jh /B(M ARRh jjq@ЉÃ0 u#\TuA0==`wP}1Qt@~DžE PjÃ.u> F>/t>B %f=@`1@=F>t/uPE PR`ÉM QQÃB %f=`zV[<:= ~ 7BPVPnU;(}W4quv0,PjE PÃ'&M QPPv0NdPjM qBЉÃ ugWPRT/t DžE PÃu >1ۃtr0Qw,t*h pZ,hRF,؍[^_ÐU WVSEX@tp13tCp03+Oy؃tCp0+h s+hS+1e[^_UWVS}EpEE E,E9vÃSuEP%SV])߃t1VF9w u%9FvEPEPEPEt}tE8Ee[^_UÐUWVSEu }U@tt .t%0x)0x!PH)HP[^_ÐUEM PB fAB|A ABRA0Q41ÐUWVS} EpuFVF9wu9Fw ~EPEPEPu`]U C9s;t))V9sF( CC@PCPW CV1e[^_ÐUWVS}9sЉ9sЉLu LJP,G0EU@04EGtÉEEUEEEEEUEU04MyGHЉ8<GLЉ@D[^_UtS]EPS} EE%f=@t#jSÃ| jjjS؋]ÐUE)w u  .u u Q@Уu1-ÐUuUVSjuÃ|u SƃSe[^UE 1ɋtfff=t tttfff=tY tLtfff= t1 t$tffft uÐUS] ACtfff= u = t 1CAC$C0yt AC<ACHCACtfff=t =uC%)‰SACC(A C4AC@ACAC A C,AC8CD1[+[%u+%d]U WVS} G8w w8h#w8VEP ;G8u:ƃjVEPu!t$SVEP9tރSh#,w 1e[^_non-secure file, check permissions! %u+%u=0x%x start=0x%x UWVSjuƃHEPV 0Eth$j 4SV GtSVЃtjLjTS9EX4T.SVG ЃE `hh$jl1RPVc 4hE dPV3;h tt]Ph$jx1RPV tE pPV;tuh$!ujE |PDE |E` Gt&SVЃtuO?\`h$E PuTP uV[^_SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%s %s %d %d:%d:%d %d UWVSE<ؙU)Ӊ)Љ))É]Ӻ*)R)É]ӍK$I)Ɖ))ƹl~`u Q)9u Q)9u Ò ÓAlC1';'v +G;w~Fu Q)9u Q)9uKQUREPURS w h''Pw L''Ph'he[^_UVSU] Mփr CBu[^bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %dUUBW$@+,,---,-,------------- ------------------------------------------------,--------,---,,,,,,))y)q*i*a2*Y<*QR*Ij*A*9*1*)*!*Rh +h,Y,USEM @At t8t)‰[-l.---/memorydiskinfobootU1Ðmachine boot {fd,hd}<0123>[abcd] Where [0123] is the disk number, and [abcd] is the partition. Booting from %s [%x,%d] [%x] Invalid device! UVS=dth-h- l&PR?h/G;=dHj>1e[^_entry point at 0x%x UWVS]lE @EUBRjj?EPVC%CPh0OVu585s jWE PCprobing: Ujg5h|1 7@9h1 UE)w u  *uu Q@У1-UWVS}MEA߃]w}-uEUE}+uEAtu}0utE}~E @FF EEPuV-Ãu ~Et8uEEF EuE;$}@EVuЉÃtttEEE;$|ͅuFV@ e[^_U WVSE] uU)w u  :tLt%u!+YGWRVSW@Ѝe[^_U WVSE)11w u  WutS@ЉƃuCt S@ Љt 5u1 =e[^_UUÐUEEPu hh?BUE PuhUUu uhUÐU WVS}4VEЃE 0E %u1ۋE 0FE $4@@(AlABBBBBBB@BBAABBGP_3CVEЃ3Cuw}j-Eރj VEPlwjVEPOwj VEP3j0EЃjxEC wjVEPKj%EЃjlEЃe[^_0123456789abcdefUWVSE u]18BCȅu됐KPEЃ9we[^_|/-\U=u(|BP|OjERAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs fd%uUVS1hVhC CC PS0 t KKǃttütF?hÃhjSX&SV~_jS0e[^+ hd%u%s*U WVSE1C{~DPPhDC PSK thDF1҃@C$uEEK%|1҉FKK1҉pC SǃttütG?hÃhjS%SW7jSe[^_disk: UWVShEptp1ېSCt~@1ۡpEtCUUuCSE1ۋ pMt,1Ґu<E CEEuىUCh@jj MQSjhEe[^_ÐUUpt9t u1ÐDisk BIOS# Type Cyls Heads Secs Flags Checksum *none*%cd%d 0x%x %s %d %d %d 0x%x 0x%x UShGpt^sss ssCuC$HGPRЃPf}hPhXG0u]Uuu1ÐUWVS}Eh Ƌp;CK KEUЙ{ VjRPEP3jP t KKhVsACp9t':}BuB9CuE9u܋ZEe[^_heap full (0x%lx+%u)U WVS]1=t9r tT9srzuu< wSD= vSQhI AAe[^_UUBUU131҄tU WVSu EPU3ـ?׉~N^ uREG~ANFtU3t"u~tFt~ t v1e[^_ÐU VSEUM]EfM]EUC}uBuU 31҄t[^ÐUWVSU } E %9t*Wƃ}tWE PVH&u EUUMMh}uEEU Meu MA31҄tӅtu1E Pmr{;u t}uWVU R%Se[^_failed to read disklabelbad MBR signature no BSD partition U WVSuFV >11WjRPj6j` tPf}Ut L111ҐM€< u:C@u+~11Ґ< u\*C@u ~LZhNjN N11v WjRPQ6j0uu W K[^_Unknown device: Bad unit number Bad partition id %s UWVS} E@{:t{:t CESEE;HT}"+PV7 u؋E;HT|Eh\M;:tPC;:uj S/< vhmMGU pC<vh~M VE;t E}t.}t}t}u πWÉlC ֋M ΁% ʁCt5C PW=ttPhMBW EX1e[^_Ðinvalid function/parameteraddress mark not foundwrite-protectedsector not foundreset faileddisk changeddrive parameter activity failedDMA overrun data boundary error bad sector detected bad track detected invalid mediacontrol data address mark detectedDMA arbitration level out of rangeuncorrectable CRC or ECC error on read controller failure1no media in drive2incorrect drive type in CMOS@seek failedoperation timed outdrive not readyvolume not locked in drivevolume locked in drivevolume not removablevolume in uselock count exceededvalid eject request failedundefined errorwrite faultstatus register errorsense operation failedUMO=OtO9tBu:t9uB  [ [  ] ^12UMu11tR=tRttR9t:t9uBÐU,WVSU}EEm }t:|rLur BEUEumcMΉ1Eщ1EыE+E9r)˃EPSQUREPURE P_ ] ]uU9Ur}t U EPe[^_ÐUE@1ÐU1ZX)ĉqq1Pwdfdwtsdstcdmcdscdhdacdcncompc U WVS}E (M1;<},EPWFЉƒu w1C;<|uwЍe[^_ÐUEU }hfBdB$0BaBUE tn t( t>x t[unjj  jtSHKj PШu(PPÐUSdà u  ut S(؋]%s%dUBPBLTPhUhxXxÐU WVSEEPEp;urz@&N}|MDBBЉE;urQWEVu WEVt u< W5fwV t We1 9vЍe[^_USE] UJu1CMt. t(r#8Mu@CMt t r8Mt)‰[UUЀ:t @8u) U=uJ E Pugh0X> jexitUhvX pc%dUE@@ jhXUÐU}|16 6%ÐUSE 0[ com%dU WVS}1 19}VhYjF9|tGGe[^_UEP4ÐUS]}44f|%[Ðcom%d: changing speed to %d baud com%d: change your terminal to match! com%d: will change speed in 5 seconds....  com%d: console is at %d baud U WVSu}  G=w\KtuNKuP~.˺ ЙQ}؃~ t29pu-9=t%%PPWPhY~j`%Y%Y%YB%YWVhPZ=؍e[^_UVSu ]4 t 4[^f4frdPd^1Ð^\؎Ў^_ ____$_*_0_6_:_@_D_H_L_P__T_Z_^______________g_k_o_s_w_{_________________________________`` ` `````!`%`8\'^jj\jjVjjPjj JjjDjj >jj 8jj2jj ,j (jj"jjjjjjjjjYj|jxjtjpjljhjdj`j\j Xj Tj Pj Lj HjDj@jt SC~e[^;Zx0NmUSE] :+KsSuZˆSˆSSˆSSˆS1[UWVSEEPhc}WhGEW4_OEEE@EE@ENЍEa<wMJu Q)9u Q)9uGN]MEЉ)Ѝ)<e[^_ÐUS]9|1[`PPPPD$<D$<aϐ؎D$0D$,D$(D$$D$ D$D$D$D$uC;U9E ~"9U};U M S)ȉCC {u,{CES)E M KK 1e[^_ÐUxt xuh-@ЉЉDPjrUVSuUM 9s"э2JtKIJuACJu[^: connect error apmU WVSS15 Ȅu =TMPt1S15S15ÈE֣ 5t fgTfE+]ɉ)ʉ)Уwց5S51thqhqhj je[^_ÐU%PRFUUtBu8BBB1Ƀx tjRBp1ÐUS]t Ct{$u .xtSpss(C$C1]ÐUVS]u Et 81u}8t u C{ uC 4C({$uC$4jjs(C ЉC@C@ } ދC@ FvSXCpPC1҃x uRS‹CPtSR1Se[^ÐUuu juunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkUWVS]{;E} uES Z$u vrvvwFwtwwwBxlxxxyyC}HCCBtC CuSB;Bv C+uCJ}HCCEsNB))9t C?u.E u C}SHCCBCC}SHCCBCCv}SHCCBCCHSHCCBSBC0} CVuC@\WSCpǃuC C@u}}SBPSrCx t Ct~}SHCCBC CtT}SHCCBC Ct*}SHCCBC Cu^}SHCCBSB9Bt CfuC@ e[^_ÐU WVSu ]߃}tUBt8t dSVjU;B0t CE@0PJtX)SVrUB1e[^_U WVS}tGu 8 t G@_uz΋GPw+:yuBt1 )ЉAKtv։)G_GPu#_wW_wG1e[^_ÐUEt@t@u P/     UVS]u UtC<ws v(F$Ѓ;uVs$CC C(C4C0C8tjjjЉCE Puuuu  u5U܉V ~EԋM AE+AU؉MЉN4jE PFU܉V ~EԋM AE+AU؉MЉN4EPU RVEt PEE Pv*U U؋M IMԋF E܋~V4UЃF09s)HE N,+MЉM̃~u EЉF4URM QVEF4EЃF0;Et7U܉V ~EԋM AE+AU؉MЉN4EPU RM܉N ~UԋE PE؋M +AE؉UЉV4jM܉N ~UԋE PE؋M +AE؉UЉV4jcM܉N ~E @E؋U +BM؉ EЉF4UR)E܉F ~U BE+BM؉ EЉF4URE܉F ~U BE+BM؉ EЉF4URE܉F ~U BE+BM؉ EЉF4URE܉F ~U BE+BM؉ EЉF4UR[E܉F ~U BE+BM؉ EЉF4UR+E܉F ~MԋU JE+BE؉UЉV4jM QV|e[^_UVSu] jSVv(s(C$Ѓv$s(C$ЃVs(C$1e[^ÐUVSu]Su v(^(^4^0e[^ÐUE8 UVS11ɐ)A v1ɐʻt 1KyA~[^ÐU=tÐU WVS]u }u 1=tNӃ23F23F23F23F23F23F23F23Fwt23FOuӉ[^_qU WVSEu }ɉ v)׃FFFFFFFFF F F F F FF˃rt FJuUmU +UU)ѡUmU +UU)Ӆ ˉ[^_ inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` UWVSM UEEĉEEEEEEEEEEEEEEE}u Nu] 9]uE1I0}u Cw<t490s0}u Nt E<t<90v00Džӥ;@uC B‰S% M AėUEP xEAE+AUMq4jE PQSU9s.} EMM EE;}rԋEU#C m)E+P(C 9s)ЋUJ,)Mu)E{}E@,E9u%UB0R(9t9s )HE M)M}utEp4URM QPEEp4P09s)H MA,)EMI,M9u MA(9t9s)JUE)E}"EUEFMEM;A,uQ(UCHK}E@,E9u%UB0R(9t9s )HE M)M}Ep4URM QPEEp4P09s)H MA,)EMI,M9u MA(9t9s)JUE)E}u>MUJ zUE PEM +AEUr4MQE P\ECFMYv EMUr4MQE PREUr4B09t8EMA yMU JE+BEUr4MQE PMUJ zUE PEM +AEUr4jEMA yMU JE+BEUr4j[UEP xM AE+AEUr4MQE P$MUJ zE @EU +BM Ep4URM QPUEP xM AE+AEUr4MQE PMUJ zE @EU +BM Ep4URM QPlUEP xEM AE+AUMq4EPU RQ4EMA yMU JE+BEUr4jM QRe[^_ÐUE up(@$invalid distance codeinvalid literal/length codeU,WVSEEURUMy qA4EA09Es +EHEUJ,+MMUUU UMU Ev#EMB)ƋEeM#Z)΃wMU Ev#EMEB)ƋEe;us"MM Me }E;urM#B))]UM+Q(9r"U)ŠMBEMBE2)ЉEEP,+U;]v+]䐐 EBEMuMQ(MBEKuuE@uB‰M#UB4Z+]9v)]My )Ɖq]EXEU+BM UEP4NM@u@B‰#E.J)ΊBUEMM tPEX+]9v)]Uz )Ɖr]MYE+AEMJ4E@JX+]9v)]Uz )Ɖr]MYE+AEMJ4[}v } :EX+]9v)]Uz )Ɖr]MYE+AEMJ41[^_U WVS}E @ Ew0G49w_,)U B9vÅt }uE)؋U BZG8tSVw<ЉGC:C5C.CBBCCCCCCCCCCCCCCCCC.CCC% `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c#a  n}www*CCHTTP server/var/www/sbin/nologin2\Wnamed*FFBIND Name Service Daemon/var/named/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3FaSanobody*Unprivileged user/nonexistent/sbin/nologin2bin*Binaries Commands and Source,,,//sbin/nologin1bintrootdaemonCharlie &/root/bin/csh2rootdaemonCharlie &/root/bin/csh3e` daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2# Disk geometry and partition layout tables. # Key: # dt controller type # ty type of disk (fixed, removeable, simulated) # d[0-4] drive-type-dependent parameters # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # sc #sectors/cylinder, ns*nt default # su #sectors/unit, sc*nc default # se sector size, DEV_BSIZE default # rm rpm, 3600 default # sf supports bad144-style bad sector forwarding # sk sector skew per track, default 0 # cs sector skew per cylinder, default 0 # hs headswitch time, default 0 # ts one-cylinder seek time, default 0 # il sector interleave (n:1), 1 default # bs boot block size, default BBSIZE # sb superblock size, default SBSIZE # o[a-p] partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # t[a-p] partition types (filesystem, swap, etc) # # All partition sizes reserve space for bad sector tables. # (5 cylinders needed for maintenance + replacement sectors) # qp120at|Quantum Peripherals 120MB IDE:\ :dt=ESDI:ty=winchester:se#512:nt#9:ns#32:nc#813:sf: \ :pa#13824:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#13824:ob#13824:tb=swap: \ :pc#234144:oc#0: \ :ph#206496:oh#27648:th=4.2BSD:bh#4096:fh#512: pan60|Panasonic Laptop's 60MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#13:ns#17:nc#565:\ :pa#13260:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#13260:ob#13260:tb=swap: \ :pc#124865:oc#0: \ :ph#97682:oh#26520:th=4.2BSD:bh#4096:fh#512: mk156|toshiba156|Toshiba MK156 156Mb:\ :dt=SCSI:ty=winchester:se#512:nt#10:ns#35:nc#825:\ :pa#15748:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#15748:ob#15748:tb=swap:\ :pc#288750:oc#0:\ :ph#257250:oh#31500:bh#4096:fh#512:th=4.2BSD: cp3100|Conner Peripherals 100MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#12144:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#12144:ob#12144:tb=swap: \ :pc#202224:oc#0: \ :ph#177936:oh#24288:th=4.2BSD:bh#4096:fh#512: # a == root # b == swap # c == whole disk # e == /var # f == scratch # h == /usr cp3100new|Conner Peripherals 100MB IDE, with a different configuration:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#15840:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#24288:ob#15840:tb=swap: \ :pc#202224:oc#0: \ :pe#15840:oe#40128:te=4.2BSD:be#4096:fe#512: \ :pg#15840:og#55968:tg=4.2BSD:bg#4096:fg#512: \ :ph#130416:oh#71808:th=4.2BSD:bh#4096:fh#512: floppy288|3in|3.5in High Density Floppy, 2.88MB:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#36:nc#80:\ :pa#5760:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#5760:ob#0:\ :pc#5760:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2880:ob#0:\ :pc#2880:oc#0: floppy5|5in|5.25in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#15:nc#80:\ :pa#2400:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2400:ob#0:bb#4096:fb#512:\ :pc#2400:oc#0:bc#4096:fc#512: maxtor4380|Maxtor XT4380E ESDI :\ :dt=ESDI:ty=winchester:se#512:nt#15:ns#36:nc#1222:sf: \ :pa#21600:oa#0:ta=4.2BSD:ba#4096:\ :pb#21600:ob#21600:tb=swap: \ :pc#659880:oc#0: \ :pe#216000:oe#53200:te=4.2BSD:be#4096:fe#512: \ :ph#398520:oh#269200:th=4.2BSD:bh#4096:fh#512: miniscribe9380|compaq38|Miniscribe 9380 ESDI :\ :ty=winchester:dt=ESDI:se#512:nt#15:ns#35:nc#1223:rm#3600:sf: \ :pa#21000:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#42000:ob#21000:tb=swap: \ :pc#642075:oc#0: \ :pe#21000:oe#63000:be#8192:fe#1024:te=4.2BSD: \ :ph#556500:oh#84000:bh#8192:fh#1024:th=4.2BSD: ida4|compaq88|Compaq IDA (4 drives) :\ :ty=winchester:dt=IDA:se#512:nt#16:ns#63:nc#1644:rm#3600:\ :pa#20160:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#80640:ob#20160:tb=swap: \ :pc#1659168:oc#0: \ :pe#201600:oe#100800:be#8192:fe#1024:te=4.2BSD: \ :pf#20160:of#1310400:bf#8192:ff#1024:tf=4.2BSD: \ :ph#1008000:oh#302400:bh#8192:fh#1024:th=4.2BSD: \ :pg#302400:og#1330560:bg#4096:fg#512:tg=4.2BSD: fuji513|Fujitsu M22XXXX: \ :ty=winchester:dt=ESDI:se#512:nt#16:ns#63:nc#954:rm#3600:\ :pa#20160:oa#82656:ba#4096:fa#512:ta=4.2BSD: \ :pb#40320:ob#102816:tb=#!/bin/sh # # $OpenBSD: dhclient-script,v 1.11 2000/10/18 23:42:56 todd Exp $ # if [ "x$new_network_number" != "x" ]; then echo "New Network Number: $new_network_number" fi if [ "x$new_broadcast_address" != "x" ]; then echo "New Broadcast Address: $new_broadcast_address" fi if [ "x$reason" = "xMEDIUM" ]; then ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 exit 0 fi if [ "x$reason" = "xPREINIT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 \ broadcast 255.255.255.255 up exit 0 fi if [ "x$reason" = "xARPCHECK" ] || [ "x$reason" = "xARPSEND" ]; then exit 0; fi if [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xRENEW" ] || \ [ "x$reason" = "xREBIND" ] || [ "x$reason" = "xREBOOT" ]; then if [ "x$old_ip_address" != "x" ] && [ "x$alias_ip_address" != "x" ] && \ [ "x$alias_ip_address" != "x$old_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ] && [ "x$old_ip_address" != "x$new_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' |sh fi if [ "x$old_ip_address" = "x" ] || \ [ "x$old_ip_address" != "x$new_ip_address" ] || \ [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xREBOOT" ]; then ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi fi if [ "x$new_ip_address" != "x$alias_ip_address" ] && [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi if [ "x$new_domain_name" != "x" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf for nameserver in $new_domain_name_servers; do echo nameserver $nameserver >>/etc/resolv.conf done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf fi exit 0 fi fi fi if [ "x$reason" = "xEXPIRE" ] || [ "x$reason" = "xFAIL" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete $old_ip_address 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 fi if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi exit 0 fi if [ "x$reason" = "xTIMEOUT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium sleep 1 if [ "$new_routers" != "" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "x$new_ip_address" != "x$alias_ip_address" ] && \ [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi if [ "$new_domain_name" != "" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf.std for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then rm -f /etc/resolv.conf fi mv /etc/resolv.conf.std /etc/resolv.conf exit 0 fi fi fi fi ifconfig $interface inet -alias $new_ip_address $medium for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 exit 1 fi exit 0 # # $OpenBSD: termcap.pcvt,v 1.1 1999/08/06 20:49:08 deraadt Exp $ # pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: pcvt25|pcvt|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: ts $THESETS # Copy in configuration information and make devices in target root. echo cd /tmp echo -n "Copying " for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "$file, " cp $file /mnt/etc/$file rm -f $file fi done echo " ...done." if [ -f /etc/dhclient.conf ]; then echo -n "Modifying dhclient.conf..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link." else echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / remount_fs /tmp/fstab.shadow md_installboot ${ROOTDISK} _encr=`echo ${_password} | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 populateusrlocal test -x /mnt/install.site && /mnt/usr/sbin/chroot /mnt /install.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 # $OpenBSD: dot.profile,v 1.3 2000/10/25 16:38:12 millert Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing alias dmesg="cat /kern/msgbuf" # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # editors believed to be in $EDITBIN, smart and dumb defaults EDITBIN=/bin EDITUBIN=/usr/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /dev/rd0a / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T 9600 # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi # $OpenBSD: install.md,v 1.8 2000/06/23 18:53:24 mickey Exp $ # # # Copyright rc) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS=kernel md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [pcvt25]: " getresp pcvt25 TERM=$resp export TERM } md_makerootwritable() { : } md_machine_arch() { cat /kern/machine } md_get_diskdevs() { # return available disk devices bsort `cat /kern/msgbuf | egrep "^[sw]d[0-9]+ " | cutword 1` } md_get_cddevs() { # return available CDROM devices bsort `cat /kern/msgbuf | egrep "^cd[0-9]+ " | cutword 1` } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { echo echo -n "Do you expect to run the X Window System? [y] " getresp y case "$resp" in y*|Y*) xfree86=y ;; *) ;; esac echo } md_installboot() { echo Installing boot block... cp /usr/mdec/boot /mnt/boot /usr/mdec/installboot -v /mnt/boot /usr/mdec/biosboot ${1} if [ "$xfree86" = y ]; then echo echo "Enabling machdep.allowaperture. Read xf86(4) for more information." echo '1,$s/^#machdep\.allowaperture=1/machdep\.allowaperture=1 / w q' | ed /mnt/etc/sysctl.conf 2> /dev/null echo fi } md_native_fstype() { echo msdos } md_native_fsopts() { echo ro } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel -r $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 _whole=$2 if [ -n "$_whole" ]; then echo echo Updating MBR based on BIOS geometry. fdisk -e ${_disk} << __EOC reinit update write quit __EOC else echo cat << __EOT A single OpenBSD partition with id 'A6' ('OpenBSD') should exist in the MBR. All of your OpenBSD partitions will be contained _within_ this partition, including your swap space. In the normal case it should be the only partition marked as active. (Unless you are using a multiple-OS booter, but you can adjust that later.) Furthermore, the MBR partitions must NOT overlap each other. [If this is a new install, you are most likely going to want to type the following fdisk commands: reinit, update, write, quit. Use the 'manual' command to read a full description.] The current partition information is: __EOT fdisk ${_disk} echo fdisk -e ${_disk} fi echo Here is the partition information you chose: echo fdisk ${_disk} echo } md_prep_disklabel() { local _disk=$1 echo -n 'Do you want to use the *entire* disk for OpenBSD? [no] ' getresp "no" case $resp in y*|Y*) md_prep_fdisk ${_disk} Y ;; *) md_prep_fdisk ${_disk} ;; esac cat << __EOT Inside the BIOS 'A6' ('OpenBSD') partition you just created, there resides an OpenBSD partition table which defines how this BIOS partition is to be split up. This table declares the offsets and sizes of your / partition, your swap space, and any other partitions you might create. (NOTE: The OpenBSD disk label offsets are absolute, ie. relative to the start of the disk... NOT relative to the start of the BIOS 'A6' partition). __EOT md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If this disk is shared with other operating systems, those operating systems should have a BIOS partition entry that spans the space they occupy completely. For safety, also make sure all OpenBSD file systems are within the offset and size specified in the 'A6' BIOS partition table. (By default, the disklabel editor will try to enforce this). If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/i386 ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT Welcome to the OpenBSD/i386 ${VERSION_MAJOR}.${VERSION_MINOR} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. If you hit Control-C and restart the install, the install program will remember many of your old answers. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT } hostname() { case $# in 0) cat /kern/hostname ;; 1) echo "$1" > /kern/hostname ;; *) echo usage: hostname [name-of-host] esac } #!/bin/sh # $OpenBSD: install.sh,v 1.74 2000/06/16 03:19:42 deraadt Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN= # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." echo ;; *) md_not_going_to_install exit ;; esac fi echo "You can run a shell command at any prompt via '!foo'" echo "or escape to a shell by simply typing '!'." echo # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp break ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) donetconfig ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab # XXX We no longer do the following. It is not neccessary. It can be done # XXX after the install is complete. # # echo "The fstab is configured as follows:" # echo # cat /tmp/fstab # cat << \__fstab_config_1 # #You may wish to edit the fstab. You may also wish to take this opportunity to #place NFS mounts in the fstab (this would be especially useful if you plan to #keep '/usr' on an NFS server. #__fstab_config_1 # echo -n "Edit the fstab with ${EDITOR}? [n] " # getresp "n" # case "$resp" in # y*|Y*) # ${EDITOR} /tmp/fstab # ;; # # *) # ;; # esac # # echo munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow "-o async" fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp= # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_password}" stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done md_questions install_se#!/bin/sh # $OpenBSD: upgrade.sh,v 1.15 2000/05/12 06:02:13 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK= # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp= # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" test -d /mnt/etc/mail || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << \__rc_edit 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __rc_edit fi echo -n "Making devices..." cd /mnt/dev sh MAKEDEV all echo "done." md_in#!/bin/sh # $OpenBSD: install.sub,v 1.158 2000/10/09 22:47:22 naddy Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK= # filled in below VERSION=28 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR # extra "site" set can be provided by person doing install ALLSETS="base etc misc comp man game xbase xshare xfont xserv site" # install UPGRSETS="base misc comp man game xbase xshare xfont xserv site" # upgrade SNAPSETS="bin dev etc games man misc sbin \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above # Path searched for sets by install_sets on the local filesystems local_sets_dir= # decide upon an editor if [ "X$EDITOR" = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { local _shell_aware=0 local _no_shell=0 # -s option means exit after a shell (caller is shell-aware) if [ "$1" = "-s" ]; then _shell_aware=1 shift fi # -n option means don't try to run shell commands if [ "$1" = "-n" ]; then _no_shell=1 shift fi set -o noglob valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ ${_no_shell} -eq 1 ]; then test -z "$resp" && resp=$1 else case "$resp" in "") resp=$1 ;; !) echo "Type 'exit' to return to install." sh test $_shell_aware -eq 0 && continue ;; !*) eval ${resp#?} test $_shell_aware -eq 0 && continue ;; esac fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done set +o noglob } isin() { # test the first argument against the remaining ones, return succes on a match local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { # add first argument to list formed by the remaining arguments # adds to the tail if the element does not already exist local _a=$1 _seen= shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen="yes" fi shift done if [ "X$_seen" = "X" ]; then echo "$_a" fi } rmel() { # remove first argument from list formed by the remaining arguments local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { # read lines on stdin, return Nth element of each line, like cut(1) local _a _n _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a test "$1" = "" && break eval echo \$$_n done IFS="$_oifs" } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { # return available network devices /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } bsort() { local _l _a=$1 if [ $# == 0 ]; then return fi if [ $# == 1 ]; then echo $1; return fi shift while [ $# != 0 ]; do local _b=$1 if [[ "$_a" != "$_b" ]] ; then if [[ "$_a" > "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n "$_a "; bsort $_l } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list=$1 _file shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host=$1 _user=$2 _pass=$3 _dir=$4 shift; shift; shift; shift ftp ${_ftp_active} -V -n $_host << __ptf user $_user $_pass cd $_dir ls quit __ptf } get_localdir() { # $1 is relative mountpoint local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __EOT The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __EOT echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir= break ;; esac fi done } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which one? [done] " getresp "" if [ "X${resp}" = "X" ]; then DISK=done elif [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK="$resp" else echo echo "The disk $resp does not exist." DISK= fi } getrootdisk() { cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: __EOT local _defdsk; _DKDEVS=`md_get_diskdevs` _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi echo "$_DKDEVS" echo echo -n "Which disk is the root disk? [${_defdsk}] " getresp "${_defdsk}" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo echo "The disk $resp does not exist." ROOTDISK= fi } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the symbolic name already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/ $2.$FQDN $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2.$FQDN $2" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives # Create a hostname.* file for the interface. if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configurenetwork() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= # force at least one iteration while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __EOT for _ifs in $_IFS; do if [ "X${_ouranswer}" = "X" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or, enter 'done') [$_ouranswer] " getresp "$_ouranswer" case "$resp" in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer="done" if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: \"$resp\" is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported" echo else _dhcp_prompt=" (or 'dhcp')" fi # Get IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address${_dhcp_prompt} ? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp= if [ "X${_if_mask}" = X"" ]; then _if_mask=255.255.255.0 fi while [ "X${resp}" = X"" ]; do echo -n "Netmask ? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then echo "Your use of the network interface may require non-default" echo "media directives. The default media is:" ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' echo "If the default is not satisfactory, and you wish to use another" echo "media, copy that line from above (e.g. \"media 100baseTX\")" echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ "X${resp}" != X"" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up ; then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -am echo if [ "X${_resolver_enabled}" = X"TRUE" ]; then route show echo echo "Resolver enabled." else route -n show echo echo "Resolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next= _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " _next= else echo -n " [ ] " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name? [$_next] " getresp "$_next" } # Do globbing on the selection and parse +/-, sets _get_files and _setsdone # (which must exist in the local namespace) as side effects. glob_selection() { local _selection="$1" _parent_dir="$2" _sets="$3" local _action _matched _tfile _f if [ "X${_selection}" = X"" ]; then return fi # Change +/- into add/remove _action=add case "$_selection" in +*) _selection="${_selection#?}" ;; -*) _selection="${_selection#?}" _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ # safe in single user mode cat >$_tfile << OOF case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac OOF set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then echo "File $_parent_dir/$_selection does not exist. Check to make" echo "sure you entered the information properly or enter 'list' for a file list." fi } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. local _sets _kernel _f _file_list _get_files _failed_files _osetsdone local _url_type _url_base _reuse _minpat # Parse arguments, shell style while test $# != 0; do case "$1" in -ftp) _url_type=ftp ;; -html) _url_type=html ;; -reuse) _reuse=1 ;; -minpat) shift; _minpat="$1" ;; esac shift done if [ X"${_minpat}" = X ]; then _minpat='base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd' fi echo echo "This is an automated ${_url_type}-based installation process. You will be asked" echo "questions and then the files will be retrieved iteratively via ftp(1)." echo # Reuse old values w/o prompting for anything? if [ X"$_reuse" = X"1" ]; then _reuse= if eval test X"\$_installed_via_${_url_type}" = X"1"; then echo -n "Use values from previous ${_url_type} install? [y] " getresp y case "$resp" in y*|Y*) _reuse=1;; esac fi fi if [ X"$_reuse" = X ]; then # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. \"http://proxy:8080\", or \"none\") [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use active mode ftp? (irrelevant if using a proxy) case "${_ftp_active}" in -A) resp=y ;; *) resp=n ;; esac echo "By default, ftp will attempt a passive connection and fall back to a normal" echo "(active) connection if that doesn't work. However, there are some very" echo "old ftp servers that claim to support passive mode, but really do not." echo "In this case, you should explicitly request an active session." echo -n "Do you want to use active ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers test -z "$_ftp_getlist" && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp $_ftp_getlist case "$resp" in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" -a `isnumeric $resp` -eq 1 -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ]; then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path="${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp= # do it again, just to double check echo "Using $tline" else eval _${_url_type}_server_ip="$resp" fi done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password unless anonymous if [ ${_ftp_server_login} != "anonymous" ]; then resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_ftp_server_password}" stty echo echo _ftp_server_password=$resp done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi fi fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then _url_base=ftp://${_ftp_server_login}:${_ftp_server_password}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V ${_url_base}/index.txt | sed 's/ //'` fi _sets= if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo echo "${_file_list}" echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the files listed,\\\\n"\ "you may select any file located at\\\\n"\ " \$_${_url_type}_server_ip:\$_${_url_type}_server_dir\\\\n"\ "You can also enter \'all\' to install all the standard sets, or \'list\' to list\\\\n"\ "the files available. When you are done selecting files, enter \'done\'. Some of\\\\n"\ "these sets are required for your ${MODE} and some are optional -- you will want\\\\n"\ "at least the base and bsd sets. Consult the installation notes if you are not\\\\n"\ "sure which sets are required!" _osetsdone="$_setsdone" # Set the minimal default for _f in $_sets $_kernel; do eval "case $_f in \ ${_minpat}) \ if ! isin \${_f} \${_setsdone}; then \ _get_files=\`addel \${_f} \${_get_files}\` ; \ _setsdone=\`addel \${_f} \${_setsdone}\` ; \ fi ;; \ esac" done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_sets $_kernel\" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi # Stash the fact that we configured and downloaded via this url method eval _installed_via_${_url_type}=1 echo echo "Fetching files via ${_url_type} may take a long time, especially over a slow network" echo -n "connection. Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." if [ "X${_f}" = "X${_kernel}" ]; then ( cd /mnt ; ftp ${_ftp_active} -V -m ${_url_base}/${_f} ) else ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | tar zxpf - ) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of refetching failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_failed_files\" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _sets= _kernel _f _get_files _failed_files _osetsdone if [ ! -d $1 ]; then echo "No such directory: $1" return fi if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= _sets=`cd $1 ; echo *.tar.gz *.tgz` if [ "X${_sets}" = X'*.tar.gz *.tgz' ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo ( cd $1 && ls ) echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi echo "\n"\ "You will now be asked for files to extract. In addition to the\n"\ "files listed in the selector you may enter any file located in\n"\ "$1. You can also enter 'all' to install all the standard\n"\ "sets, or 'list' to list the files avilable in $1.\n"\ "When you are done selecting files, enter 'done'.\n"\ "Some of these sets are required for your ${MODE} and some are optional --\n"\ "You will want at least the base and bsd sets.\n"\ "Consult the installation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) continue fi glob_selection "$resp" "$1" "$_sets $_kernel" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo -n "Ready to extract selected file sets? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Extract the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "$1/${_f}:" if [ "X${_f}" = "X${_kernel}" ]; then ftp -V -m -o /mnt/$_f file:$1/$_f else ftp -V -m -o - file:$1/$_f | (cd /mnt; tar -zxpf -) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of retrying failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to extract correctly:" echo "Choose which one(s) to retry or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) echo continue fi glob_selection "$resp" "$1" "$_failed_files" done done } install_cdrom() { local _drive _range _part _fstype _directory _n # Get the cdrom device info _CDDEVS=`md_get_cddevs` if [ "X${_CDDEVS}" = X"" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # If it is an ISO9660 CD-ROM, we don't need to ask any other questions _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do # Try up to 6 times to access the CD if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else # Get partition from user _range=`md_get_partition_range` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n 'CD-ROM partition to mount (normally "c")? [c] ' getresp c case "$resp" in $_range) _part=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done fi rm -f /tmp/label.$_drive # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _directory _md_fstype _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype="_undefined_" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [default] " getresp "default" case "$resp" in default) _fstype= _fsopts="ro" ;; ffs) _fstype="-t $resp" _fsopts="async,ro" ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp= ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= # force loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath= fi cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __EOT if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "What timezone are you in? [\`?' for list] [$TZ] " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls -F ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls -F ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel--this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT Something needed to complete the installation seems to be missing, did you forget to extract a required set? __EOT else return 0; fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup="FALSE" _have_nfs # Can we do an NFS install? test -f /sbin/mount_nfs && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __EOT if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp= # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" test -n "$_have_nfs" && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) test -n "$_didnet" || donetconfig install_url -ftp resp=f ;; h*|H*) test -n "$_didnet" || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) test -n "$_didnet" || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else _yup="FALSE" # So we'll ask next time fi # Perform sanity checks... if sane_install; then # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp= ;; *) ;; esac else # Not sane, don't exit loop. resp= fi done } munge_fstab() { local _fstab _fstab_shadow _dev _mp _fstype _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab=$1 local _async=$2 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __EOT exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-check] local _check _fstab _pid if [ "$1" = "-check" ]; then _check=1 _fstab=$2 else _check=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi ( _devs= _mps= # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Unmounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "... Done." if [ $_check = 1 ]; then echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done fi echo "Done." ) < $_fstab } remount_fs () { ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 if ! mount -u -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $1 } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab=$1 ( _devs= _mps= while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } donetconfig() { _didnet=1 resp= # force at least one iteration _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname (short form, e.g. \"foo\"): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname resp= # force at least one iteration if [ -f /tmp/resolv.conf ]; then FQDN=`grep '^domain ' /tmp/resolv.conf | \ sed -e 's/^domain //'` fi while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name (e.g. \"bar.com\"): [$FQDN] " getresp "$FQDN" done FQDN=$resp echo echo "If you have any devices being configured by a DHCP server" echo "it is recommended that you do not enter a default route or" echo "any name servers." echo configurenetwork resp=`route -n show | grep '^default' | sed -e 's/^default //' -e 's/ .*//'` if [ "X${resp}" = "X" ]; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ "X${resp}" = "X" ]; then resp="none"; fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -f /etc/resolv.conf ]; then resp= for n in `grep '^nameserver ' /etc/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done elif [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo echo "The host table is as follows:" echo cat /tmp/hosts cat << __hosts_table_1 You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __hosts_table_1 echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi }  . .. catchmodchgrp cpcpio~ pax tar dd df ed ln lsmkdir mv rm sh kshsleepsttyffff1f1ff5€u f 1ہUt fHsffD:d7087\Z[]]^XZ_txڌÌඌ਌|@'ڌÌඌ਌0܍ԍ0tďp&"?4/+HRL^X{wpjbכ͛Ǜ  @4)%!?জ$?x??? ?}P?n?g?a @?\ |?R ?G ?=2h3EYPYQYRYUPU`oV`]FvSD1# PQUVXZ|jYG:)"))) ================ == EHjYQ jKBXj=++3@` 3@ %5EIQa!1Ap!aR[#M3?R0)R!7RGRCRq 3  xx!`8xPyxUpYcYVx`MxaBxp9xq0xr'xsxtx xxxxxixq^JP7Q$_dedeu#k%_'SB$d<7B$d<2+$"  " " "@ "p "p "t " t " t s" t fbI`b0k*#k* k*k*k*k*k*k*!k *k!*k"*푠홠[XATCXCyTEoBGfDG\IGRMGHPG>QG4TG*UG VGWG XGYGZGBLDLGLILMLPLFPFRLRTV{UVqVVgPGP;CP- $##@#@#@@dQLVQGX>9P/)Q/#n/o/x/t/K@K@K0tcsg?c,LF,L@,L:,L4,L.,L(,L",L8qg]S`:`3`,``@BCFGHIPps wpgp_pN pN20pF30p740pF@pN pp!p&p_p)p_+p2p3p4p5p@pCpip_lp_mp_p@p0p0pPp 36C$sh[M;pM 8M    xx(((xicNGN@<&<<<< < <<<<<<w!<a"<K#<2$<%<&<`  DXmtqeZtPeQtXeJ]hF;]iF)]xF]F](F''vl6^L:&::<0<1< g "Y6O>GC)OI"P`I{vp_pCp&p p` pb pd ppppupfppf p!pu0p1pu2pf p^"pR#pJ&p<'p1(p )p0pap-p.p0p4p5p`7pR<p;Kp$Pp`p`p!p#p$p$p$p$p$p$p$ps$p` $pT!$pH"$p<#$p.%$p&$p($p@$pB$pC$pD$pI$pK$pN$p%p%pppippQ pp90pp1qpqp qpqpqp qp!qp"qp#qp$qp%qpqqpaqpUqpEqp9qp1qp$qpqpqpqpqpqpqpqpxpĄpńpuʄpd˄pXp=p"aaD/0.0vvvvsscWPP}?80+0#@IABCDEFGHIJKLMNPQRSTUVWXYZX! 12%w_+XE+X)+X+X+X+ X+!X+%X+ X+X+X++XW{kWV{fi`SYLE .  . .35!3F3t3}%o]L; b3-`Qw&   JP !012456PQR       ! 0 1 2 @ A B P Q R ` a b zs j c ] VOG?7"txN] #]9#]=I  (),y-yn_PRNC<5.5'5 ! EWEXEhEhE!EEE"Ea B{fiWfiPfiEfi>fi1f i$fififi"f i!fffffvPZSZ3MZ8M{Z0MjZ0 Vw OGw"O?wO7w@O/wO'wOwOw!Ow"Ow#O))9 efuvwzxhz _I3S1VF@3SF93SF/3SF$3SF3SF3S=F 3SF3SF3SF3SˆF3SÈF3SЈF3SшF3S҈Fs3SшF^3SFI3SF43SF3SF 3SF3SF3SF3SF3SF3SF3S F3S!F3S"F3SF3SF3SF3SF3SFx3SFn3SFcHCRJ 93J'JF'd99999 999999~90n9b9 U90H9 79p%9U 9U9U9qU 9U9U9U9U9U9U9b9b9c9c9&c9pM {iM9{XM{F3' 4ԿͿԿƿԿ࿿ͿeԿ)z ie]LKFL=K6L=K$LKLKLKLK־LK¾LKாLKLKLKrLK^LKJLK5L K%L!KLPKLQKLRKٽ/ ѽ໽//ѽଽy_y_yy xydyOy:# 2(# 2# 2# 2#P2#`2#2#2ݼ#2ϼ# 2ż#@2໼#%2఼#`2়#2#2#P2#P2x#2oZNZ>% 2 2 2ջ 2Ļ 2ර G௻```|`i```Y`:gP`I`jB`1`!``` `_``ںҺ৺` `uqXq?q*qaqqqvqqܹq࿹q࠹qq`q@qqqq& qpqTq9qq q80q@0qC0qP0qW0qcX0q@e0q2qqqݶq࿶q࠶q`aqA/A!AAAAAAݵAյ Aĵ A෵ Aવ Aࢵ AA}AiA_AUAAA-AAAAAݴAɴA૴AAyAe8A[hA=iAjA kAAAϳ`A໳aA৳r[ T MF?81*#  ݲӲ1̲1Ų2໲Bಲ૲J৲PP@P@ sJhWW{AW{+]$]$ sssss s s ss߱s رӱ8˱±W`๱ a൱=p m .  ` T<J?* bذ !" #2$%()*w+X,L-g.^/ѽ0Q1:2034)56^789:;ԯ<>?@ABCDEFuGgHbINJ'KLKM{NCO=PQ6R*T"UV W{XY߮Z[׮\Ȯ]^_`abc}dqe^fgSh<i`j.k*l&mnopqrstuɭvwOxyz{|}?~jVRC;+5}g_M9,/ӫ˫}bM9jE6Կ̪s[B=/+کҩ̩~f\VI/!{ͨǨPzaYK<5' ߧyscMZYqH@      צȦ+qhWA:N>C8 !"$%&ݥ')ӥ*+-./0s1k2e3T4;50678˱9:<=>?ܤ@ѤAB<CDEFGHRIJzKrLhMYNSONP<Q,R$ST UVWXޣYLZԣ[£]$^_`abcd`eIfig8h&ijݢkѢopqrstnu^vZwFxAyz.|~ir_hWM>7ر%k`D4 ߟv0ogVH;)ӞɞtmWQ@ ҝ ) -9?MTp[\\]FteuJz_N%5.+ں3vv3  >Q`&e==@3@OIJK3SFWtcpۜJhќ.$@  #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+0plP|ȻAȻA@p @xr`4```4`0P`tPPPP`]x`CPd``@4`0P`P`l@Pl@p@t@`@\`@`@`4x4`@4`@PXr ,P P4`@X@`]r H | ,P ,P P P4x4`@ @ @P4x4`@@ @PP rP_~4xxP^rp@tP|Pp@^r( @^j^z]x\P @^j \P]x\P@4j r 4r P dP xP P  P # @ 4xxP^r `x@|H`Hr 4P\`@`P`l@]r^r ^r( x]rP`t@Pt@`P\r `t@rt@P|@P |H`Hp@d@`~`d@]xP@`@ p ,P4x4`@Pr@ x`PP tjD@r@ PP``P0Xrg @@`|p@Xr 0@@`@@`pX_~ 4xxP]r  P@`P@4j r 4r P(rzP4r P@`P@4j r 4r P@`P@4j r 4r PP@`P@ r X@`@``@PP@`P@4j r 4r P@`P@ r X@`@``@PP|H`H]xP``l@@\`\PP`t@0P4`\r 0`ClPl``@P`BlPP 4x4x4`@X@`|@`@H`HPp4``pp`c@@4@BB{ij{{ { {{ {{ {-1Zb::xBxxx::::y:t::i:d::Y:T:xxx WD2?2?   XD31   <,A|A@0lԌh`<r@P@/P \دx( _?x4p8( |$D%  [12&(/|0/VlW ln3T4l4$6h6666 7P8989X4|̟ HDXT0<(ܼ@ 4|` l $%h$%dp(L"$$ $$#($*P3\4456P6d66647P7t77\/4tJLPJQQQQQ{QwQqQAWAW WWW{WfWTW(WPPteePPPP0fPPPPPPPfPPPPPPPt^fPP`htbh^gPP`gbg|fPP|(iiiPPi̭i_tPf`DtcpfL_0PHa\cP_TPPaPtdP_lPPbPdP0r`rPPrsPP@vlwଆ0yl,{D{T\{~{഍P|~yrV{=Pk5eGmUv9aWvH f0/h+ʷV)>Hⷾ'"=o;v(D c xUN8Θ˷"㦍0y#|ٔ/EC k^&UVr dmVeM- S Kf.w/RvTqp'{CIxT4:]b )UJ!az4ju v\}jBDugf=P? zڪ-1]Y+2Bc`<VbZy jBDo i%8?N,a72*0|:E)+WLfCŌKx\);5h!5h!5h! yr@@࠯ฯЯPtt%K4<  8 @ `P0p(SAgWpqvupppp pxpx,n +: !"#$%&'(),./012345679d<=pqrstuvwxyZ}[`ei\afj]bgch-z{n l@ !"#$%&'()./0123456_|>=pqrstuvwxyZ~PSUiOaYjQTVKL-z{C ~C ~C |C zC |C xC vC xC tC rC pC nC lC nC jC hC jC fC dC fC bC `C ^C \C ZC \C XC VC XC TC RC TC PC NC PC LC JC HC FC DC FC ~C ~C ~C BC @C BC >C >C >C C C C C C C C C C B B B B B B B ~C ~C ~C B B B B B B B B B B B B B B B B B @C B B B B B B B B B B B B B B B B B B B B B ~C ~C ~C B B ~C B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~B ~B pC ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C ~C yB yB yB tB tB tB ~C ~C ~C ~C ~C ~C pB lB pB gB gB gB bB bB bB ~C ~C ~C ^B ZB ^B VB RB VB MB MB MB HB HB HB ~C ~C ~C ~C ~C ~C DB @B DB ~C ~C ~C \C ?@ABCDWXFT@oca31oAAAAEEEIIIIOOOOOOUUUYᅠaooo   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000#(+2 $(,@ ` @` !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^  > x Y | " - - ' x  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ g !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^      }|{zyx eabcd_`^]\[>xZYXWVwUTnSRQPONMLKJIHGFYEDCvBA@fh~ |wvutsrqponmlkij$ 7 < C J $lP@ v TP` p #P(g *P(^ *PPX #PPP *P(H $HTPA 5tM( t }   !0 !\ !!P!!h!t! !(!!#!p<(!*!3T4l4$6h6666 7P8989_2![2!S2!O2!G2!O2!?2!;2!?2!52!-2!;2!-2!52!%2!!2!2!2!2!2!2!2!1!2!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!1!}1!1!u1!1!m1!1!e1!1!]1!1!U1!1!M1!1!E1!B1!:1!B1!21!B1!*1!B1!"1!1!1!1! 1!;2! 1!52!1!;2!1!52!0!1!0!2!0!2!0!1!0!0!0!1!0!1!0!1!0!1!0!1!0!1!0!1!0!1!0!1!0!1!0!1!w0!s0!k0!s0!c0!s0![0!1!S0!1!K0!1!C0!1!;0!B1!30!B1!+0!B1!#0!B1!0!B1!0!B1! 0!B1!0!B1!/!B1!/!B1!/!B1!/!B1!/!/!/!/!/!/!/!/!/!/!/!/!/!!2!/!!2!/!!2!/!!2!PF!" 3A;إJ.U?c?x h@TG!0/! p@P!D.T 1hX @h"hTkpi"#P")7H1S"]خjDr|lp!ܗ @|","#["T"F"\:"/" z  @+!?SMYcxl@kw@<?ij!d!HT( @(t18=PQ"e"uL} !z!P"|p @'`4,?@VT"hp"t@  @.?T$?Do  R` !!b18=P_?p?0?%j # @ "`! @t (h09X"CSlaԖp`4 !u (@4 q U ,@Ѝ8" 0@8% 4@0 8@:@FQx[ P@fT"r4,g!dRt|XxxQ *(!>3?OR]"g X@rx}"A"#LqX? h@\ p4",|L9,Fd!#P"X4O`fhdrr9~ l@ p@ t@@L?dIt:ȴ"|!#?hxG".<"@*"Rf![diXrfz {vrlfb'\>pYRT`etY>hhN{!z! X  0 - : rI .#T yf pp ܤ!   < " l    ! x@ !(! |@!!+! D!8P!d<_! @p!z! @! !!P ! X!h!,!L?!0 ! @!d""Y,"^?"pMI"2?["dg" @s"5"ԙ?""$]!"Ի""0"8?" " @"+?"^"# @ #.#x:#P?B#M#!a#lo#7z##\#Y#̨#t#x-# @###^#T? $ @$L!$)$:$&H$wS$i]$@n$"$?$$.$F$|4$l!$Ԉ$1%;!%x7#%H1%,!E%8PS%"e%"o%B%<"%"%(%%%t"%"%"&t"&"0&t"E&"[&|Fm&v!& f&(B&8&_&0&&t&& ''ȩ'~1'PB'2R'\' @g'@q'~'X'x'0.!'*''(08(3##(0(:(C(x?T(`f(\gu("( ( @(h?((( !(` (?(\H( ).).,)6) @E)PtV)g)`x)))X)<))q)q)?))*X*"#*"2*;*BR*_*tq*@* @* @*** @*@!*D** @ +!#+X $+B5+?>+?M+!#W+8"b+to+ @+!+8+`o+ @+o+d!++0+<,,lj,/, @=,MR,"a,n, {,?,, @,h, @,, #,v, @, w, @-؝-- @%- ,-BF- H@Q-#a- hA2P"2l23l!3P30 $343XB3fM3 >AZ3|Fj3<}33?3z33 >A3:!3$K33P3"4 44 *4$;4lJ4L$[4Pg4Tx4 >A4 >A444 `>A4P"444O4R4(N4"5$5X%5 65;H5LR5^]58Is5ԥ5"5"5"54"54"5" 64"!64"864"O6 h>A_6"k6tx66|@6 l>A6H656 p>A66P"6_6x77?7+7170D7"O7\]7|m7pv7?7\77\<7`7|7x@7p7;7L 8o8ԙ)8@`98ZJ8R8 t>Ae8o8a{8D8"88%8"8D8$[8$?8$8p9 9 G 9@@19l #?9!O9W9p"_9d~o9y9l99 9L909"9$9k"9ď9 x>A::: "%:H4:C:KN: |>A`:h"i:q:|:@: >A:E:l:: ?:l:4:|?:l:l4;;);L1;@<;UI;Z;`f;Bs; >A};4q;;8J!;t;";̖?;;T;; >A;?<<< '<(*6< #A< O<_<~q<"<x<!<\!<h!<L<<A=t!'=(@@=|S=4)\=d=s= >A|= >A=1=?=V=?==k =@ #== ?A= >>DE#> ?A2>,":>E> ?AO>Xm [>"s>4">">">l"> $?A>4>>R>| ?h? (?A ?h.?e"6? ,?AC?sL?pW?<b?p?B?4?~?"????n ?? ? ?@x@ 0?A!@LU0@G@"Y@Zl@@@d@@,@@x@"@@}@Ts@ @@A AAt.%A D7AdFA"WA~"bAP!sA/?A.#A.#A#A AAA"A?A\Ai!A?AܼB B AAB4(BxU5B@>=BIBZB AAdBhrB(}BDBoBpB4?BBB AAB"Bx=B AACCE1Cp?BC@?PC]CiCпzC AAC<C"C CCC BAC hCACHCC pCA DD ?#D,3D#JD(#^D "uDXD CAD CAD$?D!DtDhD CAD"D CADx D( D EE")E"1E} GE} YEkE CAvEt"E4"Et"E"EE~!E̟EEFx!"F2FL:F8JF|PSFpc^F` iFwF@nF CAF?Ff"Fp!Fl!F| FL#UL0#mL#L0#L "L"L`"L"L" M"M?*M"AM<"YM DAbM jMh#xM:M\M MM DAMDM DAM DAM0N DANN|8!*N!7NL FNSN^NPjNt"N"Nt"N4"Nt"N"N" O}O 0O DA:OBOKOtVO DAbOqO#{OSO?O8"O !OOOO (DAO؈O HDAO<O^ P,P*Pw:P IP]^P(3rP Pظ!P(PPPlPPԉ!P Q\ Q7Q4#QL7+Q,5QUHQ.RQcQtQ"QmQLaQȎ"QQ@Q"QlQH3QQR0VR&R EA/R EA;RKRN"mR[wRRjR|PR FARzRRx:R{RR FAS?S@'(S (FA?SlKSHXSPMiSuSS6SS!SHq SxSH9S!S Tp TP#T]/T;TTKTPUT?`T"lTxPxTt7T #THJTT-?T ,FATlTW"W8W W#W"W "WĢW!W'XX?)Xd7X 0FA@XMQX,f?]Xd2kX$_zX?X3X,XXXNX$aX}"XXP"XYYvY],Y,DY PFANYH"ZY8<eYx?{Y?YT%YAY@XY lFAY,Yl?Y#Y|YHDZ pFAZ( Z;+Z$;=Z0RZYZ hZtZ8"ZLZZ xFAZ xHAZZ#ZZL"ZH"[T ["["[T3[=[fJ[][ [[?[x[T [0G[n[x[P?[(<["[,? \\ '\3\"<\,iH\z"R\ |HAd\"z\"\`\e\\$!\M!\H\^\]$]&]3]6D]xQ]b]t]?]?] ],]t]0U]0]pW]X #]HR],?]" ^LY^"^E.^D8^E^ [P^z]^em^0~^d^@^h^4"^0"^a^ ^>^^$Z_ HA__m"%_`1_:_X?H_R_3#__ g_?o_Фz_t_$_0_ _Lz_pl_ HA_8___ `` HA`L1`<0;`4\J`lX`i`| `F ` HA`T[``` IA` JA``!`L `!a|a,S.a@A;a#DaNaVa_aD=wa`aa(!a!a)aLaaaa4@b<# b2b)bH`8bLFbЖSbabkrb|bbߎb@bDbbb b,bܖbb JAc (JAc 0JA"c83cPhtz!hliPii,i QA6iCilOi\iXjiui0Sii i iiPi"iL"i\?ii?jt"j`F-jP7jBAj\Lj< Yj@ubjvjXlj8!j!jLj42j([jjjTkP=ki"!k(6kp FkSQk((Yk$ck"rk"kD"k@"k k<k`"kk0kkĢ!lFldl$l_6lGlPRl^l(!!nl]l lh!l QAl #llxl QAl?l_ lnlDy mH"m,,ml?m ImPm\_mom@zmmmmN"mT*"mL mܝmmm,n QA(n9n QAAnJnbRnpanD"ln xn9n@nynn n"nn QAnl"n QAo!oH,ol#5oIo,Wo QAcono xo RAoo RAo,oHot?oH?oxoo}o RAo$p RA pP#pd>7p$@pd/Sp?`pXnp&?yp #ppp@zpyp@BpD?pLpd p\Lq "q`  qL!/qh=qlJq"`qdGoqtqoqq=qwq0qIq"q RAq r'r $RA"r2r$"'t3t|LtR_tkt RAztTt SAt tRt:t Ft?tt8]"t< tt"tOu"uȁ$u?,u 9ưGu SASu ]umuu4u?u 6u Ouxu?uuu SAu/u|/vx" v"v?!*v9vZGvTvx _v SApvh{vlv #v0v vv"v4v SAvPEv7v w`"wX"!w4E"4wXA"Gw5"Yw8-"kw|!zw\i w_w wwX"w(w@wT+w w`xp2!x x (x5xH"AxH #Yx#nx4"A AJnXa iEwh|]ঁ;ಁhແ!с>ށ0 AX,)43Q=DEFPvRx"adFsl AX4ंmಂxH˂ق8 \"l'll4A`OYd2a!rCQ|Z]Dmi ЮAr"!P!ॆ?ெๆ?Ɇ\H݆(Tr#$0 AiMl Sb  гA` 8 "े سAେH #໇"ć-ڇ طAK#)#BL"\"uP"h"ࣈ"ຈ #ψ#l"""8 AGԑTadrH!{ AL Aࠉ'೉ཉ Aʉ((!P?h'6,AP kZpkwT}#ଊഊ༊`*Ɗğ?ϊ?4 A -!8D"@ H Sb Aj>x<L!H!࣋ ஋ උT ྋ F͋ A׋>! AL #"I5H!FLNZ #c ĸAl*u8EौXdಌ7࿌hNӌ܌܄!\P/! /~8d@XuN?XlgXXo~ `q! s ்\།Df?Ǎ@>ҍx6! @Ht? -5cCN Tf(^n(wS"sࡎ?਎ ఎ໎lʎ֎Lt ȸAșH?ܰ ? A%9xE( R (Adq|myI!D"੏И"൏)ʏ ҏۏ"D"t +L:L"G=Nxw!Wܽ _n\r\ ࠐLಐ 0AːdiՐP"PV   @!o !ȋ4hy;LH$TD?_ hoh l~॑ PAෑgÑԊӑT!P"!H?/$Z><GTCku" "P"঒ಒ#ྒ˒ؒ ` TAP"T XA0Dh!?I@[TkyEX!॓V!ී?Ɠ!Փ"ޓ7""h! #xY-J7"B \AN?UH_m!d ࠔ `Aಔ ༔͔Lڔ$ Ȱ ?! !$0!<ANLIf,td hA ,੕ೕH࿕@̕xԕ(X-`+!?O]"npr A࢖,tഖK"ɖ ߖ\ |Hh)?6̘?B|?N4![,"k1t D \4඗|ʗT4ߗl }7Ԍ #1d?|NT.#UpSi<5tH࢘l൘f˜Ϙ+ޘ(U,!l.#/$0@^PY^ AjAsL}p" Aଙ`V໙#˙h!ۙ P". = x%!8`NIfS` Ax+XT"$ ,ౚԞ༚š(Қߚ|K? %#4 ;cHXz `kv A}?px৛L๛T"ě!ЛhPܸۛ,#< A-d9"GpZW$1cpzy@! AX࢜ A૜<ཛྷLʜX"ќ{ڜ$"(! A`d(Ph3BGI(OZ ĻAbP m?|" ȻAZ੝dෝ0B͝xםlY< ,h hG7<GtU0]!q |GT"p"૞$ພ|SŞ "̞7ٞ лA4vt" x,",!/$8#@P #M\0Zto ԻAट ػAట?ໟ"ßܻ Ο "ٟwTx_ A +?:L [(kVuQ~W< Lvࡠ Aૠ AຠLv!ʠڠ!L"0@,MԸ],+j/s } Xiड0ౡI໡~Ρ ԡRd~","/9lgNL(V\Pn|V-ࢢ!๢!ˢ!!lv! A0.<>IY?`#nd #| A+lFૣ Aೣy`!ѣ!ĖlW (Ax(?/dBdM`[eȽ?t0 HAL LAતط೤`̤DԤ$*0 Ĵ!H!")d"7lFC PAQ{\0!l dA~"4!૥ hAഥzå˥"ڥ ȼAԒ"ԱX?T.!20=_M"\HW"m C"t@"3"ࢦ!ದ 0SզpB(  oc&7H Y hAdpP|XZ\!#੧`!෧çGاlH pA"$?"%|."; HD"#N xAU b |Al|y$ AD"ਨl9౨lRຨ0?| ʨX$ӨȑߨdX]P ,G #,`7 AA"P_dgX2oq z#?!ࢩ!ഩ A'?Ω٩-@\0} "B#xz0@OJ"Zt!neUhପ#ཪϪh٪l~4u8#(3 5=HHR"i !yh Aď஫໫d?«05!֫`7` Aԟ? A F, 9@B (AM(q[Pi|?pc"|P<UP"࡬"ฬ?¬"׬"4?%5!7TH 0AR|Ocp"qDl PA࠭ଭྭȭ hA٭Ln, Dp&@:NLt"]i<vt A A࠮ମ෮p࿮ AǮ"?Ӯ8?t+L |A%dL>I:W0a/k&u "X7Xয|Aಯ A༯l=ϯ?ׯ<"߯2LZ! Y!PF!) 5(?=F="\ 1"r`"8*xਰ4ರ(e໰\԰ްx"`?JHSH^"h xAo}pr"!ฺźܗϺR׺" |AiA A",r/L?; !IiRp\|Ef AsX#}8K!঻ ཻ ˻ֻH r" X'"3t!=LJO "Zk|t<?8y!ৼ!༼dżȕ?̼Tܼ!82p7 ""+6?pFR [ Ad,nww? "#"஽ A࿽^ʽ!Խt?޽,{!l  "x?5A A\!tpz~#x"ॾGಾ",!վXؚW4!H!&5F Rha\Ul"s} G ॿ`୿2྿̿AۿH $Th %|"/@ 60AHh?_ Aq8~l"5t$6 Ap3"4 .#"#2_;"G"N1?[ [j|"qh\*"L!X\9LA<6 H  "4!2P9 @JSČbXx"H%!9x AF  %4-5=0 HL_PPF]g:o"z"\ Dd|gV|d[`$X0":cBL3d o Ả"H/+2:HFCLjJ!^|$m{G2ml A?hie A"5"M`[Ȑ"blp A}lܓ! A8 gl8al:'-8@GTbT iu܍p-?  \} AW@$ >&,+/D^? AN0Ycpm?x pAP#ؠ?X A A!`*|7,DtM-W xc8llM08WkxH?"|" A5 !".`6x@ AH4X ^0"eas|Ddxȷ? pHa`q! 6 e)U>Q PAYl~4!\] ?Wt k!P6P?-6C\i@"#s #}@! TA"@"8!, d6L6r XA9* @,YItV83kX"#u #8>"? \A\"H?" 8]J\\!p8;BFTL+_|j(q G: `At!"!  #@ #"O5X"=J$X"e rzd4`Mt" hA< @ A[DJ6h6/%"7=?SOt^qg p(M{$UT4!ܕ AH .to?9 ? AHxUd`lq}H A A!<h"<FhY?bd k|z " f"#4 #49?<!  =%0 A9D@?L AY Aesp #ym A,Aq'!t4h,\s4DGWxbenv#=!#$"pHo? !8fXBc)";4 Ype Ap{@`o?L?D 7L@89 H1QA"R"c Ash { A?, tb`xh!d6# A"! (A3 (A< ,AM 0AY 4ApyTT"$?  8A4ܦ@\-=MZgq {T8= !x`<@#t.^6!@ԀLԳV c\[q3{ H??D? @A" #*?}d9l"*9H #UP"e ~P TATXPRi" !  !*L5HHTWp"iz_ TMd ā XAp4"X!PB t pA)@"R"dEnDy\O:["i4u!) AH@ A!8"$G 0p a!1CP0d8sHh!X"<"Tv tv !X(9?@0HXdj_6hl"oYt APc ATPL!4:D"+7l!>I<Vp0b"#nPwp0 Jx"rص D`Hwp ;"#Gh!OD{]qcx _L< A̭$"Шt=X2d( A-q<hI 8AYxg (?dh?b`P#,"D # A?d" ?"L?, : AE JS,dq<({ ?zP-<tl"ԙ!-#!>DQЄ^X=y J\"(?T$j T"$P?+ "6tE(NHF_mly"x<p # AD",\h?`" lr  ?(\ !4 A;$F OU^1r{TZ8?ԓ"D A A"_apm_ppbattach_log_copyin_epic_free_rings_scsi_scsi_cmd_sdioctl_addlog_apm_dobusy_proc_trampoline_dmmax_ffs_oldfscompat_ipintr_isapnp_print_epic_openbsd_shutdown_cmd0643_9_chip_map_ldt_doforce_pciaddr_ioaddr_icmperrpps_count_cdevvp_cd9660_vfsops_dc_setfilt_admtek_nswbuf_remrunqueue_max_npxsave_bcopyw_cpuid_level_apm_err_translate_ffs_fifoop_p_spec_ebadf_ttychars_doshutdownhooks_astpending_cold_pcmcia_parse_cis_tuple_ahc_pci_probe_pcisubmatch_rt_timer_init_rti_delete_msgs_cd9660_readlink_cpl_htonl_switch_page_userconf_maxlocnames_spec_read_dc_eeprom_getword_pnic_pciaddr_resource_manage_cd_get_parms_xfer_free_list_aha_cmd_epic_set_mc_table_devopn_sys_rfork_iso_uiodir_isohash_fdcattach_pci_subclass_display_spec_close_ahc_createdmamem_buf_nbtports_bgetvp_Xrecurse6_uvm_pager_dropcluster_sys_revoke_Xrecurse7_ec_probe_pci_subclass_input_sd_scsibus_get_optparms_cnset_in_pcbdetach_in_pcbconnect_zeroin_addr_msdosfs_symlink_Xrecurse4_htons_epic_read_eepromreg_rl_txeof_arp_allocated_ccpu_Xrecurse5_cdioctl_cpu_model_uvm_map_protect_Xrecurse2_bcopyb__isa_bus_dmamem_map_scsi_test_unit_ready__bus_dmamem_map_vmi_list_slock_ffs_reallocblks_rt_timer_queue_create_msdosfs_reallocblks_nprocs_Xrecurse3_finit_opti_chip_map_if_attachsetup_unp_detach_ttyclose_le_cd_Xrecurse14_Xrecurse0_pcic_isa_attach_pciintr_icu_tag_ne_isa_attach_aic_isa_attach_scsibusattach_uvm_map_submap_catq_dofileread_ffree_fork1_Xrecurse15_Xrecurse1_fillw_i386_get_ioperm_userconf_common_dev_boot_iso_shipdir_MD5Update_Xrecurse12lshldi3.o_apm_battlow_softdep_setup_directory_change_vmapbuf_powerhook_establish_shutdownhook_establish_Xrecurse13_kernfs_print_needbuffer_spec_strategy_VOP_BLKATOFF_Xrecurse10_vga_col_cy82c693_read_uvm_map_clean_VOP_READ_cnputc_aic_select_Xrecurse11_vnode_free_list_vattr_null_m_copym_pipeinit_sys_setgid_sys_umask_wi_watchdog_bdevsw_getsock_acct_process_sys_readv_vop_symlink_desc_vop_fsync_descmax.o_efread_isaattach_tcptv_keep_init_unp_scan_adv_attach_Xrecurse8_vr_calchash_cd_scsibus_getvol_encode_comp_t_vop_ioctl_desc_Xrecurse9_dcphy_service_exphymatch_getsn_isofntrans_bios_getopt_regyear_soo_write_vop_lock_desc_meta_down_cmd_channel_map_pciide_print_channels_cnstop_ipsec_expire_acquire_sys_munlock_cd9660_unlock_ahc_cd_ahc_pci_intr_wdc_ata_bio_kill_xfer_pcic_chip_mem_map_ffs_realloccg_writedisklabel_scsi_free_xs_sys_settimeofday_cd9660_ihash_slockmin.o_eisa_devinfo_softdep_setup_allocdirect_VOP_SEEK_maxvfsconf_randompid_vndxfer_pool_msdosfs_lookup_ahb_ca_pcmcia_card_gettype_ahb_dev_tl_dio_setbit16_adler32_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_wdstart_ufsfifo_write_rtrequest_tablefull_tickdelta_cd9660_reclaim_vfs_unmountall_fill_eproc_sys_seteuid_ahb_cd_Xresume_aha_free_ccb_rl_start_net_sysctl_sys_wait4_vt_coldmalloc_devin_groupmember_ne2000_readmem_pcmcia_3cxem556_func0_devio_VOP_ADVLOCK_epic_common_attach_uvm_shareprot_xl_calchash_ep_cd_Xsoftclock_aha_queue_ccb_cy82c693_init_mii_phy_add_media_cpu_wait_am7990_config_sorflush_wdc_free_xfer_ep_pcmcia_prod_enosys_cd9660_getattr_dc_mii_sync_com_pcmcia_disable1_ep_pcmcia_disable1_inverse_char_aha_scsi_cmd_wdprobe_tcp_do_rfc1323_vop_mmap_desc_cd9660_unmount_uiomove_aic_scsi_cmd_aha_cd_aic_cd_copystr_setup_buffers_arpt_down_aic_free_acb_rl_probe_atapi_to_scsi_sense_spec_pathconfmemset.o_intel686_cpu_name_devioc_nswap_bpf_allocbufs_userconf_common_attr_ne_cd_pcmcia_intr_disestablish_pciaddr_eisa_intr_disestablish__isa_bus_dmamem_unmap_aha_get_ccb_isa_dmamem_unmap_pcic_isa_chip_intr_disestablish_pcic_pci_machdep_chip_intr_disestablish_isa_intr_disestablish_pci_intr_disestablish_wdc_atapi_intr_command__bus_dmamem_unmap_ttymalloc_sys_getfsstat_check_console_pcmcia_card_deactivate_mii_activate_sys_nanosleep_aha_ccb_phys_kv_mii_phy_down_uvm_page_lookup_freelist_uvm_map_advice_uvm_deviceops_resume_iret_isapnp_findcard_cd_read_subchannel_fix_f00f_cddump_pmap_pageable_reassignbuf_mb_map_pfctlinput_inetdomain_PTDpde_current_video_screen_aha_init_ccb_vr_stop_kthread_q_Xintr_pcmcia_megahertz_xjem1144_func0_pcic_queue_event_cddkdriver_pipe_close_acctp_pciintr_header_fixup_ef_isapnp_attach_ep_isapnp_attach_le_isapnp_attach_wdc_isapnp_attach_isapnp_attach_pccngetc_fdwrite_cnwrite_amap_cow_now_bcopy_bt_queue_ccb_pchb_rnd_asc_mcode_chksum_rlphy_service_ipaddr_lf_findoverlap_sysctl__string_sendsig_dp8390_debug_wdc_enable_intr_copyout_ipport_hilastauto_kernfs_symlink_sbflush_dc_reset_ep_statchg_aic_get_acb_sys_obreak_cddone_ufs_mkdir_ttyflush_fdremove_rnd_timeout_wdprintmuldi3.o_pciintr_link_init_pciide_dma_init_hexdectodec_vr_shutdown_kernfs_pathconf_donice_fifo_pathconf_wdcdetach_cse_isolatin_wdcdebug_atapi_mask_pager_map_wanted_lock_doscheckpath_spec_advlock_rdioctl_pcmcia_intr_establish_eisa_intr_establish_intrtype_pcic_isa_chip_intr_establish_pcic_pci_machdep_chip_intr_establish_pcic_pci_machdep_pcic_intr_establish_isa_intr_establish_pciide_machdep_compat_intr_establish_pci_intr_establish_ext2fs_fifoop_p_emul_native_chainlength_kernfs_write_sysctl_struct_sys_mincore_dcphy_ca_pmap_collect_acctresume_tl_hardreset_tl_dio_read8_ffs_clusteracct_ttylclose___divdi3_extent_free_calcrulshrdi3.o_ef_mii_writeb_VOP_LOCK_safepri_adv_cd_dcphy_cd_wi_pcmcia_detach_wdc_pcmcia_detach_com_pcmcia_detach_ne_pcmcia_detach_ep_pcmcia_detach_sdmatch_mi_switch_mclrefcnt_vp3_cfg_intr_shift_ufsfifo_read_dead_badop_VOP_LINK_isochar_arc4_stirnotdi2.o_scsi_execute_xs_bdirty_ostype_VOP_CLOSE_pciaddr_do_resource_allocate_pciaddr_resource_allocate_reg_store_single_uvm_deallocate_finishdup_sys_vfork_unp_gcing_xl_wait_bt_timeout_pci_get_capability_ipsec_soft_timeout_dosdirtemplate_enodev_aic_show_scsi_cmd_pciintr_link_alloc_isapnp_unmap_doreallocblks_cy693_chip_map_pciprint_icsphy_status_ipipstat_unp_shutdown_fxp_detach_fxp_shutdown_xl_detach_xl_shutdown_ufs_mknod_process_read_fpregs_stat_rush_requests_iftovt_tab_Xf00f_redirect_bios32_entry_chargen_access_vr_encap_fc_lookup_sys_setlogin_skip_spc_right_cd_scsibus_set_pa_immed_bpf_m_xword_sys_ovadvise_pcmcia_print_vr_ioctl_link_rtrequest_dead_ioctl_config_deactivate_sc_print_addr_isa_bus_dma_tag_eisa_bus_dma_tag_pci_bus_dma_tag_ststrategy_sys_fchflags_readbuffers_start_reaper_kernel_pmap_store_aic_print_acb___muldi3_apm_thread_create_ipintrq_kthread_create_fldenv_ffreep_cdmatch_PTDpaddr_amap_wiperange_evcnt_attach_ukphy_service_tqphy_service_ext2fs_access_ufs_remove_igmp_fasttimo_pcic_intr_socket_wb_bfree_CMAP1_fdread_cnread_wdc_atapi_ctrl_CMAP2_timeout_cnvmem_apm_flags_tl_autoneg_getdevvp_unp_defer_logsoftc_sys_execve_spec_bmap_rl_reset_kbd_reset_prtrealloc_rn_inithead_efstop_VOP_INACTIVE_sbappend_trapsignal_fp_etc_scsibuszeroref_gdt_get_slot_sys_rmdir_isa_malloc_wdc_ata_bio_rtable_init_pciide_print_modes_ttyinput_vsprintf_pciintr_link_fixup_critical_scroll_ufsspec_read_icmpmask_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_scsidebug_level_ip_sysctl_in_pcbhashlookup_VOP_MMAP_getblk_roundrobin_cpu_startup_atapiscsi_ca_npxproc_fdsize_ufs_ioctl_unp_mark_sys_fstatfs_sys_swapctl_rlphy_ca_cfdata_npxdna_fp_nop_cnselect_ufs_rename_msdosfs_vnodeop_p_rootvnode_pcconsp_dp8390_config_xl_choose_xcvr_atapiscsi_cd_ufs_symlink_ne2000_detect_pdevinit_rlphy_cd_aic_pcmcia_prod_ffree__com_pcmcia_enable_ne_pcmcia_enable_ep_pcmcia_enable_efreset_isa_dmaabort_postsig_finit__pdc202xx_setup_channel_opti_setup_channel_acer_setup_channel_sis_setup_channel_cy693_setup_channel_cmd0643_9_setup_channel_apollo_setup_channel_amd756_setup_channel_piix3_4_setup_channel_piix_setup_channel_ifa_ifwithdstaddr_socantrcvmore_pipespace_sys_sysarch_sched_sync_VOP_BMAP_xl_encap_90xB_cpu_swapout_sys_sigsuspend_start_pagedaemon_biosattach_isapnp_unmap_readport_vt_reset_dec_priv_qm_vt_set_dec_priv_qm_wdc_ata_err_wd_get_params_sd_switch_mii_phy_setmedia_dc_txeof_pciintr_link_lookup_tl_stats_update_tl_dio_read32_tl_dio_read16_ttclos_fxp_stats_update_xl_stats_updategetsn.o_pcic_chip_mem_unmap_comconsattached_poly_div16_CADDR1_cpu_dump_bounds_check_with_label_ttyunblock_sys_setgroups_pcibios_present_we_probe_CADDR2_pcclose_copystr_fault_pccnputc_process_sstep_VOP_OPEN_dc_eeprom_width_isapnp_knowndevs_vt_stbm_moused_proc_isa_dmacount_sd_scsibus_get_parms_uvm_map_pageable_uvm_map_checkprot_execsigs_cursor_pos_valid_vfs_getvfs_pidhashtbl_dc_watchdog_le_isa_ca_Xfast_efstart_scsi_do_ioctl_cdopen_sys_recvfrom_ppb_ca_vga_move_charset_tk_nin_can_do_132col_sys_mkfifo_cd_scsibus_setchan_bios_diskinfo_uao_dropswap_in_pcbinit_ppb_cd_intrnames_pcic_attach_socket_amap_wipeout_vflushbuf_selscan_ata_perror_wdc_atapi_reset_2_extent_find_tcp_ctloutput_ip_ctloutput_spechash_slock_fxp_intr_xl_intr_if_detach_wdc_isapnp_ca_physmem_pcic_vendorucmpdi2.o_reg_load_single_dc_pci_probe_mii_print_pagemove_config_activate_vop_valloc_desc_pci_subclass_processor_soo_stat_intr_calculatemasks_epic_set_tx_mode_ufs_select_pcic_chip_io_alloc_uvm_pagerealloc_ttymodem_isapnp_print_region_rip_input_sys_ofstatfs_pcmcia_card_attach_ufs_islocked_vop_readdir_desc___anddi3_wdc_atapi_intr_udbhashsize_ttopen_dc_start_icsphymatch_winChkName_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_wdc_kill_pending_ef_miibus_statchg_wb_miibus_statchg_epic_miibus_statchg_rl_miibus_statchg_ifa_ifwithaddr_dead_bmap_soqinsque_vfsinit_cd9660_ioctl_dc_miibus_statchg_fxp_init_xl_init_xl_miibus_statchg_tl_intvec_adchk_ip_setmoptions_unp_drop_dehashtbl_Xrecurse_ukphy_status_vfs_opv_init_default_xl_list_tx_init_90xB_eisa_intr_map_le_isa_attach_aha_inquire_setup_information_bt_inquire_setup_information_atapiscsi_attach_st_switch_rlphyattach_rtalloc2_detrunc_sys_getpriority_dc_setfilt_21143_ext2fs_balloc_fragtbl124_ffs_update_hostname_pchb_ca_dvd_auth_dead_open_apmprobe_vt_keyappl_pci_subclass_prehistoric_wdc_atapi_send_packet_scsibusactivate__bus_space_map_bus_space_map_rtalloc1_exec_maxhdrsz_wb_list_tx_init_tl_list_tx_init_vr_list_tx_init_rl_list_tx_init_sdstrategy_ext2fs_fhtovp_dc_pnic_rx_bug_war_xl_list_tx_init_am7990_ioctl_ether_ifattach_pchb_cdstrncpy.o_sdclose_ufs_ihashlookup_userconf_cmds_userconf_base_APTDpde_pciide_mapregs_compat_getnewvnode_get_random_bytes_atapi_mode_sense_numvnodes_ffs_specop_p_vop_generic_islocked_cluster_collectbufs_schedhz_bioscnprobe_sbdroprecord_eintrnames_rttimer_queue_head_tqphy_ca_vga_screen_on_ne2000_writemem_pcic_cd_aha_isapnp_ca_tqphy_cd___ashldi3_cd_play_msf_shutdownhooks_done_pcmcia_io_map_ext2fs_checkpath_tcp_respond_selwait_sys_lchown_pcic_intr_find_comhwiflow_isa_dmadone_softdep_setup_remove_getnewbuf_sysctl_string_sys_getsockopt_rnd_attached_wdc_atapi_intr_data_tcp_keepintvl_kernel_text_vt_dcsentry_pci_knowndevs_cdclose_udpstat_cpu_exit_rnd_event_free_vr_newbuf_trap_types_uvm_page_init_timeout_todo_mii_detach_ffs_vnodeop_p_dead_lock_fifo_read_intrmask_Xdble_wdc_atapi_drive_selected_tcp_debug_msdosfs_remove_domains_geteblk_vop_whiteout_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_vop_islocked_vp_offsets_socketops_vop_create_desc_com_pcmcia_enable1_ep_pcmcia_enable1_tcp_close_ip_rtaddr_kernel_map_tcp_setpersist_vop_pathconf_desc_eisamatch_pccnpollc_tcp_template_rtstat_tsleep_fd_motor_on_intrlevel_amphy_status_nsphy_status_pentium_mhz_seltrue_apm_handle_event_pcvt_scrnsv_reset_ppbmatch_pci_intr_map_pci_devinfo_cd_switch_cluster_callback_uvm_km_alloc1_ep_mii_clrbitbcd.o_apm_standby_epic_read_phy_reg_stread_ufs_quotactl_powerhook_disestablish_shutdownhook_disestablish_wi_pcmcia_activate_wdc_pcmcia_activate_com_pcmcia_activate_ne_pcmcia_activate_ep_pcmcia_activate_vt_keynum_com_activate_sddetach_uvm_pagedeactivate_fifo_print_vn_writechk_allevents_sominconn_vunmapbuf_vop_inactive_desc_vop_seek_desc_wdstrategy_in_pcbbind_VOP_REALLOCBLKS_soreserve_dp8390_ioctl_piix_pci_icu_opti82c558_pci_icu_cttyselect_userconf_common_attr_val_Xprot_skip_char_right_we_readmem_ureadc_fastvec_rl_attach_ip_protox_igmp_leavegroup_msdosfs_rename_pc_tty_sdzeroref_dead_lookup_m_apply_pciintr_guess_irq_tqphymatch_in_cksum_chrtoblk_strcat_dkcksum_cpu_class_apm_op_inprog_vt_initsel_cpu_fork_MD5Final_fdretry_mii_phy_statusmsg_rtalloc_noclone_userconf_help_proc_zap_hostnamelen___subdi3_reg_u_add_isamatch_bios_sysctl_npxdrop_comcnpollc_rt_timer_timer_inphy_status_uvm_meter_averunnable_mc146818_write_scsi_do_safeioctl_sowakeup_pccom_cd_uvm_page_physget_rt_missmsg_tk_cancc_isapnp_id_to_vendor_sys_quotactl_cache_enter_vr_intr_vop_balloc_desc_cd9660_mount_tss_free_ahc_isa_probe_depca_isa_probe_wdc_isa_probe_xl_pci_intr_ack_ufs_unlock_userconf_number_kmemlimit_intrhandffs.omoddi3.o_pentium_base_tsc_icmpbmcastecho_in_rtchangehtonl.o_pmap_change_wiring_ufsspec_close_clrbits_strcmp_kthread_exit_wdc_atapi_done_ffs_isfreeblock_msdosfs_islocked_wb_encap_wdzeroref_uvm_map_lookup_entry_sbinsertoob_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_deadproc_slock_sys_omsync_sys_futimes_vn_close_ne2000_ring_copy_ndumpmem_pool_drain_ip_getmoptions_MPFail_soo_read_vop_abortop_desc_m_freem_ep_roadrunner_mii_enable_pcic_pci_ca_cpu_sysctl_exec_aout_prep_omagic_wdc_reset_channel_wdc_nxfer_iophy_status_mii_phy_status_deupdat_ahb_switch_stack_underflow_vr_init_wdc_atapi_get_params_in_pcbrtentry_resetpriority_sys_setpriority_ata_get_params_startrtclock_bpfselect_m_inject_cd9660_rrip_analyze_tcp_mss_update_ep_mii_sendbitsscanc.o_pcibios_pir_table_cddetach_tcp_output_rt_maskedcopy_devwait_sosetopt_adv_intr_uextraloc_Xhold0_denormal_operand_pci_subclass_mass_storage_scsi_probedev_sys_listen_Xhold1_kbd_response_pciide_promise_products_uvm_vnodeops_msdosfs_select_Xhold2_strlen_ext2fs_readdir_dc_rxeof_Xhold3_pool_page_alloc_nointr_unp_bind_userconf_more_config_rootsearch_strcpy_Xhold4_wi_alloc_nicmem_pciattach_ext2fs_specop_p_in_pcballoc_uniqdosname_vfsconf_userconf_list_userconf_init_setsigvec_cd9660_vnodeop_p_tickadj_Xhold5_reg_u_mul_tl_dio_setbit_unp_ino_rdclose_xl_encap_Xhold6_do_initialization_trig_b__isa_bus_dmamap_load_pci_subclass_dock_ukphymatch__bus_dmamap_load_amap_alloc_dos2unixfn_Xhold7_reg_u_div_ne_pci_prod_pci_bus_maxdevs_unix2dosfn_dosetrlimit_filehead_ether_sprintf_Xhold8_isapnp_newdev_wi_get_vop_lookup_desc_ne_pci_ca_Xhold9_trig_a_ext2fs_dirremove_ufs_ihash_slock_ep_eisa_ca_arptimer_adv_init_elink_idseq_ufs_checkpath_pool_head_route_usrreq_isa_dmacascade_mii_phy_activate_ipsec_exp_bytes_fifo_write_pcic_isa_probe_piix_get_intr_opti82c558_get_intr_npxattach_aic_isa_probe_pmap_collect_pv_enterpgrp_inferior_npxintr_whichqs_via82c586_pci_icu_pciide_cypress_products_scsi_probe_busses_stwrite_swread_userconf_attr_tickfix_rnd_states_msdosfs_readdir_comevents_pfslowtimo_wdc_isa_ca_suword_mouse_ioctl_waittime_freeclusterchain_sync_vnodeop_p_filedescopen_amap_copy_bpf_reset_d__timeout_lock_sb_max_dupfdopen_savacctp_mouse_hide_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_ioctl_vp_offsets_etherbroadcastaddr_apm_userstandbys_comioctl_tprintf_close_pgsignal_Xrsvd_reg_u_sub_needqueuedrain_fxp_mc_setup_wi_cmd_FPU_st0_tag_cnpollc_inet_ntoa_btminphys_dcphy_status_uvm_map_clip_start_igmp_joingroup_socreate_adv_dev_ep_isa_ca_eintrcnt_inverse_region_ec_fake_test_mem_we_test_mem_VOP_TRUNCATE_fdshare_exec_aout_prep_nmagic_uvmexp_pmap_enter_pv_softdep_sync_metadata_pcmcia_print_cis_wb_eeprom_getword_rl_eeprom_getword_dc_eeprom_getword_tl_stop_statfs_to_ostatfs_xl_start_90xB_scsibusprint_AscInitDriver_fragtbl8_schedclock_nullcnpollc_uvm_amap_pool_esigcode_st_mode_sense_uvm_map_clip_end_proc_reparent_vop_rename_desc___bcd2bin_pcic_intr_probe_keyboard_type_sd_patterns_cd_patterns_doclusterread_dead_vnodeop_p_msdosfs_vfsops_osversion_timeout_set_eftxstat_ahb_debug_btprobe_cdzeroref_vndbuf_pool_kernfs_access_pffindproto_rtcput_scsi_start_userconf_change_ipending_we_ring_copy_rn_delete_sys_getrlimit_randomclose_sprintf_pcic_isa_alloc_iosize_reg_store_int16_reg_store_int32_ioport_ex_fragtbl_ttyrub_igmp_timers_are_running_subyte_wdc_atapi_update_status_pccom_isapnp_ca_we_isapnp_ca_ec_test_mem_ip_forward_reg_store_int64_dumppcb_rtredirect___xordi3_fd_dev_to_type_ufs_bmaparray_load_store_instr_extraloc_FPU_st0_ptr_exphy_reset_ext2fs_reclaim_bufqueues_userconf_pnum_pciide_ca_uvm_pglistfree_ext2fs_fifoop_entries_ffs_fifoop_entries_cd9660_fifoop_entries_com_detach_tcp_debx_stathz_pciide_cd_piix_init_comattach_pool_init_ipq_locked_strncasecmp_spec_vnodeop_p_Xpage_fddprint_wdc_ata_bio_intr_pool_get_tcp_maxpersistidle_sysent_mouse_copy_selection_remove_selection_softdep_freefile_lastdtime_vop_vfree_vp_offsets_vop_revoke_vp_offsets_vop_lease_vp_offsets_vop_close_vp_offsets_vn_open_bios_print_rtinit_unp_connect2_cd9660_tstamp_conv7_apm_powmgt_engage_ext2fs_getattr_rtfree_ext2fs_unmount_epioctl_trapwrite_fdcresult_tqphy_status_sys_minherit_rnd_event_q_ep_isapnp_ca_wi_read_record_pcic_poll_intr_pcic_attach_sockets_vt_curadr_uvm_unmap_detach_char_type_mouse_copy_end_cttyread_config_attach_scrollback_pages_userconf_pdev_vprint_isapnp_print_pin_pci_mem_find_cdstrategy_bpf_m_xhalf_msdosfs_unlock_msdosfs_reclaim_dc_list_tx_init_printf_userconf_cmdbuf_Sysmapbcmp.o_pool_put_fc_largedistance_kernfs_readdir_MD5Init_mouse_copy_extend_sd_scsibus_mode_sense_scsi_change_def_userconf_show_we_isa_ca_ipsec_require_pfs_ttread_cpu_switch_ip_flush_b_to_q_somaxconn_tprintf_open_wi_reset_ec_ring_copy_ahaprobe_vfs_busy_cd9660_symlink_wdc_output_bytes_Xfast8_Xalign_wi_seek_isa_mem_head_cpu_apmwarn_aobj_pager_vfinddev_Xfast9_wi_update_stats_ufs_dirremove_msdosfs_unmount_mii_media_table_amap_add_ne_isapnp_ca_wdc_pcmcia_pr_pcic_isa_bus_width_probe_uvm_io_sys_undelete_sys_sigprocmask_Xfast4_isapnp_get_resource_reg_load_int16_reg_load_int32_asc_mcode_size_uvmspace_fork_raw_attach_clusteralloc_profhz_vop_print_desc_vn_lock_Xfast5_wdc_atapi_the_poll_machine_routedomain_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmds_Xfast6_config_defer_cd9660_inactive_wdc_ata_present_Xfast7ulmax.o_sw_cursor_vgapaletteio_ststart_cd9660_close_Xfast0_curproc_reg_load_int64_delaycount_swap_syscall_lock_dp8390_enable_cfroots_size_Xfast1_Xosyscall_end_pcmcia_verbose_tl_softreset_tl_setmulti_tl_start_cd_scsibus_load_unload_ext2fs_specop_entries_ext2fs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_msdosfs_vnodeop_entries_spec_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_dead_vnodeop_entries_sync_vnodeop_entries_ttyretype_cd9660_specop_entries_cd9660_vnodeop_entries_mclfree_Xfast2_le_isa_rdcsr_wdc_atapi_minphys_scsi_decode_sense_extent_create_Xfast3_ext2fs_vnodeop_p_clusterfree_kernfs_vnodeop_p_fifo_vnodeop_p_msdosfs_rmdir_nextvnodeidxordi3.o_isapnp_config_ahb_get_ecb_kbd_code_init_we_read_hdr_vr_setcfg_iophymatch_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_select_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_pcvt_set_scrnsv_tmo_commajorulmin.o_dumpsys_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_wdc_pcmcia_ca_kmem_map_pcic_ident_ok_tl_probe_pciide_mapchan_nchstats_itimerdecr_vmspace0_ep_media_status_wb_mii_readreg_tl_mii_readreg_rl_mii_readreg_xl_mii_readreg_resume_pop_es_stack_underflow_pop_uvm_km_valloc_wait_resume_pop_ds_opti82c700_get_intr_ep_isa_probe_tcp_disconnect_userconf_disable_cd9660_tstamp_conv17md5.o_apm_powmgt_enable_fd_motor_off_msf2lba_ufs_whiteout_susword_stdump_ffs_init_process_read_regs_wdcstart_sd_atapibus_ops_cd_atapibus_ops_ip_defttl_tcp_init_am7990_reset___ashrdi3_in_setsockaddr_sysctl_rtable_vop_mkdir_desc_ec_read_hdr_epic_ifioctl_scsi_inqmatch_user_config_sys_fhopen_uvm_fault_unwire_rttrash_domainname_vmcmd_map_zero_wdc_pcmcia_disk_device_interface_wdattach_msdosfs_getattr_ether_ioctl_bpfattach_isa_dma_stats_loads_mii_phy_auto_timeout_ffs_alloc_rip_ctloutput_rqinit_ext2fs_create_deferred_config_queue_osrelease_wdcprobe_isa_dma_stats_bounces_ffs_balloc_timeout_del_uvm_map_replace_lf_advlock_sys_setsockopt_epsetfilter_ata_set_mode_pcic_detach_card_mouse_copy_start_timeout_add_wdc_print_caps_pcic_chip_socket_disable_fdcpseudointr_skip_char_left_Un_impl_wdactivate_ffs_fhtovp_kernfs_reclaim_vn_ioctl_CONST_INF_vttoif_tab_sys_chroot_sys_getpid_pool_inactive_time_ufs_readdir_fdcloseexec_totalfonts_avail_end_uvm_fault_domaininit_cd9660_ihashrem_pcic_event_process_opti82c558_init_epic_openbsd_probe_wdc_ata_bio_done_reserve_dumppages_amap_init_rt_ifmsg_amap_free_tcp_drop_sys_getsid_vop_reallocblks_vp_offsets_vop_balloc_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_inithtons.o_pcic_isa_alloc_iobase_swwrite_ip_ecn_ingress_sys_setrlimit_dc_setfilt_xircom_aic_scsi_reset_dvd_read_disckey_kernfs_getattr_ahbprint_dumpdev_kernfs_unmount_nchrdev_vop_select_desc_aic_pcmcia_ca_pcic_wait_ready_altgr_down_pmap_alloc_pv_gdt_size_wi_txeof_pcic_isa_intr_list_pci_subclass_system_epsetmedia_set_2ndcharset_uvm_map_setup_suid_clear_sys_getuid_exec_script_makecmds_dumpmag_ipsec_soft_bytes_ip_output_socantsendmore_pcibiosprobe_ne2100_isa_probe_m_copyback_sgr_tab_imono_com_raisedtr_dumpmem_uvm_map_reserve_adv_pci_ca_st_check_eod_uvmspace_init_CONST_PI2_bus_space_free_isa_defaultirq_icmp_send_ip_init_dp8390_reset_uvmspace_free_wi_stop_uvn_attach_vop_rmdir_descimax.o_in_ifscrub_sys_ftruncate_if_attachhead_config_detach_children_session0_bootapiver_clockintr_pci_subclass_network_CONST_PI4_uvm_swapout_threads_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_le_isapnp_ca_modifiers_VOP_UPDATE_wdc_exec_xfer_arp_intimer_Xmissing_initrtclock_isadma_copytobuf_cd_scsibus_set_modeimin.o_vt_reset_ansi_sdactivate_setregion_ffs_reclaim_userconf_add_read_rndstats_Crtat_si_get_i386_cpuid_features_uvm_pglistalloc_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_sys_getsockname_cd9660_ihashinsstrncmp.o_wb_setmulti_atapi_mode_select_softdep_change_directoryentry_offsetashrdi3.o_CONST_LN2_tss_alloc_ffs_fsync_checkdirs_sys_madvise_aic_minphys_ahc_isa_ca_vfs_unregister_kinfo_vdebug_vga_family_scsi_probe_bus_dos2unixtime_sys_accept_strncpy_m_copydata_wi_start_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_uvm_vnp_sync_sys_access_disk_init_bios_getdiskinfo_isapnp_process_tag_revarpwhoarewe_if_mark_unignore_icmp_error_ip_drain_amap_share_protect_ffs_unmount_ip_freemoptions_dead_select_userconf_device_sysctl_clockrate_ef_isapnp_ca_isapnp_ca_set_screen_size_amap_ref_disk_busy_epreadeeprom_wdcreset_piix_chip_map_uvmpagerops_cttyopen_isapnp_cd___hex2ascii_real_2op_NaN_poly_2xm1_epic_reset_pmap_map_ufs_reclaim_m_reclaim_randomioctl_dp8390_disable_dc_setfilt_asix_Xstray14_pciide_via_products_scsistrategy_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_Xstray15_rtcget_ffs_vget_ep_mii_readbit_max_hdr_Xstray12_wi_setdef_ahaminphys_vn_read_pccom_isa_ca_Xstray13_st_patterns_stopen_swdevt_sbrelease_Xstray10_tcp_attach_Xstray11_msdosfs_start_m_pulldown_arc4_reinit_initproc_ttycheckoutq_AscInitFromEEP_ffs_isblock_in_iawithaddr_ppsratecheck_zombproc_isa_intr_typename_st_erase_tcp_dooptions_ip_dooptions_cd9660_ihashget_mouse_copy_extend_after_kbd_cmd_speclisth_arith_overflow_tl_intr_uvm_page_physdump_baddynamicports_lastddate_ec_attach_biosopen_aic_abort_pci_intr_fixup_mii_phy_update_pmap_changebit_bpf_detachd_machine_suswintrntohl.oadddi3.o_calibrate_cyclecounter_ext2fs_advlock_rminit_via82c586_get_intr_sis85c503_set_intr_lance_isa_probe_comclose_extendfile_sofree_rmfree_pciide_sis_products_gdt_next_nullmodem_userconf_enable_uvmspace_exec_reg_load_bcd_rl_setmulti_raw_ctlinput_sysctl_rdstringumoddi3.o_disk_lock_PTmap_icmp_input_tcp_input_config_detach_sys_dup_set_charset_vfs_mountedon_VOP_READLINK_tl_dio_clrbit16_ipsec_def_auth_psratio_rnd_event_space_wdc_input_bytes_tl_init_vwakeup_kbd_code_init1_set_precision_flag_down_classnames_ifmedia_baudrate_descriptions_bioscnpollc__isa_bus_dmamap_sync__bus_dmamap_sync_ihashtbl_ip_freef_sis85c503_getclink_map_forwmerge_ip_frags_ep_detach_wi_shutdown_pcic_attach_pmap_release_unp_rights_timeout_init_tcp_notify_VOP_SYMLINK_fdexpandiordi3.o_cd_size_ext2fs_bmap_arpinit_done_vn_rdwr_xl_freetxrx_biosprobe_pcstop_raw_disconnect_rn_addmask_msdosfs_print_vgonel_sodisconnect_solisten_gsignal__randseed_setsegment_vfs_op_descs_bootargmap_fillinusemap_ttywflush_am7990_copytobuf_contig_tcp_ident_AscInquiryHandling_igmp_input_raw_detach_speedup_syncer_sbwait_vga_screen_off_ext2fs_open_Xhold12_ext2fs_blkfree_wdc_default_write_reg_Xhold13_ep_eisa_match_pci_lookup_quirkdata_viscpy_Xhold10_pcibios_get_intr_routing_mouse_paste_gdt_init_ufs_getattr_uvm_vsunlock_fxp_autosize_eeprom_icsphy_ca_Xhold11_child_return_gdt_free_uvm_page_physload_strncmp_pcmcia_ca_isapnp_bestconfig_tcp_mtudisc_icmp_mtudisc_ip_mtudisc_sysctl_tstring_sys_getgid_arith_underflow__isa_bus_dmamem_alloc_isa_dmamem_alloc_pci_mapreg_info__bus_dmamem_alloc_gdt_grow_icsphy_cd_Xhold14ntohs.o_ether_input_pcmcia_cd_Xhold15_btports_ufs_getlbns_uvm_useracc_uvm_km_pgremove_intrsafe_ext2fs_lookup_getnulldev_vt_reqtparm_bicc_isa_probe_le_isa_probe_wi_find_uao_set_swslot_saved_charsets_mii_submatch_ufs_readlink_bpf_movein_isapnp_map_untimeout_pmap_zero_page_ffs_clrblock_rn_walktree_nselcoll_sys_pwritev_copy_fault_pci_io_find_procfs_domem_scsiprint_emu_printall_ffs_readstart_ahc_isa_match_uvm_coredump_pciide_chan_candisable_rushjob_atapi_print_default_product_desc_nchinit_pccom_pcmcia_ca_wi_init_wdc_atapi_real_start_pmap_pte_inittodr_soqremque_vt_coldinit_wi_free_softdep_initialize_sysctl_rdstruct_pciaddr_print_devid_apm_suspend_vr_mii_readreg_vfs_shutdown_ep_mii_readreg_soisconnected_tl_eeprom_getbyte_cd_play_msdosfs_advlock_wi_read_data_uvm_anon_lockloanpg_msdosfs_statfs_cttywrite_vcount_vrecycle_rip_recvspace_rip_sendspace_unpst_recvspace_unpst_sendspace_spec_select_dc_mii_readbit_wi_rxeof_in_selectsrc_vn_stat_APTmap_pcibios_print_exclirq_clock_ymdhms_to_secs_dkcsumattach_uvmspace_unshare_aic_dump_driver_pmap_copy_lf_setlock_ahc_eisa_match_tcp_pulloutofband_initmsgbuf_pcic_print_apm_standbys_trapdebug_ttyprintf_fxp_statchg_fc_bmapcalls_ep_pcmcia_ca_get_usl_keymap_wddump_ifmedia_init_clock_secs_to_ymdhms_isa_free_config_make_softc_alltrapslmax.o_tl_attach_phy_uvm_fault_wire_aic_msgin_icsphyattach_timeout_hardclock_updatecmpdi2.o_wdc_pcmcia_lookup_ep_pcmcia_lookup_sdread_device_lookup_msdosfs_write_fucompp_scsibussubmatch_uvm_pglistalloc_npages_ext2fs_readlink_rootvp_wm_sqrt_wddone_ip_ecn_egress_aic_debug_get_pccons_isadma_map_epic_ifwatchdog_tcp_canceltimers_pool_setlowat_fxp_mediastatus_wdc_default_vtbllmin.o_bios_cksumlen_rddkdriver_isa_has_been_seen_uvm_vnp_terminate_nullioctl_ttioctl_dvd_read_copyright_scsibusmatch_max_keylen_fusufault_tl_ioctl_wi_head_ffs_sync_MCFail_ip_optcopy_cluster_rbuild_ne_pcmcia_ca_apm_cli_sdsize_ext2fs_makeinode_rn_refines_deadproc_VOP_UNLOCK_FPU_rm_wdc_atapi_intr_complete_wdc_atapi_send_cmd_sc_err1_ep_isa_probemedia_ahc_eisa_ca_xl_rx_resync_kbrepflag_le_isa_wrcsr_adv_pci_attach_soisdisconnected__wdc_ata_bio_start_wdc_ata_bio_start_wdc_atapi_start_CONST_1_rlphy_reset_pcread_ndflush_userconf_lines_setjmp_pcic_submatch_sys_readlink_vr_setmulti_ip_mtudisc_timeout_q_sys_getrusage_am7990_zerobuf_contig_ext2fs_init_dvd_read_manufact_uvm_map_create_tcp_slowtimo_ip_slowtimo_cansignal_acctsuspend_tcbtable_rt_timer_queue_destroy_vdevgone_Paste_avail_cd_play_tracks_ip_nhops_vop_default_desc_tl_mii_send_wdc_atapi_timer_handler_numcache_doingcache_vgaioctl_reg_load_extended_uvm_unloananon_vflush_syncerproc_fdcstart_softdep_setup_freeblocks_sobind_sys_getdirentries_sys_sigaction_pcic_chip_mem_alloc_pciintr_icu_table_sdminphys_ffs_mount_vop_vfree_desc_cd9660_mountroot_rdgetdisklabel_AscAbortCCB_pcmcia_read_cis_amd756_chip_map_default_chip_map_ext2fs_inode_pool_kill_vmcmds_dc_rx_resync_i386_iopl_m_zero_unputc_pmap_virtual_space_arpresolve_ifmedia_delete_instance_epic_eeprom_clock_cdactivate_map_backmerge_sbappendrecord_mountlist_fdattach_pmap_testbit_msdosfs_readlink_rdread_mainbus_ca_arpintr_wi_intr_mouse_button_usermount_sys_kill_vop_read_desc_xl_setmulti_pci_ca_uvm_kernacc_VOP_WHITEOUT_bufhashtbl_fdcprobe_msdosfs_vptofh_vop_generic_lock_disk_find_mainbus_cd_epic_ifstart_sys_fchdir_wakeup_pci_cd_dumpconf_amap_pp_adjref_rootfs_vfs_export_lookup_isa_intr_alloc_vclean_copyright_isapnp_configure_uvm_anon_init_bpf_validate_disk_unbusy_pipe_stat_pcibios_max_bus_hw_sysctl_sys_munmap_nblkdev_ep_vortex_probemedia_vga_chipset_pci_conf_write_tcp_backoff_vsnprintf_timedelta_rdsize_dc_shutdown_dc_mii_readreg_hz_wi_pcmcia_attach_com_pcmcia_attach_aic_pcmcia_attach_ne_pcmcia_attach_ep_pcmcia_attach_pcmcia_attach_scrollback_mouse_sys_link_async_update_amap_unref_ifqmaxlen_isa_drq_isfree_dvd_read_struct_ufs_root_udp_output_unp_disconnect_isapnp_init_pool_reclaim_clr_parms_ext2fs_link_ipip_allow_ext2fs_fifoop_opv_desc_ffs_fifoop_opv_desc_sys_fchown_cd9660_fifoop_opv_desc_bpf_tap_ntimeout_ttywait_wdccommandshort__isa_bus_dmamap_create_isa_dmamap_create_isa_intr_check__bus_dmamap_create_mask_rnhead_vfs_register_getphysbuf_mii_down_pciintr_icu_handle_pool_destroy_ffs_blkfree_rl_mii_send_uvm_pageunwire_config_process_deferred_children_killpg1_sys_sigpending_sgr_tab_color_read_seeprom_lockmgr___bin2bcd_vs_sd_reassign_blocks_procfs_findtextvp_pcibios_flags_ahbminphys_eisa_maxslots_uvm_pagezero_uvm_pagealloc_strat_amap_extend_kern_targets_acer_chip_map_wdopen_vfs_opv_init_explicit_soshutdown_sys_shutdown_exphy_ca_apm_cpu_busy_iophyattach__main.o_eisa_intr_string_mouse_zaxis_pci_intr_string_uvm_pagermapin_cd9660_access_wb_stop_bus_mem_add_mapping_iomem_ex_comcninit_in_pcbdisconnect_exphy_cd_ffs_vfree_udp_init_raw_recvspace_raw_sendspace_disk_unlock_initclocks_cd9660_strategy_keyboard_is_initialized_pv_efwatchdog_fdfinish_vt_ech_isadma_copyfrombuf_cd9660_start_isapnp_newconf_ec_mediastatus_rl_intr_cd_reset_rtl80x9_mediastatus_isadmaattach_apmopen_icmperrppslim_last_invalhash_logopen_AscInitASC_SOFTC_qs_select_vga_charset_vfs_hang_addrlist_swapdev_tz_bootargc_apm_evindex_vt_col_vt_dch_atapiscsi_match_rlphymatch_cpu_coredump_locnamp_cse_koi8_mmclose_uvm_anon_dropswap_winSlotCnt_sys_symlink_uvm_init_limits_tl_mii_sync_cmd_pci_intr_stioctl_ext2fs_blkpref_ufs_makeinode_sys_mmap_sys_exit_vt_aln_in_interfaces_ffs_mountroot_dk_mountroot_vfs_mountroot_am7990_start_pcmcia_card_detach_apm_power_print_cmd_chip_maplocc.o_wdc_pcmcia_disk_device_interface_callback_vp3_cfg_trigger_shift_fxp_pci_attach_xl_pci_attach__bus_dmamem_alloc_range_uvm_anfree_softdep_setup_allocindir_page_vn_initialize_syncerd_userconf_parse_curpriority_fusword_ufs_advlock_icmp_ratelimit_apm_disconnect_rd_root_size_xl_txeof_90xB_Xfpusegm_copyinstr_opti82c700_init_rl_init_udp_recvspace_udp_sendspace_epmbufempty_ldt_free_rt_timer_add_sonewconn1_pipe_select_checkalias_am7990_copyfrombuf_contig_bootargv_ext2fs_vget_autoconf_verbose_pcvt_kbd_fifo_fakeintr_pool_page_free_nointr_in_pcbnotifyall_VOP_SELECT_pollscan_dc_coal_pci_map_io_pmap_init_tcp_mssdflt_lastday_randomattach_Xfast12_vt_dld_pmap_destroy_Xfast13_wb_setcfg_wb_mii_send_ffs_truncate_rip_usrreq_Xfast10_aha2840_load_seeprom_dectohexdec_bt_collect_mbo_bootargp_in_pcbrehash_ratecheck_Xfast11_pool_sethiwat_ufs_seek_sys_open_uvm_map_loopattach_desiredvnodes_epic_set_rx_mode_uvm_pagealloc_contig_timeout_static_fs_sysctl_sys_mprotect_isa_dmastart_cdminphys_setdisklabel_Xfast14_pcintr_ip4_input_cd9660_pathconf_cd9660_print_if_index_Xfast15_wb_fixmedia_tqphyattach_igmp_sendpkt_disksort_pgfind_pcmcia_ccr_read_com_pcmcia_disable_ne_pcmcia_disable_ep_pcmcia_disable_pcmcia_submatch_isapnp_com_submatch_reg_store_double__insque_pcmmap_ext2fs_dirrewrite_ufs_dirbadentry_tcpdropoldhalfopen_cpu_initclocks_sys_fork_rddump_st_mode_select_statclock_limfree_vfs_export_fxp_pci_ca_xl_pci_ca_soisconnecting_reaper_wi_write_record_comwrite_in_socktrim_fddkdriver_pchbmatch_tcp_rst_ppslim_last_soaccept_tty_count_bpf_mtap_vt_ind_st_mount_tape_uvm_unmap_icmp_reflect_sys_fhstat_sys_fchmod_utsname_nmbclusters_st_pcic_write_vt_designate_we_recv_int_bus_space_subregion_ttypend_vop_advlock_desc_microtime_vt_nel_wb_list_rx_init_tl_list_rx_init_vr_list_rx_init_rl_mii_sync_configure_ext2fs_setattr_tcp_reass_sbreserve_xl_list_rx_init_wdc_cd_Xbnd_apm_cpu_idle_isapnp_find_ahb_scsi_cmd_csd_koi8_sys_bind_comdefaultrate_epic_stop_activity_cd_pause_dp8390_start_uvm_pagewire_ufs_makedirentry_msdosfs_close_VOP_REMOVE_sbcreatecontrol_sysctl_int_Xdbg_le_pci_attach_set_pci_isa_bridge_callback_zeropage_Xdiv_vt_cuu_tcp_keepidle_slpque_cpu_f00f_bug_srandom_st_read_block_limits_uvm_vmspace_pool_dead_strategy_sys_statfs_poly_tan_ext2fs_specop_opv_desc_ext2fs_vnodeop_opv_desc_msdosfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_sync_vnodeop_opv_desc_pipe_read_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_pcibios_entry_get_address_bt_free_ccb_pci_mapreg_type_apmcall_comconsaddr_pool_create_arp_inuse_lockmgr_printinfo_sys_acct_max_datalen_softdep_setup_allocindir_metasubdi3.o_pci_device_foreach_dc_devs_inphymatch_amap_unadd_ext2fs_remove_xl_setcfg_softdep_mount_m_pullup_msdosfs_setattr_unix2winfn_bt_scsi_cmd_acer_pci_intr_st_unmount_scsi_strvis_recvit_sendit_epconfig_CONST_Z_pci_subclass_communications_VOP_RENAME_profprocs_vt_cuf_tl_dio_clrbit_wdc_ata_ctrl_intr_biosclose_unixsw_vt_cud_rn_insert_kernfs_lookup_uihash_sys_getlogin_fifo_advlock_opti82c700_addr_pcic_power_vt_clrtab_vt_cub_vt_dsr_pmap_activate_tk_rawcc_sys_ostatfs_epstart_pcmcia_function_enable_kern_attr_pmap_initialized_uvm_map_findspace_pcmcia_scan_cis_sddump_pool_prime_maxdmap_lastpid_dc_init_bt_init_ccb_tl_watchdog_pmap_create_ifafree_if_slowtimo_sys_getpgid_dp8390_mediastatus_Xdoreti_apm_resume_ext2fs_rename_ext2fs_read_vfs_free_addrlist_sys_dup2_ne_isa_match_wb_tick_wdread_sys_truncate_pci_mode_softdep_fsync_random_fxp_mdi_write_Xdna_ef_mii_sync_ahc_isa_irq_mouse_copy_line_wb_mii_sync_asc_mcode_tcp_trace_isapnp_testconfig_sddone_insmntque_limcopy_ether_delmulti_cse_special_st_loadquirks_sbdrop_sys___sysctl_dc_newbuf_Xill_count_lock_queue_m_free_vprintf_psignal_vop_close_desc_am7990_setladrf_wi_ca_vt_sgr_we_attach_ep_pci_attach_chainalloc_mii_attach_bpf_dtab_rtioctl_cse_downloadable_vga10_vga16_wi_cd_XXX_mmap_vop_generic_unlock_VOP_REVOKE_vga10_vga14_pv_page_freelist_lf_wakelock_wdsize_isapnp_wait_status_igmp_slowtimo_useloopback_sys_swapon_ep_default_to_media_vt_udk_stmatch_tcp_rst_ppslim_rn_init_userconf_histsz_aic_dump6360_vga10_vga10_comcngetc_ext2fs_reload_doasyncfree_suser_ef_tick_vt_ris_normalize_nuo_ext2fs_truncate_unp_gc_vt_sel_aha_collect_mbo_scsi_print_sense_uvn_sync_lock_sogetopt_sys_sstk_vop_unlock_desc_ahc_reset_Xofl_Xbpt_vt_sca_ahb_timeout_skip_spc_left_pdc202xx_pci_intr_yield_cd9660_lock_dc_setfilt_apmerrors_wdgetdisklabel_sdgetdisklabel_cdgetdisklabel_mii_phy_delete_media_pager_map_wanted_uvm_sysctl_cd9660_defattr_readdisklabel_ahb_free_ecb_pdc202xx_chip_map_vop_revoke_desc_cd9660_link_csd_isolatin_arith_invalid_sysbeep_ukphyattach_wdc_atapi_the_machine_rootconf_vop_open_desc_cpu_vendor_vop_reallocblks_desc_VOP_VALLOC_uvm_swapin_sys_sendmsg_sys_recvmsg_vt_sed_revarprequest_nbigpipe_pmap_extract_ripsrc_ip_stripoptions_vfs_opv_numops_efcompletecmd_comstart_epic_ifmedia_upd_pmap_remove_pv_in_localaddr_soisdisconnecting_rdopen_le_isapnp_match_wdc_isapnp_match_pcvt_kbd_wptr_msdosfs_fsync_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_ahbmatch_vt_scl_killproc_sys_sync_route_src_disk_count_tl_ca_ufs_bmap_dofilewritev_pcic_chip_io_free_fxp_mediachange_syscall_Xnmiqdivrem.o_pcdisp_comspeed_reg_load_double_ext2fs_sync_ip_reass_kernfs_setattr_tl_cd_via82c586_get_trigger_piix_get_trigger_opti82c558_get_trigger_epic_ifmedia_sts_pciide_dma_table_setup_uvm_pagefree_ffs_blkpref_arc4_timeout_Xfpu_sosend_sys_profil_comprobe_polynomial_bpf_attachd_readde_dc_pci_attach_ahc_pci_attach_wdc_atapi_tape_done_ufs_open_pcbmap_procfs_dofpregs_pciintr_icu_lookup_uvm_pageremove_uvm_swap_get_userconf_maxdev_enqueue_randomness_dequeue_randomness_tcp_saveti_uvm_pageactivate_bpf_ifname_mbtypes_aic_print_active_acb_ipip_sysctl_pcopen_cluster_wbuild_userconf_modify_iso_disklabelspoof_pcic_isa_ca_aha_isa_ca_aic_isa_ca_apm_set_ver_tcp_totbackoff_ttstart_exec_aout_prep_zmagic_vt_strFPU_round__isa_bus_dmamap_destroy_isa_dmamap_destroy__bus_dmamap_destroy_gdt_shrink_ifmedia_baudrate_blktochr_rd_open_hook_softclock_le_isa_intredge_scsi_prevent_ifmedia_match_sd_ca_epic_input_eepromw_vinvalbuf_mainbus_print_cd9660_mmap_dc_attach_common_fxp_attach_common_am7990_intr_uvmcnt_dump_msdosfs_mkdir_readep_pffindtype_addupc_intr_dc_intr_sd_cd_uvm_swap_put_cd9660_deftstamp_bus_space_alloc_uvmspace_alloc_ext2fs_alloc_bpf_iflist_bpfopen_vn_write_userconf_add_leapyear_ttyopen_bios_pciinfo_ne_pci_lookup_doclusterwrite_msdosfs_update_fifo_lookup_md_diskconf_wdcrestart_mmioctl_sysctl_dumpentry_loioctl_sis85c503_pci_icu_uvm_map_extract_sys_stat_cd9660_init_arc4random_initialized_physio_m_clalloc_proc0paddr_vt_tst_sd_scsibus_flush_chkvnlock_APTD_we_mediastatus_wb_watchdog_pmap_enter_aic_sense_ne_isa_ca_pchb_print_sdopen_fifo_printinfo_ext2fs_vfsops_vrele_am7990_init_mouse_copy_extend_line_VOP_PRINT_aic_sched_proc0_vt_switch_pending_rl_stop_ffs_freefile_procfs_validregs___qdivrem_apm_thread_div_small_tl_phy_writereg_vr_phy_writereg_i386_nocpuid_cpus_spec_print_vnode_hold_list_soconnect2_userconf_cnt_divide_by_zero_ip_pcbopts_in_delmulti_preempt_apm_perror_uvm_aobj_pool_unix2dostime_bufhash_ext2fs_mountroot_VOP_GETATTR_rd_cd_wb_intr_dcphy_auto_vop_lease_desc_apmattach_comconsinit_amphyattach_nsphyattach_uvm_total_msdosfs_mknod_ruadd_sys_sigaltstack_curpcb_vt_clreos_pcvt_kbd_rptr_tcp_rst_ppslim_count_mono_time_m_retryhdr_we_set_media_diskconf_wdccommand_comparam_wdc_atapi_reset_msdosfs_root_uprintf_comcnputc_vmcmd_map_pagedvn_pciide_channel_dma_setup_uvm_unloanpage_uvm_pagecopy_AscISR_pcibios_get_status_fdcstatus_epintr_ep_isa_media_wi_ioctl_scsibusdetach_cluster_write_cttyioctl_ttybg_sys_getppid_swapbuf_pool_amap_lookup_xl_mii_send_maxproc_bufinit_arpintrq_apm_record_event_wb_init_dumplo_vm_nphysseg_ufs_setattr_softdep_increase_linkcnt_sys_mlock_sys_adjtime_kmembase_revarpwhoami_isohashtbl_mountroot_fscale_vt_clreol_syncdelay_sys_fsync_ufsfifo_close_ahc_attach_isadma_dmam_startprofclock_fusuaddrfault_csd_technical_userconf_pdevnamFPU_round_sqrt_ufs_dirrewrite_issignal_csignal_mbinit_Xsyscall_wdioctlstrategy_udbtable_rn_mkfreelist_ef_ifmedia_upd_wb_ifmedia_upd_tl_ifmedia_upd_rl_ifmedia_upd_stclose_kernfs_badop_sys_preadv_vop_islocked_desc_xl_ifmedia_upd_rl_watchdog_scsi_user_done_uvm_km_init_minphys_fdformat_ext2fs_fsync_msdosfs_ioctl_sys_sbrk_uvm_km_free_bpf_setf_sys_clock_gettime_Xtss_vr_mii_send_wdc_atapi_intr_for_us_rn_lookup_VOP_RECLAIM_ttyin_indent_ec_mediachange_allocsys_rtl80x9_mediachange_malloc_pciide_map_compat_intr_process_write_regs_dc_list_rx_init_isa_strayintr_via82c586_set_trigger_piix_set_trigger_opti82c558_set_trigger_pci_bus_fixup_ef_ifmedia_sts_char_count_wb_ifmedia_sts_tl_ifmedia_sts_rl_ifmedia_sts_dc_crc_be_xl_ifmedia_sts_wb_ca_machine_arch_uvm_cnt_head_vmi_list_ufs_init_mc146818_read_uao_create_nfiles_randomwrite_pcic_pci_attach_pciintr_irq_release_pcic_pci_machdep_intr_est_ne_pci_attach_iso_nchstats_mii_tick_wb_cd_cd_scsibus_setvol_if_qflush_msdosfs_read_sys_poll_cse_technical_ec_set_media_pgrphash_config_init_cd9660_fifoop_p_si_find_softdep_setup_blkmapdep_incore_wdcactivate_Xstk_pciaddr_do_resource_reserve_pciaddr_resource_reserve_route_dst_maxlockdepth_rdstrategy_uvm_map_call_sys_mkdir_sis85c503_init_FPU_data_address_ipsendredirects_biosioctl_uvm_page_rehash_va_null_ifmedia_ioctl_fubyte_cpu_cache_ebx_zdmap_memset_unp_attach_logread_we_cd_vr_setmode_mii_ufs_access_uvm_vnp_setsize_VOP_WRITE_dp8390_getmcaf_cpu_cache_ecx_wi_pcmcia_match_com_pcmcia_match_aic_pcmcia_match_ne_pcmcia_match_bios32_service_fd_set_motor_epic_output_eepromw_tl_dio_write32_tl_dio_write16_ttyinfo_ttyoutput_randomopen_wb_mii_writereg_tl_mii_writereg_vr_mii_writereg_rl_mii_writereg_nclruhead_spec_write_xl_mii_writereg_ep_mii_sync_ep_mii_writereg_ukphy_ca_msdosfs_seek_vfs_unbusy_epic_start_activity_tl_setfilt_ext2fs_mkdir_ttylist_v_putc_sys_pwrite_wd_ca_cpu_cache_eax_si_free_tcp_do_sack_ttyfree_ukphy_cd_swbuf_vt_clearudk_pv_nfree_VOP_READDIR_addupc_task_msgbufmapped_dc_tick_atdevbase_ttwrite_epreset_wd_cd_longjmp_init386_raw_usrreq_dc_crc_le_aic_msgout_wddetach_bpfdetach_wdcbit_bucket_wdc_select_drive___wdstart_log_open_cpu_cache_edx_in_baddynamic_ifunit_epinit_class_cmp_ctrl_down_poly_div2_pcmcia_card_intr_pcmcia_ccr_write_idt_region_totalscreens_poly_div4_tl_attach_uvm_km_suballoc_sys_mknod_cd9660_bmap_tcbhashsize_bpfread_ifmedia_set_uvm_swap_alloc_ufs_lock_nosuidcoredump_ef_miibus_writereg_wb_miibus_writereg_epic_miibus_writereg_rl_miibus_writereg_i386_cpuid_cpus_thread_sleep_msg_sys_pipe_cd9660_statfs_dc_miibus_writereg_xl_miibus_writereg_xl_mii_sync_gdt_count_iszerodev_ufs_link_dounmount_sys_read_ether_ipmulticast_min_ahb_send_immed_procfs_doregs_disklist_acctwatch_uvm_pagermapout_cd9660_open_rl_ca_isapnp_free_region_rip_init_ifa_ifwithnet_user_attr_CONST_QNaN_vm_physmem_ext2fs_mknod_tty_attach_setrunqueue_rl_tick_gdt_flags_tcp_newtcpcb_VOP_ISLOCKED_rl_cd_wi_inquire_rtcintr_ufs_vinit_vop_remove_desc_ether_ipmulticast_max_comsopen_ipsec_exp_first_use_ipsec_soft_first_use_msdosfs_sync_pciide_cmd_products_cd9660_rrip_getname_isapnp_alloc_irq_vr_autoneg_xmit_forkstat_dp8390_watchdog_rd_sleep_pri_fxp_add_rfabuf_am7990_watchdog_uvm_mlk_call_ipip_input_ipv4_tunnelsetup_sockargs_userconf_argbuf_tprintf_wb_attach_cd9660_islocked_tl_encap_arpioctl_lf_getlock_bwrite_vop_generic_revoke_pciide_chansetup_ipport_lastauto_sys_writev_vr_mii_sync_rl_ioctl_cy82c693_write_si_head_vgacs_tl_wait_up_sys_fstat_memcpy_apm_ep_shift_down_msdosfs_mount_reset_screen_saver_kmeminit_sys_ioctl_isodirino_pciide_attach_wdc_atapi_in_data_phase_poly_atan_isadma_unmap_st_space_procinit_uvm_init_ffs_write_consintr_ep_media_change_aic_reset_sync_print_boottime_ne2000_write_mbuf_apm_ca_extmem_uvm_grow_dc_ifmedia_upd_ef_isapnp_match_ep_isapnp_match_isapnp_match_device_ref_apm_cdstrcat.o_ne_pcmcia_get_enaddr_ep_pcmcia_get_enaddr_ifnet_addrs_sys_getegid_wdcattach_uvm_mk_pcluster_ufs_mmap_ifioctl_extent_alloc_subregion1udivdi3.o_uvm_dump_vop_truncate_desc_dp8390_mediachange_pcic_init_socket_isapnp_alloc_drq_VOP_LOOKUP_raw_input_pipe_write_opti82c700_get_trigger_pchbattach_dc_ifmedia_sts_le_pci_ca_m_devget_ffs_blkatoff_sys_ptrace_wdc_preata_drive_apm_suspends_fucomp_consinit_adv_switch_pcic_chip_do_io_map_ext2gennumber_hashinit_wdc_get_xfer_ifmedia_add_apm_periodic_check_fst_i__bt_reset_ccb_sun_noname_ttrstrt_wi_mgmt_xmit_ufs_fhtovp_sbcompress_selwakeup_sleep_opti82c700_pci_icu_virtual_avail_ifa_ifwithroute_vr_watchdog_pci_subclass_multimedia_identifycpu_tcp_ctlinput_deextend_allocbuf_m_getptr_runtime_route_proto_updatefats_uvmfault_anonget_ipforward_rt_rtalloc_process_write_fpregs_xl_attach_vr_getmode_mii_pciide_mapregs_native_math_emulate_uvm_pageboot_alloc_cpu_set_kpc_mouse_copy_extend_char_usl_vt_ioctl_reg_add_scsidebug_luns_inetsw_rt_newaddrmsg_m_prepend_initsiginfo_bioscnputc_cd_read_toc_scsi_size_mouse_copy_word_uvm_mlk_hint_uvm_loan_buffers_switch_screen_iskmemdev_dofilereadv_intrcnt_stack_overflow__isa_dma_check_buffer_isa_mappage_isa_dmamem_free_cd9660_vptofh_ne2000_test_mem_am7990_stop_ufs_ihashinit_realitexpire_dc_stop_st_ca_aha_reset_ccb_tl_setmode_rip_output_vn_closefile_fucom__dc_read_eeprom_epbusyeeprom_efsetmulti_tl_intvec_txeoc_sdwrite_tcp_now_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_csd_supplemental_uvm_lock_fpageq_rt_setgate_fxp_watchdog_xl_watchdog_wb_rxeoc_vr_reset_in_canforward_rawcb_tl_intvec_txeof_uvm_map_init_ffs_reload_pcic_intr_msdosfs_access_reinsert_syncer_maxdelay_memchr_maxsmap_uvm_vslock_wb_rxeof_msdosfs_bmap_myip_ifp_dp8390_intr_in_pcblookup_nchash_pcibios_entry_info_eisa_ca_ncr_ca_soo_ioctl_sys_fpathconf_ahc_xxx_reset_ahc_construct_pci_subclass_serialbus_pctty_msdosfs_open___moddi3_VOP_CREATE_memcmp_apm_minver_aha_init_acctchkfreq_spec_lookup_VOP_ABORTOP_aic_init_eisa_cd_ncr_cd_pcic_attach_card_scsi_inquire_ext2fs_inactive_win2unixfn_tx_ca_icsphy_reset_trap_type_uvm_pager_init_epic_stop_tl_intvec_netsts_pciide_amd_products_pci_mapreg_map_cdwrite_vgone_cd9660_check_export_stack_underflow_i_udp_sysctl_setregs_xl_eeprom_wait_tx_cd_sigcode_reg_mul_cp_time_sys_mount_pcibios_return_code_pcattach_fsubrp_uvm_map_entry_pool_settime_sys_nosys_pgrp0_dp8390_init_ne2000_attach_pcibios_ca_reg_div_ufs_rmdir_encdebug_ticks_start_update_ether_addmulti_wdc_disable_intranddi3.o_pcic_pci_match_cd9660_sync_xl_rxeof_epstop_pv_size_want_resched_fstp_i_pmap_free_pv_igmpstat_userconf_totdev_ether_ifdetach_pcibios_cd_ahc_eisa_irq_wdioctl_uvm_mmap_bpfioctl_fc_lfcempty_uvm_exit_isapnp_merge_cache_purgevfs_itimerfix_reallocate_copybuffer_ext2fs_mount_udp_input_pipeclose_sys_utimes_wdcdebug_mask_mainbus_attach_ffs_fragacct_pcmcia_check_cis_quirks_ahb_done_uvm_unmap_remove_ipqmaxlen_cd9660_quotactl_fcom_st_pci_class_tcp_timers_unp_connect_piix_set_intr_opti82c558_set_intr_setroot_vr_ca_vr_ifmedia_upd_apmselect_logselect_pfind_rd_attach_hook_inside_udp_ctlinput_unixdomain_Xspllower_comintr_pciide_mapreg_dma_pcwrite_tcp_iss_createde_fdavail_randomread_vr_cd_vt_su_probe_switch_kernfs_vfsops_cd9660_specop_p_if_attach_ahb_find_CONST_PI_wb_txeoc_pciintr_pir_lookup_vt_ri_we_mediachange_adv_pci_match_uvm_map_reference_udp_usrreq_isa_dma_stats_nbouncebufs_opti82c700_set_trigger_wb_txeof_vr_ifmedia_sts_mem_no_union_check_p_sys_unmount_vop_bmap_desc_pciintr_link_route_ext2fs_blkatoff_VOP_VFREE_uvm_map_inherit_piix_getclink_opti82c558_getclink_sysctl_iflist_sys_getpeername_vga10_vga8_stopprofclock_sys_getfh_ulmin_ext2fs_cgupdate_rn_search_m_vt_sc_kbd_setmode_fsubri_bus_space_unmap_ufs_inactive_sync_inactive_savectx_cominit_round_to_int_bt_init_ifconf_kthread_create_deferred_uvm_fork_vt_rc_compwroff_shrxs_pciide_intel_products_protection_codes_sys_geteuid_wdc_default_read_reg_wi_setmulti__isa_bus_dmamap_load_mbuf_pcimatch__bus_dmamap_load_mbuf_pcibios_pir_header_st_rewind_ulmax_vt_sd_st_quirk_patterns_scsi_quirk_patterns_tcp_mss_ffs_vfsops_xl_cd_kbd_polling_ext2fs_valloc_vnops_vfs_rootmountalloc_xl_txeoc_fuswintrskpc.o_ep_pcmcia_match_pcmcia_match_isa_dmamem_mmap_m_gethdr_brelvp_ne2000_read_hdr_reset_usl_modes_breada_linesw_cd9660_read_dc_mii_writereg_panic_vt_il_xl_txeofstrcmp.o_uvm_pageratop_icmp_mtudisc_timeout_ip_mtudisc_timeout_unp_dispose_dc_encap_pcic_chip_do_mem_map_epic_rx_done_uvm_setpagesize_cd9660_rrip_getsymname_vt_mc_Copybuffer_ttysleep_btintr_vr_phy_readreg_breadn_wdc_probe_caps_sixel_vga_fsubr__pmap_removeashldi3.o_mmopen_prtactive_dc_delay___iordi3_sdstart_ext2fs_vinit_ext2fs_statfs_softdep_update_inodeblock_msdosfs_fhtovp_sys_lstat_ep_read_eeprom_fstenv_ext2fs_vfree_m_get_fifo_select_fifo_badop_locnames_fsubp__wb_start_uvm_km_alloc_poolpage1_in_losing_siginit_lockinit_pci_conf_read_virtual_end_cd9660_seek_dp8390_read_at_poll_vt_ic_tty_detach_uvm_scheduler_nexecs_ifindex2ifnet___wdccommand_intr_vmmap___umoddi3_putphysbuf_uvm_km_valloc_rdwrite_m_adj_pcic_chip_io_unmap_fxp_pci_match_xl_pci_match_wdc_atapi_real_start_2_st_load_m_pullup2_config_rootfound_Scrollbuffer_sgr_tab_mono_stattach_cd9660_vget_intel686_cpu_setup_m_cat_m_copym2_allcftables_ipsec_exp_allocations_ipsec_soft_allocations_msdosfs_init_scanc_arc4random_8_max_linkhdr_wb_probe_apmclose_snprintf_logclose_panicstr_xl_setmulti_hash_vt_da_wdgetdefaultlabel_getvnode_disk_attach_dc_eeprom_idle_am7990_meminit_wdc_atapibus_attach_uvm_km_pgremove_tcp_usrclosed_lf_addblock_cache_lookup_sgetc_bt_get_ccb_mainbus_match_isa_nmi_brelse_isadma_ca_Xstray6_vt_dl_cdstart_fdstrategy_rn_search_msgbufenabled_stop_uvm_pageout_Xstray7_in_pcbnotify_crcopy_sys_sendto_Xstray4__remque_tcp_xmit_timer_fc_lmdistance_fxp_start_xl_start_ahc_init_isadma_cd_mbstat_Xstray5_ec_readmem_ufs_ihashrem_findwin95_ahc_free_wdc_floating_bus_vt_ca_Xsofttty_Xstray2_ipsec_def_enc_igmp_init_vfs_getnewfsid_sys_flock_netisr_Xstray3_in_addmulti_kernfs_open_bdwrite_ttselect_sys_rename_Xstray0_pciide_dma_finish_le_pci_match_fifo_ebadf_pffasttimo_sys_msync_biowait_epread_vt_cd_Xstray1_cpu_id___one_cmpldi2_FPU_loaded_data_pgdelete_fusubail_pcibios_pir_initFPU_Arith_exit_frstor_sdattach_limit0_cd9660_setattr_vput_etext_ifa_ifwithaf_kernfs_xwrite_vn_select_logpri_cache_purge_mii_mediachg_csd_special_ext2fs_sysctl_ffs_setblock_fsub_i_fifo_close_spec_fsync_ef_miibus_readreg_vgapage_wb_miibus_readreg_epic_miibus_readreg_rl_miibus_readreg_cn_tab_dc_miibus_readreg_xl_miibus_readreg_pci_addr_fixup_kbdioctl_fgansitopc_comdiag_swapconf_cd9660_root_Xstray8_dp8390_rint_xl_setmode_Xstray9_efbusyeeprom__isa_bus_dmamap_load_raw_pci_subclass_bridge__bus_dmamap_load_raw_softdep_load_inodeblock_sys_connect_amphy_ca_nsphy_ca_pcmcia_function_init_lastdosdate_netcon_boothowto_isapnp_unconfig_pcstart__isa_bus_dmamap_unload_bt_done__bus_dmamap_unload_uvm_unlock_fpageq_hostid_sys_setpgid_cd9660_vget_internal_m_retry_aic_dequeue_wdc_wait_for_status_amphy_cd_nsphy_cd_ne_pcmcia_dl10019_get_enaddr_aha_finish_ccbs_aha_switch_msgbufmap_softdep_setup_directory_add_aic_switch_pcic_isa_addr_ufs_dirbad_m_getclr_q_to_b_trap__isa_dma_alloc_bouncebuf_epic_init_ep_pci_match_ufs_start_soreceive_exit1_sys_getitimer_elink_reset_tl_intvec_rxeoc_pciide_compat_intr_msdosfs_lock_kmemusage_exit2_ahbattach_bzero___negdi2_st_pcic_read_aha_timeout_bt_find_argdev_maxslp_pmap_page_protect_around_rn_addroute_msdosfs_link_ttydefchars_aic_timeout_fuword_reg_store_bcd_reg_sub_tl_intvec_rxeof_putc_execsw_imask_pcprobe_kernfs_mount_mountlist_slock_disk_construct_ifinit_epget__isa_bus_dmamap_load_uio__bus_dmamap_load_uio_netcls_crfree_AscResetDevice_wd_flushcache_cnioctl_fdioctl_bpf_mcopy_relookup_AscResetBus_fsave_ipip_output_msdosfs_inactive_opti82c700_set_intr_VOP_RMDIR_vop_generic_abortop_bucket_cd_load_toc_ufs_ihashins_start_init_vn_default_error_ep_pci_ca_sput_isa_dev_scsi_get_xs_sys_lseek_sys_select_scheduler_start_wdc_atapi_dma_flags_pciintr_link_map_list_apm_majver_ahb_init_mmmmap_ext2fs_vptofh_sys_close_dc_mii_writebit_fxp_cdstrlen.o_wdrestart_uao_reference_procfs_checkioperm_powerhook_list_shutdownhook_list_ep_mii_setbit_bioscninit_more_chars_compare_st_data_ufsspec_write_uvm_km_kmemalloc_vop_access_desc_AscExeScsiQueue_timeoutsstrncasecmp.o_cdattach_scsi_donestrcpy.o_out_fdc_pcvt_kbd_count_namei_pcibios_pir_table_nentries_ec_media_gdt_compact_comopen_kernfs_xread_lbolt_opti82c700_getclink_mouse_copy_extend_word_set_precision_flag_up__isa_bus_dmamem_free_wb_reset__bus_dmamem_free_VOP_BWRITE_wdc_downgrade_mode_nextgennumber_bgansitopc_sigexit_unsleep_eptxstat_aic_datain_pio_ldt_alloc_wdc_exec_commandmemcmp.o_via82c586_set_intr_sis85c503_get_intr_ec_write_mbuf_epic_read_eeprom_ufs_print_apm_resumes_cse_ascii_scsi_autoconf_swstrategy_procfs_validfpregs_dynamic_gdt_cse_supplemental_in_revarpinput_revarpinput_PTD_lba2msf_uvmspace_share_VOP_MKNOD_arc4random___wdccommand_done_fstsw__aha_done_sd_scsibus_ops_cd_scsibus_ops_skpc_sys_chmod_allproc_aic_done_wi_write_data_uvm_anon_add_fxch_i_amphymatch_nsphymatch_ext2fs_rmdir_msdosfs_mmap_m_split_sys_chdir_epmbuffill_cd_ca_selrecord_cred0_fsub___in_setpeeraddr_ttwakeup_time_winchip_cpu_setup_ufs_ihashget_tcp_rttdflt_setstatclockrate_ahc_intr_cd_cd_removede_nchashtbl_vfs_sysctl_VOP_SETATTR_sys_fcntl_cd9660_rrip_offset_aha_find_dp8390_stop_xl_reset_aic_find_apollo_chip_map_bpf_freed_vfs_op_init_soabort_arc4random_state_sccs_looutput_kernfs_inactive_fifo_inactive_rtl80x9_init_media_pcparam_isapnp_flatten_i386_protection_init_ufs_check_export_msdosfs_check_export_kernfs_vfree_shrx_setgate_tl_newbuf_st_read_kernfs_init_sys_chown_adaptor_type_sbappendcontrol_sys_reboot_check_exec_inphy_ca_intrstray_udpcksum_ip_directedbcast_ne_pci_match_tl_calchash_ihash_lookup_VOP_STRATEGY_sysctl_vnode_inphy_cd_tick_pciide_vendors_dev_rawpart_makefstype_sys_opipe_icmpmaskrepl_vop_blkatoff_desc_ahbintr_poly_sine_rd_root_image___udivdi3_pcic_chip_mem_free_vr_rxeoc_ufs_create_dead_write_vntblinit_arp_ifinit_wdcintr_isa_ca_aha_isapnp_probe_dcphy_attach_softdep_fsync_mountdev_unp_discard_spec_ioctl_Xsoftnet_npxprobe_epic_intr_cd_scsibus_get_mode_VOP_FSYNC_ttsetwater_rootdev_vr_rxeof_spec_inactive_config_scan_isa_cd_vt_set_ansi_fdiv_i_vfs_free_netcred_nextc_pcic_chip_socket_enable_eisasubmatch_in_broadcast___assert_vgetmemchr.o_pmap_pinit_uvm_km_free_poolpage1_ip_maxqueue_netio_sysctl_doproc_bt_cmd_wb_newbuf_xs_free_list_sysctl_rdint_trace_req_ifnet___wdccommand_start_we_params_bt_finish_ccbs_bios_memmap_soo_close_bios_ca_udv_attach_hardclock_sys_clock_settime_ne2000devs_pmap_reference_ipsec_esp_network_default_level_ipsec_esp_trans_default_level_ipsec_auth_default_level_lastseconds_dp8390_get_dc_pci_acpi_comstop_bigadj_crdup_isofncmp_rtl80x9_init_card_bios_cd_roll_up_config_search_vga_test_tcp_outflags_bremfree_loadchar_fld_i__scsidebug_targets_rn_match_constty_sys_pread_scrnsv_active_in_control_via82c586_init_fd_nvtotype_findcpuspeed_ahaattach_pidhash_aicattach_bt_dev_tcp_maxidle_llinfo_arp_updatepri_bootdev_mouse_moverel_comconsioh_pciide_match_bad144intern_uvm_wait_vmcmd_map_readvn_ovbcopy_pcmcia_function_disable_st_interpret_sense_sd_interpret_sense_scsi_interpret_sense_cninit_ext2fs_flushfiles_ffs_flushfiles_dopowerhooks_iprintf_fdinit_bufpages_isapnp_submatch_ext2fs_vnodeopv_descs_vfs_opv_descs_fdfree_de_ca_ahb_send_mbox_wdclose_amap_splitref_bpfclose_kernfs_link_VOP_PATHCONF_round_reg_sys_unlink_vop_reclaim_desc_wdc_default_read_raw_multi_2_uao_detach_in_ifaddr_VOP_MKDIR_sync_fsync_de_cd_ext2fs_direnter_npx_ca_update_led__isa_bus_dmamem_mmap_rl_calchash_pciide_dma_start_pciide_lookup_product__bus_dmamem_mmap_sys_setitimer_isa_dmafinished_pmap_copy_page_vop_bwrite_desc_vop_update_desc_mntvnode_slock_fddump_ipstat_npx_cd_Xosyscall_faddp__fmul_i_uvm_vnp_uncache_randomselect_wdc_default_read_raw_multi_4_st_touch_tape_constab_dmtext_ipsec_exp_timeout_winChksum_userconf_history_msgbufp_Copybuffer_size_comconsiot_vnode_free_list_slock_fcompst_tl_shutdown_tl_phy_readreg_bpf_bufsize_disk_resetstat_ef_cd_vr_txeoc_alldevs_leavepgrp_vop_generic_bwrite_ext2fs_mountfs_exec_setup_stack_we_write_mbuf_wb_read_eeprom_tl_read_eeprom_rl_read_eeprom_nsphy_reset_ip_srcroute_fatentry_copyargs_fxp_read_eeprom_xl_read_eeprom_vr_txeof_amap_lookups_sys_sigreturn_crget_bread_ahb_ecb_phys_kv_ppbprint_pccom_xr16850_fifo_init_epic_tx_done_cluster_newbuf_xl_newbuf_fmul___apmioctl_rn_newpair_logioctl_disk_detach_sys_fhstatfs_dc_ioctl_AscFindSignature_fdintr_csd_ascii_comconscflag_wddkdriver_route_cb_AscInitFromASC_SOFTC_dc_cd_nbuf_vga_type_divide_kernel__isa_dma_free_bouncebuf_subnetsarelocal_amphy_service_nsphy_service_genericconf_vop_write_desc_reallocate_scrollbuffer_reg_store_extended_npages_tag_word_exception_epic_write_eepromreg_cyrix6x86_cpu_setup_sys_chflags_nullop_locc_isadmamatchsrandom.o_via82c586_getclink_ahb_poll_normalize_st_identify_drive_pmap_prefault_ipport_firstauto_vmcmdset_extend_fdiv___sd_shutdown_ufs_pathconf_bpf_catchpacket_pipe_ioctl_sys_gettimeofday_random_state_kcopy_esym_bioscngetc_ahaintr_pciide_chipen_aicintr_uao_swhash_elt_pool_rt_timer_queue_change_userconf_histcur_userconf_histlen_tputchar_resettodr_ne_pcmcia_ax88190_set_iobase_mul64_mii_phy_reset_cpu_reset_mbutl_pcic_deactivate_card_addr_6845_cn_devvp_ufs_strategy_arp_rtrequest_clalloc_ndqb_soo_select_tickfixinterval_tcprexmtthresh_fs_posix_sysctl_clfree_ec_ca_pci_map_mem_soclose_fifo_ioctl_xl_mediacheck_pmap_bootstrap_ufs_direnter_uvm_swap_init_wb_calchash_AscReInitLram_uvm_swap_free_arp_maxtries_kernfs_get_rrootdev_userconf_hist_int_kmemstats_ec_cd_arpt_prune_sysctl_ntptime_idle___cmpdi2_ext2fs_dirempty_iophy_ca_dc_pci_ca_lmin_vr_start_ffs_sbupdate_loif_lf_split_ahc_probe_scbs_ipport_hifirstauto_if_mark_ignore_fd_ca_iophy_cd_sis_chip_map_logwakeup_isapnp_map_readport_ep_eisa_attach_fadd___ep_isa_attach_pci_map_int_i386_set_ioperm_cdread_uipc_usrreq_VOP_IOCTL_diskerr_fd_cd_max_protohdr_rtc_update_century_pci_mode_detect_dcphy_reset_softdep_setup_inomapdep_ip_dosourceroute_kernfs_statfs_soconnect_dofilewrite_userconf_histbuf_sys_ogetfsstat_lmax_eisa_attach_hook_pcvt_to_fdivrp_isapnp_isa_attach_hook_isa_attach_hook_tl_dio_write8_pci_attach_hook_uvm_ifpromisc_lasttime_rdattach_vr_autoneg_mii_pmap_remove_all_cpu_feature_we_media_rmalloc_kern_sysctl_main_vr_probe_bioops_firstc_fdrelease_eopnotsupp_delay_sddkdriver_phys_map_ffs_valloc_pciintr_do_header_fixup_epic_init_rings_rl_encap_gdt_put_slot_pccnprobe_unp_externalize_ec_init_card_inphy_service_comread_route_output_cinit_epstatus_patches_maxfiles_wb_ioctl_kernfs_root_sbappendaddr_cfree_ahc_pci_ca_scrnsv_timeout_vsp_dvd_read_physical_cdsize_free_wdctimeout_in_ifinit_msdosfs_create_lockstatus_imen_apm_error_isapnp_alloc_region_bt_switch_st_decide_mode_if_detach_rtdelete_extent_alloc_region_switch_exit_aha_poll_apm_set_powstate_uvm_analloc_rawcbtable_userconf_hist_cmd_sys_setsid_aic_poll_dvd_read_bca_arpt_keep_msdosfs_mountfs_VOP_LEASE_dc_setcfg_fdcintr_ffs_statfs_btattach_lortrequest_comprobe1_fc_purge_epwatchdog_wdc_default_write_raw_multi_2_imin_efinit_poly_l2p1_mii_phy_detach_dead_print_fxp_power_lgdt_com_pcmcia_attach2_pcic_chip_io_map_epic_openbsd_attach_uvm_pager_put_userconf_hist_eoc_exec_map_efioctl_comcnprobe_uvm_pagelookup_unp_internalize_sys_setuid_ipforwarding_VOP_BALLOC_pcmcia_power_ufs_dirempty_dehash_fxp_ioctl_xl_ioctl_iptime_domainnamelen_fxp_mdi_read_wdc_default_write_raw_multi_4_imax_pciide_pci_intr_cnopen_fdopen_fdivri_isa_dmamem_map_sys_clock_getres_wb_shutdown_uvm_km_free_wakeup_sys_issetugid_sys_pathconf_ahc_isa_attach_wdc_isa_attach_pci_make_tag_ipsec_keep_invalid_sigprop_epic_write_phy_reg_ufs_lookup_tcp_mtudisc_increase_raw_init_tcp_quench_bawrite_enxio_aic_dataout_pio_edata_fconst_aha_start_ccbs_kvtop_fixjobc_ntohl_wb_eeprom_putbyte_tl_eeprom_putbyte_rl_eeprom_putbyte_tcp_rscale_ipq_if_down_dead_ebadf_pgrphashtbl_dc_eeprom_putbyte_comsoft_eisaprint_mmrw_userconf_show_attr_vop_link_desc_VOP_ACCESS_efget_vr_attach_sys_setegid_chgproccnt_scsibus_ca_poly_l2_cnclose_fdclose_bpf_setif_kernfs_read_rrootdev_cngetc_mda2egaorvga_we_init_card_icsphy_service_iophy_service_tcp_fasttimo_config_activate_children_pcioctl_kthread_run_deferred_queue_scsibus_cd_efintr_mii_phy_tick_intel586_cpu_setup_if_up_ahc_isa_idstring_fdivr__ffs_sysctl_cd9660_select_end_fcompp_bcmp_compare_wd_shutdown_msdosfs_pathconf_biodone_exphyattach_deget_vfs_syncwait_fdivp__dcphy_match_gdt_ext2fs_update_ip_randomid_fc_fileextends_mii_pollstat_tinfo_t_copyoutstr_pcvt_is_console_bt_poll_pccninit_amap_pp_establish_softdep_flushfiles_inetctlerrmapnegdi2.o___ucmpdi2___lshldi3_pcic_event_thread_pcic_create_event_thread_pci_subclass_memory_icmperrppslim_msdosfs_strategy___main_fdtimeout_wdwrite_bpfwrite_vop_setattr_desc_aic_reselect_apm_doidle_icmp_sysctl_tcp_sysctl_isaprint_ifmedia_list_add_version_fdalloc_cmask_config_found_sm_ffs_wildcard_rt_tables_extent_destroy_endtsleep_pcmcia_megahertz_xjem1144_func0_cfe0_pcmcia_3cxem556_func0_cfe0_fmulp__fadd_i_rl_rxeof_dirchk_route_init_sohasoutofband_cfroots_idt_color_uvm_map_deallocate_enoioctl_closef_sys_write_cpu_com_pcmcia_prod_comtty_fd_types_pcvt_timeout_pager_map_pmap_protect_ext2fs_sbupdate_lf_getblock_sys_xfspioctl_spec_badop_rt_setmetrics_dead_read_setrunnable_fdstart_aha_dev_rl_shutdown_mii_phy_auto_ufs_close_ipv4_input_lf_clearlock_sys_socketpair_aic_dev_pcibiosattach_ahc_eisa_attach_pci_decompose_tag_inphyattach_vn_syncer_add_to_worklist_vfs_opv_init_getc_fdcopy_falloc_ffs_mountfs_routesw_fifo_bmap_dk_establish_vfs_allocate_syncvnode_cluster_read_fxp_stop_ether_output_xl_stop_ep_vortex_media_bt_ca_nextraloc_bt_start_ccbs_isascan_pmap_deactivate_ext2fs_write_sys_socket___lshrdi3_gettick_bt_ccb_phys_kv_rt_timer_remove_all_cdevsw_securelevel_find_last_set_devout_device_unref_cd9660_readdir_bt_cd_ntohs_ffs_vptofh_schedcpu_fdc_ca_eisaattach_dmmin_fifo_open_fdprobe_hztodivdi3.o_st_write_filemarks_exphy_service_tcp_usrreq_kernfs_start_coredump_dc_mii_send_fdc_cd_min_ext2fs_symlink_tcpstat_icmpstat_dosdirempty_devcls