ELFa( 4rE4 (   ==((qEee`o / /;0&00Qd;0 2 @00Q8$/ // @ <  B00 RgР -L4 `ꐡeiemain() returnedh   ),@@(LQ 0/}e<i -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0P5U@ PU*00 ,*00" 4 7x0l5\ \0@D P g2p00 ! P===== -4!L01 M, P@0 00eS4 Z0p , 0 Z 1!R,00 )  ^!P,00  @0S0 0@` V 6H0 5P$ 0lP, 0 04娟==== - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `KpQP* 0 P(U:p p-QLM0@`  `KpQP* 0PXU:p p-QLM0@`  `KpQP* 0P\U:p p-QLM0@`  `FKpQP* 0 P,U:p -QLM@`0 `u:v: -QLM@w` t`v:,v: -(L  -(L  0-" _  P0L @ 00hD p-LM@ P` 0٠00PY YR` cUpp p-LMP@`V0 pd㳠p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P㊠?XP 0s UP(0Sp(00PS 0U 0 0 ]0P 0UPp -LM0pS 0S 00 87 70`%`K% [)0S ) %0K ~ 0@P&PK& [)0S ) &0K g0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 Ɵ000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000u00KI= p-LM@`hPL;p -2LM PR|2   Jh0S`2`h0 zD0SL200l0S 2 2  RB^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZj/00,0K,pK!0(@ *pK+KIV 0< ᪱P202I/202" (P2$00$0h0 ``U000P w^e=D  =j=` 8v:PRg p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@Pu`K@Ep 0-LPd@0h7 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U Ln]    (d] a]^]=j@v:\[;`v:lv: 0-L@LP 0( 0( 0h' -0LM@p Н00 ` 㿝00 PZpd3 <# R00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWn0++'0K 'K$0 Q0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 $0V D0PT -PL4p`V 4hĚ$0( 00V\S\P\$ 0  $00 $00 DPT$0 0$0m:Dn;xv:v:v:v:v: -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,-D0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 <P0 0  0 S   50S0`00`0 !P0 VE00@p x0 Pk40Sh@@j0H 00OK ၮ,^,P000/gv:= -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|PZ00 `0 0TZ2 <Z20Z1$Z2Zv:v:\[;v:w:w: p-LM@8P@`4  00 00S p  0S > S 00p000 dZ`p 0 00  (000C0 ,w:\w:w: -LM0`10#0P8pKP@0 00 0000  0 0, 0 004 PϘ`0 0@ 0 0 @08 @;0  @ፘ! " # w: -LM0p ` P_㷚0ST  0 PE0 @ @00$00$0 00/A#bJi? ㈚ i* ず 0 P(0 0S  0 Ph ,000i? ]GMb= -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph,2;000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,@gw: M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K~ 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,x@gw: p-LMP0K`Pc @7_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@㔖P(_P@dT` e(0PRg p-LM @00P w$0`0$0 @R 0$ 0 00  0 \Qph<\PRg -LM4@0S @440S -L M$X @R0  l0@ $@W hWw:w: - L  -LM @( 0S@0 @LRg -LM@ R000 ֕h 0-LP,0@T 0U @T0LRg -L MPP@`x  0T@ 0T 0T@0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@H0@0 T$P020J T0 0!0; T0; 0O $@0M T0P l R $0  @ 0O TM 0T@0O T0 7 %0R $0 p@?#όL 0 0T0G $00G T00" $0 00" T0dOM T0 T0k -L M `, 0p 0 P崠0 #̠#3B(0+)*@ $0PS 0 0 < <0 0P0SQR0 RD R9 0@ #@!@"@,0  0S  hD% p(0TP  00h #Ġ##Lh0@0 0, l0"""Ƞl  p(0 PW0 0S0000,  0"0000000000 000 0dP 0S  0 0 S00 00 00 v0 0 l = #=Y -`0 RLᲠp P8 0S ,  ) 0 0 030 0@###Ƞ+)*(0 0T00  @@9 "" ?0 0 030SL S  @ 0 0 @ @0 pS 00S@P Q@R@  0 0 030 0# ##Ƞ+)*(0 0T0 000 S000 0 00 03y: -LMP0 R @p  S0  S0PQ0R00S0Pʼ0^0^(`0 R ( 0 0  0`R Z V0 `H P 0 R00 A 030?0`200>0 0?<0040 000`000X 0 T P 0 T 0 T 0R 0( `0 `s0S0 0 0 4R 0( 0 ]z:`8Tz:z:z:8{: -L M0 p@ 0R , 00 QP X 0Uʸ00CXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,0S, P@0U20 0>0ʠ0 010 0 !  0?@?<0 0@0 0X0ʸ0U0U 0?0 \A 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0ʠ0 010 0 !  0?<0000 000A80@- PP @ @ P  0 0,,,,S QRP0-  00   00 ! @0T10  @1 @0Th@1 @0T X@1 @0T X?#/Z?B!P`10d!h1VO VO R0000 0 uXP@$0SPX11@TPU0)(0S0>, \p0 0:(8IY 0P80 $ MZ? 00|P@0!Y>!0@\T0  @h @T0|P".@40|!.@0|ug8=`8h8\|: -LDM0P $@T P 4/000K0S@ 0 ,8TpQ# 0,0P*:P$:QW 4 , (0 L0 H 1D 000 X R X RJ0B ( 0H$Ƞ 8 $8`< /8 !;0 0# W 0 $@0 \04 $0P` P < l L88 "50 0@ W: 0P0 0 04 , 04 X X0S T ! L001PQ , 0S T0S0p0, \DH  0p0, \L L8 W 0 # !" L8 7 P Y X R 0, ,00C, \X\ 8l;<d˟W@ 0H  WL00 ,@@ W   0SS:@^ c:^E ^ :^ @ 3L4Q0,0W0 $P5 #P# 40S ^0` L00 @0S0P@Q0R0F0?, \ K0 @K H@I J .0=0 S@ѵ@`ѵ`ѥT_ V00TP , 000D ,000 b0?Rf0?JV00T  R(TV 0DS4 R ]TKxKop ,@0 (00 @0?,00 D4Q ]}KyK4\ 5 000$80s 0S00 0 tYK4 ;0p0H7@Q <7Q45 000$080p0#S- @T' T T 00 0@P@ P eV|I _P P Tv<8Q$JP@ P4  R00C##̠#,IJH0K 0=nJ5@ Rr W5RR 5Rx4 000$0@@5 D@ $0 6 H $D@10L S,0 & ,H 10S00  L00P 0pF?, \LD H0xJD H0`JX JHD4@\ 84\@0, ,0c lJ4^0,07eJ 5 000$8@ QJ4@ 0 ,0@, ,0c8 `<0:JW 0 040 , [Y W 4 +\$J#000 04 T@0?, \~"000  0=><IW 40 [ gIP ~0 $`{s I5 0@+& I0, ,0@ @c, DIW 04! "$# (,IoIIIIL=|:|:|:6;|:}:}:}:}:}:~:8~:d~:\=~:T=~:~:~::<:d=`:::::$:8:X=X::::`=P=: :4:D:T:l:::::Ё::0, ,0@ @c, X?Iw0; $000; T"H ,p 4p D L 0p c0"$"bq N T0T( I 0T -L M p01 h!.X@T T T 0,0 `V    (0S    $0 ( $ `V& V 000     0ppoX(0S $ $0 (P,@ 0X0[YZ,`  0 " 0$ @ $ 4  P(0SH1R/S0H1ppHq  $0 @( bH0,0 0S0 0rWH,@m 00S0hTg (Tbt000 0 0x00R00 ppT0HH0F:0:h= -LM`0p @P h@T0A`(@0S F/? HL: -LM4 G440$0KS80 00 , < <0Su8<00Q8 <0 4HQU @T00 4 0L1 0 00 PP0 YPGTP40PQU @T0040T10  00 PP0 YGTP0PU+ $0  0$0@, 0X0 Y xG 0p0CS00 00 , ~G R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0 SY MG@Y<0 0S40$[ 00<48000<0 4$JTꔂ::؂:: :@: -LM 0`0p0 岠ᤅ, @QU hR0000 0 4 40@ ,X 0A0S P 4 0 0 0, `$ ,D 0"""Ƞ[YZX 0 ! Ÿ @  $0 P p(0S    $0  (0800000 PP00S000@,@T 04 0 R T ,G0 0 ,0S 00`S SQ0Q0 4 0   00S  @DTRF,屄 00IF< 3P <4000 8<0P8T 0@@T 0Z "! t  h::\|:: -L M d4q (t P, 0 0HQp41pU  0 !01 R PY0 R0PQ00  , R : 0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ )P@ p'W(W V000S 00  0 "00 `0 SP QR 0 S, 0 S0Z 000SJ R0T1C 000 1QQ@4 !010 ###Ƞ0`J/) 0S ( W{ 4qpm@000/  Qh+F/ R0L1 (Pp P C==: p-LM@`h+0 /W0< (E㮃P$00$0ph|: -L|M<  PD   DP <00PH0 4`K80K 0`P PH0,P< r<D @ 0 0 8 :4P_<D @00P 0 PJ<D @: !P<0 H@ @D<@L 0 0  L0@  P<@@ Q< @ - D0 <0 0D 000 @ 0@ @D 00xD0 0, 0D0 ,0\ x0 !T0 Ƞ?0 T0@0EPFXG` M d0 Q R S N0PP09 T0: ; A B C 8<D\LhOl e p0f0tg|] ^ 0`_0abcdXYZ[x \ @ `Ÿ11 RP8 $ #4"( 3#8( 0<0!S !<!0>11 /!0!\ \D0 @@0 0D0  D@ 0 0@ 0 0@-<0 Q 0 7<DN/0@0<  C<D 0$<0D <8 00D D<0 d~C<0 TxC< DsC< 4nC :T:8=== =::::L: p-LM`1d! 0SPO*XaVV R0000 0 p 3P`! 409`10  P0` 0/!`1 0 `10`1rp`! 0!0@0|80`!@0 !?\p<8= -0L`pKP@4@ZP@' PUU1 h1P0h1@1 R 0S @0  R0Z 6PU0m< 4 980 4! 0qA : 0- 80,#@L(P 80,#(0h -LMP0p @Rh8`` 0Sa:h!40b0C02#1 d1d1$0CRR*D!`0!`!A'` A`10C0  `10`1 0  d!0$ B9d!d10 #Pd1 ! d100P0 m$0!00|l8 -LM0PpUA00 `0V Sd 4zR80V`08 @08  800}h1`0Ch1 -0LxAt0tAl0lAd0dA\0\AT0TAL0LAD0DhAL=:P=:`=Ѕ:T=:X=:\=$:d=<:h=X: -L,M䗟䧟P }?89 p, 7 4K04KHKP`0 A,0 S |,)O DK HAX 470P5$  00( 7 d0 -q  q  /6&`%=&`006 &006 , &6`&`d006 &006/`P@K0 5K$KP`6\6$[  P6QW BQ/ +>4K5 05KP4[S09009  ,<&s $T l5%#K #K<KP5  [5\# P6K 00 Q0N@P%P5$  0)  0$ 0) 4 4 w4 N4 6 ~ r(R @09$0090|B3t$e 0  00 0)   0  0  0 0) 0 0) 0  0 0)  l0  0T 0) 0< 0) 0  0 0) v 0 p 0 0) 0z 0) 0s  0bn 0) M 0b G 0D\ 0) 0,U 0)  0N / 0"H 0)& 0A 0)10 1@ \`00)09Ŵ1\09009Ť1Q101 P00)09t1 P09009T1 <10)H1@ Q@1}>8910) 2R $1R0) 0) < 090090 Q09 ;gh <:`:l:x:|U;t:+ D > F H B J N R V T Z L TX h \[; -=` X_e< Na'(j) -0)8 L#8 $ɐ R2 d X\ -0)8 L#8 $ɐ R4 h X\ -LM09`0 5Rɖ R2 d 0X IR4 h 2Xxrɐ R2 d 0X 9R0 ` (ɖ 0R4 h  X2Xo_  9R" D ( ɖR@4 h 0XH(9$HT@ 0  `1ɖ R4 h :X41ɖ R2 d $1X1S0ɖ R4 h 0X"0ɖ R4 h 0X ɖR4 h 0X  ɖR4 h 0X\p -40Lɐ 0R ( \ -LLMT 0 `@6 0pR,6 R |@6PP  !1 01$0  1 |U |@6$|$ R 1 0 +10 ,(0 0S /S ><@0 Sx$0 P@ @<P84 R,4Q l  SD0 0 l0KP6[5[ 0p0 O|@6PP 3 !!$ !01 |U| 4|@,6$|$ R 1 0+10 ,( 0m@  DP 8 4>  D0m gnt2=$[Q>K  8K  *K  0 0D Pl00l0 # R간[>0S6[¸ D lK_0 <0 < P k8 \<<00 0lK Nh < H ggpg:Ĉ:> ::\::05;505t0p000t0p0 p-0LM`a <0@t"5K p:{L0,0P@@{T  ph<=h Љ: -LMA0P 00K  00"[80 41R; R 3[pCX#smW$`0ɕ   20K!0ɕ R8 p (K#[0 R3K#[101pW0,0 80xL@H0[W= 0   h \, -8IL@DtpP ɗ (0  @D|tTeaɗ 8R  #8X IR8  #8X 0YR8  #8Xɗ 8#8 XA ɗR0 ` (0P@D||tT8< 0; 9R  (ɗ 0R4 h  X0X  8 ;\: : p-0L M PR`0 PEu @0@0 0S PE)|uU09009d`01K02K01K80 K p,i;p09PTh H: 0-0L PR 9$)$@ ɕ<<$)0T{ ɕ@$)0T0h{0T -2L M @RP 2R 2R 200!P 80Plr9 R8 p (0 hVu 9R8 p (0 Pe`\0  R L8 p v%0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0AS  $ $   $ $ $ $ $ $ ,  0P 0S0S` (PK?2K02K]< <0(PK UT h \*D> < #(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ɖ R8 p 0X IR08 p X0\  R L8 p $P2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK& U?G  K5K80 Pp@W 0"K0C "K SȢ ܢ  0[,PK2KX0000000S>L0,PK0K2KT \h !(T > #< 6S-L@p6 8S `,Pɔ0S8 #8X0ɔS8  #8X|Pt0ɔ R (0  PEyuU< O9 `\\: p-LM@80PP`0 (  R8 p #p\ -LMPp60 P a 0?  R6 l # ɕR6 l 0X IR6 l 0X 60mP@ 9R6 l (P0 S 9R6 l ( 0 S\4xV -|1LMp00  @PHQJDaɔ R0 ` (0PEWyuU4 9R" D (  ɔR4 h 0X 60Po?PPl0ɔ R6 l 0XP?U< u8 h \x: -LdM⌐Kd [ 108K0p8K05 -BTP @ 00`W | 0S P Tp`@00X 8K0 5<5 d% 0 h p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@q @@0 O  K 1R 1R 1R111R 1R -11q /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u 7p 0r D 0v 0 H L B F R N -%*T C> J V Z :D  -LLM]p@\ u` 09h l  0` \0HP`ux=T (l=Td=T*\=T IP=T H=T h\ lQ `kuP \ hP\1S p hh h ?0\ hP5 (=  0<T> (<T 2 = S! =@S <  8C84949  d< R ; 2KK"Kp<0K 49 < R `;2K03KK@ K 505\ 0S ;  x;  \O^oh#Pi \ r \4P^5@Y \(d:T )X:T P:T;hPB  :h =\0*hP' hA "\ 9. @RA\0S\$9T2 $9TP: R,\09!  d)000?K2K 9"K 0K$9TP \" hP@ | th \0d)hPh \ 8P* Y8PP  P  P I 0hP hP5 0 h0 &w7P7 Q7 P! 7R 7R 7R 7R 7R\09 } 09 y 09u 09@q 09m h7f7P 7P 66P h7Pp7 RR\7 R T7  h!87 @&0<hPB6 R> 52: 6 R8  .h 1h6)00 0 6  hP5K`@U` 0%0 ?A1c バბ 0 2c0x%`%08% @5Te85T]*05TV $$5T 5T \ h \Th h4,0@5  hP\0h 7 4T& 4Th h \$hP5@ 4 R hQ P\ hd$k. \08 \ \ %3T 3Te *3Tr3 R{\09 u mh ph <03 hPTh2 R \ 101K2TG5 2 R( E h Hh2,02  hP,h0 S( !-!l 0hl  \ l! \q ! *hP !\0l l! Pl  Q10Slq@% q]P  @X`K@&@@d1@5KEK A%K RKQ  5 0 lq@  Pl0  0T C0T&gi2i 1i iii i i i i i i i i8-%C= gfffȊ:i i iiiB5i i i i i i NAi86i(i|> 8171< ,Th D0Tq`1Pwh0 R  Tk\h n0h,0|0  R 0  hPNh0SK >\0 d  h00iZ@\0|S<:Vp h  pPf @|?0 p0  p0@R0S@00  %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p 5Px00x0\d | RP\ 000hd0 |0 iZd0  |0R*V o |`Bh0 W  50h20k \h ,4h \0D#hPh0 Sh3 RM  R 3R 3  hh 3 ᳠ᴠh s $T h0+4R%  4R 4P hDzr hD d4Rd4 R|Dh W 0h04h 峠0㴠0h0$0h0S00h Eh Hh5,05  hPh0\0) 'p 0-M0LM PcR  0 R 09AKA A 8 0  00 2|0|@x0 Kp ̠0KPT0K  R<0< Ca0TЊ:h =gfff -LQM09 `! 0jpd 5@87য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK `7 0%K5K?5KTK 474'5K K%K\K  7 '6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK09 @texvPK@&@b@qmT6@`@K KK;KK 0@T 5 R- 0S R' UAoK@@@&@9@K  .@`k 04@K3K0O Z0K V 4K84 R 5 pp4( K-K00QK3 09Fe%=PCP 0nK0  P+`!0()  P09`! ,)/d o5 @05%p3+%<aY<000((3( K$S0BSKR/K00"2(K UK >K 0 2"r#00  2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01( KOKN/K00 0JPK&@@,1@K@ =KMKKu 0`10K8KKK 0010!8K 0(K8K 0K09|10/K7K'K 0|K09lB h > J D H F N R NoL -: =:: TT *X!Z -V  -LGMA0Sp!, 000Y 1 Rx10 S<0K 8K 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9 0K 5Kg >N0 B@f^$[H4[Q04KD 0  0000 <  N@ B0D^ DPp 0 P0 0C0 0 c0 R 0 R 5[ :h ̋:: -LHM`09@hKp PD, sZK ,I0ED 3K  %K#[ 0"K 0E00< 0PH 0S( O-h : p-LM@0P09 `<p%%=000` 5e=5h 0-@LP,- 0 t00t004:h -LM8@@ 09 $00 Rh` -= -L\M4@KP 03K2K [ R 0 S  R R2  2  | pb0S  \23K@2K 2[[3K2[K3K 2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@o,["[2[g, ! 1QQd@K&R0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0h p8TH: XQh\:|U;d::v'N$ -LM9`P(0Bp S? L T d \ d d d d d l 0H S$ < $ < D  000NP@(P Tl0l 㳀pT0 R   > H J p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S \ h h h h 0 8 0 \ 0 dp0 ^0 V0 t0 h0 \0  R  R40  R09 0 0 > J H Th 0-MLM@P800000|1 R9  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽  000000000H > h D -ML M09BKI0 I| 000CSur  D '0T p0S^XPpڴ8! #  1  P`C |P`=04H8( K81BNK0!@@D(0K 1  P`# \P`8 0(K 0$!  0  P`   CP` 8L0  @ T .P`@ h p-LM09r̀@ ( 0 P `  000 0S`V@PpR 0 SqP pppg -<0(,0L0 N R h 0 0  N R p-QLMPC  R09`:09 09-:09`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $)09 `ph 8Ќ: 0-LM09@+P"0 00> Ph0ɔ R  ( P 0,0B=C109 0000-0h \ R-L  0 0C SE X X X X X X X  X 0 < X X X ` 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40B D F H J L N P R T V X Z \ 0-LM0@PShD D 8 t d l D h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @PB h D F H J L N P R T V X Z \ p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S <0g: 0-8uMLP @t0 R 0s? X0  @0p  R0Z0x0 20h  '> ` : -8Nn(P኏L@`p"`0  #   밠 %/' : -8Nn(P኏L@`p"`0     밠 '(: -LM8up {s/000e, T `V( O 8c@0S91!@Pe@dDFA 02 S&h1b1 R0``00`eY `009,oe@ R }2g@TZ @ @dPeDFA@04 Sʄ1d|A R@0 @000@0 @be@,&  &~ꤖgggA=D:d: -LMu]me P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  oek 00 1+ 8`  1R010000 0 !0*0!00 0@@" ? `|& 8` 101! R00:` ]&=:: p-LM0@u]d PR0000 0` !*!0S00@@@P2 phd0 Ca =gfff -LMC0ID`u}@D  pD20u? @$ R00000   R 0 0 0 @0S(("@Pd@dDFA@04 S1d1 R0``00`Fd10C1jꔀ匠@@dP^dDFA@04 Sʄ1dXA R@0 @000@0 @ d@Dꨖggg -LMp0! 1?2c!c2c(dp@umP0 `P0L cUF D @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101  L H0–  D 4P~H g< =-0  t0 a1a2cP  0Q P 0S!0S~H -SLMu]` 0 P ʴ8%0N0  0A 0  pK0K@K @y0 SK 0K@oPZ Pp 3•  P P; (3 p,^P3   O   . 0Z $ Ӳpڨ K0 KS&  $$(2 R RF R (pZ (p@\ 0  @K!1@RTں1H"01@<2P @dbDFA@04 Sʄ1dA R@0 @000@0 @b0@0(p}@@0S @o@00K@Tڴ( T,$(b@AP0S@000 b@0S  @0 R~Q1ᴠ01(s? ( p9!0R ʴ8 b @?pRbW(p$X# b 08#:=:8:T gggh: g:: -LDM`uMS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0>P\K`K  80K3Pp 8\0[ R 82 ,0S , q͆ 0\[ #q P:PP 1 8K cPrh  p0S#< 8 /N@O1Ά _`    `0h `K `0`0 p` 0`0 1岐`00`0 p& h-#8 <'#01 R' h0 h  0S !ᴓ 8 0 12 8p#!8 8 h 8pp"8gX"IRO0 B`0 d )gNԎ:::X H:=p::̏::$: 0-S@Pu L 0P 8 8"0H: 0-S@Pu L 0lP 1 08 "0p: -8L`@P80  @ 0o0@ @ ,0,PpW6 0p0p  0 Pp)6<&2 PpPO&< B@hh5  PPp@?U< >@0 00@ @ ,,Pp< )4  4Pp$ A< <p0p  0 Pp<)\4 PLpP@<@  0P Pp@M?U xP`{3PP5#3 0#3 0/0S3 0@0 1  D3#\23@`"d2p#p3DR 0̠:LBT  4p" 0"]P1PQ=?U<0$<0<0X"8<0) 0@?P@QPUZ<0$<0&<0"8<0& 0<0<0      p ` P @!4.0[SR-0[SO,0[SL+0[SIpW  1+0[ 0+0K<804 ,@ 804,00)?h8|P:`:*4!.!6!L0!L(!!L!H!P4!\4!t:::Г:: :L:p:::::SgSg -LMR, 0 $0P0t 0"00  , 2!8 <   P4 ><(0SR(0S,0bpA(0@S4T*8W4 , ,00@040?QA 0@<(0SA@<(0S40 0 0(0 0 0(50PI 0 0 0( 0 0 0(< $0 4 (<X0@fP0  0!0 $!PPP PZX0 R |X@I00$MX0$ R 1 0+10 ,P(P<8010PPH7(:ggpg 0-LM&P",@0?  RB0Z<(0S6F6FF0 $0  ( 0-LP+ @ 7P@ ?T099 90 -LMPP<B(0iS(0`SV<$)(0ASw $2 0)R1y01 )p y ?#=?0c? R`  Zl00l0 P /H  7S P l00l0 P H ))9S0J0 0 ? B5c5c0JS 0\1 0 Q,1 A0 1 )py 0J ))0h00h0   00 02:S 9S <P 4  00 0 ) 000C 0G $0 ( (p H$ T,00S 00S    ``/```V 1S(84> 0X{@ -L$M6, S`0 D ,  0 D D 0 <0 2?H0 , 3 P@,( 04 *S@ D00@ 40 640CQ@î<(0S視X 8 < 0 @1X8@4L 0\? R88X ;T ;44\? R$ (IT 5804R $80 040R T% @ %5;5SX0HI %84 00X840@ w{=?5 0-@LP5X20T" 0 -LMP@`SPp 0HP S1TM1T7*1T# 1T %!8 @ 2A8#  @ 8C82% @ _505%@ 0 R< R4P5@ Kt0T h0T-Pڜ0P\0S\80T/0Z2i 1i i i 5i i 6i( p-LMP@:S`0t00t0OphSꘕ: p-LM`@PU HY5=595847 0T8@4< 0X84> 0X P$@?P2SPU@Z@?P7SPU@Zp<0$FC07<0$!p>!@!>!>!>!>!>!>!>!>!>!@! 0T 0T 0T 0T 0T0& 0 KSӇR^ 0 Td>S $ 0Td1S $0S7  $  $0  0 00 T 00 T $0 0 9S0p00 p00p080 T $8 80 T  @0{:P8=|K!G!0=/=+== -0LM A8P4pp0`  0  h0 "Pp0   0000TD0<p0 0p0 HP,=0== -04Pp@0`0L0 8@T0 T0  0 0; 0 Td[R $dTR 0TP P 0P 0 TT 0T 0T 0TT -0L040 0 T -(0L180h2=0= -(0L180h2 =0=0 18=00 S00 -L MŸa8@4h, Ÿ删ŒpPP0 ~/PH2W .<2W& 02W 0 00, 0 ,T1W 1W0 @00, 0 0 @00 01WI 91W |1W@P 0@ @@@@@@0 @@9@S@@ @ LD,  ,0 @$@@0W 0W000W0 0Q0 0 000000=0=]t@yt xt zt {t ktjt@\tltmt -L M#l00Q(@%0 P4, $0S S 0, R@pp  Rp  Rp   p0p00 pSp 0S $0R 0 0R0 p0 H`|2|"{8|0P0C@|0p00, T0 0, T0 B40, T,0 T0,000 T0 0SH $0KS,0Ӂ0 T0004 0) 00$0(  0 9S0 &6R h0(!"P C0 ,000 T00, T 00, T$0KS!0ӡ0, T,0 , 00,000 TB=ܕ:0= -LDMP1l  , A4`pNp  |0Sڗ0 M ,0S L,000 T0 0 >HQ3Q #p 0p00 0 H0S H800 lK H  9@TP0 @TT000 T0Hp0Hg=: -LM@Mp0  0p0cM p-L M@M0pPt`x0p0t0SM880V @U 0@@ pd;|U;: -PLM@D 0R@ 8pYMP堀`U UJ +<W0  p0 oM0 0& MU*嬠`0 x p0 0RTp0x 00 h `P"U:@0aI0400 T=0== -L M`84@P㈠ $8 ,    $W  $P\  p %0  ,p7P+0  , 0  , p0 0p0| R,0H, h0"2  $ h0!20, h0!,2P0 000 Tlp PL0 0SA 0_L  $ 0@.0U:x t0 0Rt0x  $P|0Ta0U, 0 0 000 TD0 R 000 0pp0 TL0==.= -LP `1Lp $  $ @$K@ -LMP`pL}N $0 @T N0 T00 0 }N $0 @T NiK -LMP `p@K 0T@0DD @T0 T 0T 0T 0T0 T $ixK p-L M0 K `0  PP p@ T \0\@PU HPH0 0Q S00 4 00Sgd|e4SgieD;! p-LMt`t0lP P0P@HH D0 0S0b$0@ps 0Sg Sg$Sg,Sg =8Sg: -LM℠Pp@0 `V 0 =8808 40P( (0p$Sg=ug0Sg Sg,Sg= 0 0Sg$Sg0 0 0Sg$Sg 0-@L J04 00P0 T0hJ -@㈠4p@  0LTh5 QE  $  0P T  0T0  T 0TdL R R  0 T R RdY!Z!Z!Z![!,[!4[!P[!p[!l 0 S0 00 0 T  $0@  T@0  T0@ 0Tß#00 S Q0Q3 r  T <| t 8Pl 8S080mE0$04 40 Q00 000Q 00 0@ 00 ~  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0@0  T  $0 0R%0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 |K0 @0 0 \ T  Sg :d|eD;!ieug:M!C!$N!,:@:T:p:::Ė::(Sg':: -LM0`4P@ 0T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 ,@T 2Kd/Kp}N $0 @T !K0S\ v pT  $0PPpT W<: -0`LM908P  @ 9 ,OT .< 2땎0T)  / 0 P0p']P P  PN@ P !P i070260 '7 b ]P)NPN>U0@1!51 0!1 0 ( `B{1T71!11!!1| X0@0`:8;T1TL1LH1:@@!0=P< (P@        M JGD        hq!q!d:X `:D=D=x!؝!!d!p!!q!`r!d)p! 8 -=!`!::::,:P:t: 0-PL @0@<@ P<;hS ' 0*-= -0MLP 0(0$000,0 ɐ bp0 0 0 P@[ɗ,0K00 *,P@\Jɗ00,  04P@$;ɗ 0 P@. @0 0a,   P$  1 T`0ɗ0 0 0 P@ ` X<^ @ꔘ::ܘ::$:D: -LM0 R0 , '4 40q00` 000 0R4 B 4 ,0 Y(0S$$Z700 R,0ɓ(0S0,0 0(0$000 $0 ($0 (, Y -LM0pS Y(0SI$ ə " 89 0@T3 0Z o`0S Y (0S$60Q 00Z@@9$0 (Y $0 (Y -0L4M0  $0 0(0ɐ0P B0P  0 Ppə,0K`00`P P *,Pp|ə00P,  04PpDə 0! Pp 0A,   P  04p WHp D*H0D 1ə`@0 0@` @0 <  pPH<8 E@4P $ !101 p0p$00 010p pE0Sg EP@$E $0S 0 1 01;00 (p,p0<0 8  1@ ə@D0 p0;Pp)<8pppD04@ 4 ,00#,P## 0H  H və(0S $0 (\ D@ p0,ꔘ::ܘ::D:ggpgh:::$: p-LM0PU@` 2 0P 1 Uɖ(0S0(0$0 0p $0 ( -LM0pS Y(0SG$ ə " 89 0@T1 0Z o`0S Y (0S$K5 Q0Z@@9$0 (Y $0 (Y -LM )P@+ -LM@ 4P 5A0AS  0-0@LD 7PS 0huDs & p-LMP0@D7`S@ \D(0ph<Xq!= -LM@ W0CQ  T 00HSAQ B00HSʠ -LMp`N @Ⓨ,  WZ r!s!Ls!Ls!`s!U  , ɗ8 0\ H <7l @181aR<7l <7l~ '0w@ 0 0 X000ɘ(0ST*4 ?=0 cRT*V0!1S 5  ,2 ,0S 0,iT*0 ,"0 00(9D ,9@@ ,PP 0%%l%H8Q"""̠   0 @`?0 @7!400@KK,40> 0$Q 08; \K 1 0 cɕ)` 0\1 ,0S , $0  (ɕ(0S )0 "0 00(0p 0@7!$ @7KK ,4 0\0 $ 8; K 1 U0@|2|"5x2 0p"p2 0 ( `=D2T7<2<"182!,"1( X0ۭ@0|;;1/͠10@;!0~P P     @$POzP=@U0@dPOnP=U0@ڕPKNbP=U0@q FPUJ02N>PU0@DZ   !l!d:\ ț:D=D=!!`!!!!\!!d)$!| > -= ""::D=:::,: p-LM` X0@TŲ PQNPPU0@Z*p G-= -0MLP 0,0(0$0 ɐp!ba0 0 P@\ɘ,0K00 *,P@`Kɘ00 ,  04P@(<ɘ 0 P@/ _0 ,a ޳P%  PT`ɘ0 0  0 P@ `Z<^ @ꔘ::ܘ::$:D: -LM0Y, ( 0 4 p00 `0S40@8040  ,0 Y(0S&00$z"00 000 0Y,0ɓ(0S0$0 0,0(0 $0 (00$0 (,0Y -LM0pS Y(0SI$ ə!b! 89 0@T3 0Z oʳ`0S Y (0S$"0Q 00Z@@9$0 (Y $0 (Y -0L,M0  $0 0ɐ0PC0P  0 P`ɚ,0Kp00pP P *,P`xɚ00P,  04P`@ɚ 0! P`  00, A  ៲P  4` 4`0 V4:D0 p0ɚ0@ p0  <  `P4<8  1@(P  !101 `0`$00 010` `00Sd 0P@$0 $0S 0 1 01;00 (`,`0<0 8  1= ɚ@D0 `0;P`&<8```D04@ 4 ,00#,P## 0xɚ(0S $0 (\ <@ `0,ꔘ::ܘ::D:ggpgh:::$: -LM0@Q 0#0Qɐ(0S0 0$0 $0 ( -LM0S Y(0SE$ ə# 89 0@T0 0Zo-q`0S Y (0S$u Q0Z@@9$0 (Y $0 (Y -LM TP@V -LM@74P 5A0AS  0-0@L/ 7PS 0h/ Q p-LM@0P/7`S`   ;0 ; /00ph<!= -LM@ W0CQ  T 00HSAQ B00HSʠ -LM`N @~p WZ 8!!!!!U   94!,ɖ04!\<7l 00as<7ls <7ln '@L 4! <1 0PT H0!0@41Dq '020?0P1 P7^SP  7 TT 6 P^ ^7SP TST T 4!Pl0  0 0X1 &fPP @ (;@T@H\$H X  &0 008#HH cP`x <I$P0lq 0@ @PD   \@0>ş,0 S ,}D`'4!000'4D1 X@0T,00P (  80@ ɚ(0S<$0 0/- 0b $0LL  -LM0 5T9@SC\0Tɂ5 hNt00t04: -LMP@`%|1T0p! Gd1T2 \1T  up4W %5A0AS p505 0S 5 @ @ #  E4Pp7S5A0AS@L00S@0T  ᬱ4Pp Di i i ϖ1i -L@`pPɔd ,0 Pg'cUdU ɔ048 \ h0: p-LM@`Pɔ ,0 P@'cUdU ɔ49p \P9T ,0P ''cU(pp xp0: -LPp`@ɕt ,0S@'cTdT $ɕ&014 \1z hK0(: -9YLH!,`p ,$HGHT0!, ɖ\I0 \ -L@nM`j9P-,ɔp8`-\P . M*ɔ0-\ 0-9PLL ,0@<l0ɕ  0\0P0 -LM9@8 ,(7ɔ0 \P0 -sLQ@ 0 Q0 >ɐ 0 \ɐT0 -LM0HP,@p ,`P XP(8`` ;SR ;S 0 P`1  ` h  ;S  ;S K V X # a b9-,0(ɔ((0-\0   (+4 -LMp0<2P00P  R22P@ R`  0@ Sa1 0\E,0BBPCJR0CTX9 Q  V@AX   XLa {0 %u% o k   e0 %_u% Y U  P0 %J l 0SS Y  ^0 oH%] 88 ^ \ p-LM 0@i4P8 <0 \ 0ɕ48 \p00 p-LM 0@i4P8 <0 \ 0ɕ48 \p0 0 0-9PL-,0@5 ɕ0-\07 SP90P9 0-L(7ɐ@0 P P,ɔ00 \0$0@P(!8!@!H! ሜ:t:::: -L`20@ ~/1! z1 /r1 ɠ -    +ˆ _ : 0 ;MU 0S<C<;NK 0S<C<;;S;/0C;;pS;P0C;5 ,R0   0S0@#%P0 , U @ڭNP @pPP < 0U@\ ] ^ -L`@ 00R00Sd@ $cTdTxP@p  @TP^ P@Q@TPZ t H8: -LM`P9@0)R,0P9 OP9L)4RD ʤ4RD4K8 K_P 48 P4墣P90P9ɖ9H$\Ip9 +\ɖ9$\I:#\ɖ`:#\I:#\ɖ#3\I#3\ɖ#3\I|#0\ɖd#0\ITSL#0\p@ɖ!0@\TP@~O0 'ɖ"0\I"0\@ɖ",0@.#TTj Pa@7<'l0X9TX89-,7("(S( S5'& &ɖ0-\I0-000KLɖ!0\I|!0\ɖd!d1\I 0\ɖ!0\5;5%@ %7 S <4埢 0R@PP9 x:̜:44 44P44 4 T4@,4448X4000h4l4;؜:: :: -`PTY50@=L5U pɖ8\!\9-,I08-\ɖ!0\I0 \ɖ 0\I 0\ɖ 0\I 0\PNPU0@Z*W )R P9P90P9040l4h4 -LM9Ip`0 \ɘ!,0\I 0\ɘ 0\I 0\Y0)`tɘ 0\I 0\@ɘ ,0d@!}T}T  !,: p-LMX)P0, `(` ;SR ;S `9 $K,Jt   I 0 dA@QT P 0Q01@l`0S  @pcP0DV0!@Bt0:t0#t`@04 -LPM0<` Pp> l0 \PK  @ : @@Yɖ0 +00tI0 typ0 R W0&S1#6007S,x7,T: 0-0P'LR@p0p  ɐ\9P ,<7'42ɔR 887 \0h0d0X9  ;Q QJ@QZ@@@;Q QV@Qd@ -`L@Vp0P Vh|6P9 )0RP9 5  9S5@ /0 p-LMhR@`lp2 ` h”l 0Xd|MhRlp2 ` h” l0Xp -LMhBp`lp2 ` h—l 0X_ 0@03 < LL0\ 0004 @0=0 勴hR `lp2 ` h—l 0XhRlp2 ` h—l 0Xop,P= ""-= Q- L Q  =S p-LM@ `P PQ ^P 0:#:S0 000S00c8 @T20T2C8 T20CT2o,"<0S<<   <0CS,<00-,000 p-LM0P` L0S @0S0 0 6<SLp00.-,000 p-LM0P` L0S @0S0 0  <SLp00@-,00@0@ p-LMP`0 L0S @0S0 0 <SLp00$0 R0 R  = -LMhPplp2 p h2l ( H?` L10S<````.'  A0S 00VhB lp2  h•8l #8XX20X2>x`h`XhBlp2 p h•l0 X ::Н:: 0-T20QLPT2 @T0 0ST20CT2000y -LM@0SS#  R 0 R  0!  0:0::Q:\PQhA-`4PU%@P 0 0;#;-R@ Pv@ Q0 00AqAP09040Q@Dp 0 \+0"+^ @L00eL00@p@-P @P0` R p@w 000 0p@: " 0-L@Pb0hS -LM`0Vp0PHhB p2l  h•l (0?`VZ P 0S P 0Sh_0S  0-LMhR@ lp2  h”l (0?00h~ p-LMhBP lp2  h•l 0X`hB p2l  h•l (0 `HcVphocVp: -LMPph• lp2  h2l (pWp hWhB` hlp2 `&h h•0l X`hB p2l  h•l (08:0#0W` G V|W    r4:<:D: p-L Ml@V PK 0EP ,0"  000,^ `0< Lpp<0 p-L Ml@V PK 0\EP ,0"  000,^ `0< pp<0 p-QLM`P @Tp -L$M@, 0 40 t`@ D q 0@] H  0>PZ0 4PP%0%40 `1`R< J< `Z8 2,Q8 @T007 0<0 V0 8 " D0B B * ':@474$ \9i000 `V P%,000 0gZ 0P HP  ,  lT:040 -LM@?P 0h -LM@!0P`h0SX0 Dp0H 3L0<(K,@K @AP , 040(,0P 0 (0  Wl<S0,x00> 0⼌0 R 0 R @@ p0 RP@ᕾ 8\40 ,0 ,!X  =<"=Mb -LM@0p`1h R980 TQ0 R4pPP_ R 050 R0F0 P <;d 00P>mpPP0 gt: : -LM0@D4 0  -LM@>P 0h 0-0L L0@P R P(0 R0 = -LM@>P 0h -LMP !0`hp0S?0< (@K03H0 $K @=P@ ( 040[(0$ ` 0 D0T L0 $0  D0P$ <@0S,00> 0| 0@  $0S0$0 -LM0D`pP@T@*ETLgiL0@TL0@T -L 0⼬0 R 0 R 00[P@ 娼0 0 ,!᤼H<Y040<,K<L T00@K @4P00, p00 yi=<"=Mb 0-LPp=@T0T0^ -LM0` DP@1ZL0SE @t. < 00@0@, 4pPZ @4 0 00oG00 0 P CP0@T4@6 ^:^ h• lp2  h2l ( @Y : -L`0pt0  hPR40  RD0 BA @`@<.S0<x \  p-LM0@DP `0R0R00S4 S00 1* **P\^4<ph^ -LM0DPp@0!@0T50Cp@ m0P` 0S S 0SP 0 0 @T+giR i"Ԟ: -LM0 @p g`堕SU  44pp7DpD@PP! p0PUPp ͆0 0PU0 00 PUJ0PUZgih0S0S 040P00 00 -LM`pDPPhh@ L0P  0(Q 0S  R00 H0 <$K(@K @( 0P40$ (0 0 L0 $0P  $ 00 p-LMh@ PRh` 0S  000 0S DJX0Sp0 ph4  QL 00S9"9"9"9"4100BPD PP  PT H0 ?P0DTP"T0DIPDD0000h0p000PD, P0r00 0hJQ,0 Q$0000====l== p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -QLMP Qh•@lp2 @ h2l (h• nlp2 @ ` ih•i< lXAh•lp2 @ h2l (h• nlp2 @ ` ih•1i0l Xdh•lp2 @ h2l (h• nlp2 @ ` ih•il0 X p2@h•lp2  h2 l( h   h•lp2 hB00l0 pGXWWP0  h•lp2 hB 0l0 DD N -LM@9P 0h -L M0 D:p` R%@ 0TĀ<0 @0% $R 29R R R /@8R R^l9^>T9R H9RD9 RR ,9 R 9RV 9R 9R\ \^񟗿>"H@"@">"\A">">">">">">">">">">">"A"hB">"B"pC"h—@lp2 @ h2l (h— lp2@N  @h—IIlI= Xh—@lp2 @ h2l (h— lp2@N  @h—IIl?h—@lp2 @ h2l (h— lp2@N  @h—I7Il0h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl0vh—@lp2 @ h2l (h— lp2@N  @h—IIl;U `5 T5R  RU00$5RU4 N4S, S < ğU1# =C4  0SU 0R0 Rx$yR\$. U1 #Pj U@1 @# $  唦PdU010# \ \s^o>"E" F">"F">">">"$?">">">">">">">">">">">">"h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl:  Rw L2R R U005U R+ 2R U1 # B1R\ \Uh— lp2  h2l (0@\ \Uh— lp2  h2l ( H0     RN4JĠ,K +0K)K,K*K孥U  ᧠      # #D = :$:== = '= 0-0P L@3  $0S0$00hA6 -LM@6P 0h p-LM`0 Pp03M @RT0 H ?A3c<е, ᗵᙵl p =Mb" -LM0@3 ⸵0<0S0S Q0- L@P Q 08S0@  0-8PS@L ⊵L4QK4=0BPP-= p-L Mh@V PK 0 ;P ,0"  000(^ `08 ͟00pp80 -L MX`U(pK 0:P@) P(,0 0@00(PU 0HZ  H 08ᓟ0$00N   p-LMP@ `L 80Hpho  -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 ᓢ@`p`B0 Xp0C$ 0P8 R <0 ,4 0 sP@ 0P0NPP`  0 0B@$B -LMxPW$`K 0:P@) p$ ,0#  0@0(0(?^ H  H 0p8О040 0  p-LMP@ `8 0Hph  -LMp, Dh— lp2  h2l ,* B: @P0  *TU  #0\20\2 0``V $0Z0``V &0Z>❟ ($8 09P@ t2 |,b[03iP @ 090_P @ 090UP@ 0`90K0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`:h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\d:hBlp2 P h—l 0\` h—lp2  h2l ,` V @`1`>V| 8h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\9hBlp2  h—lH 40\hBlp2  h—l80L \40#9` P9h—lp2 P h2lH ,` V P x1@Tp!0040`THPHN0L8 sh—lp2 P hR3l1 \hBlp2  h—l ,0\d29hhBlp2 ` h—l 1\`VJA`V@DZ@꬟::|U;4:H:d=h:@%I$̄=\"-=|:0 6M7 -LM HTe | H0S 8$T| 㸛=@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPp UU U m teh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2800C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\8hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\7hBlp2 ` h—0H l\27 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 R^e= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 K(N@g,x p1@`X3hB lp2  h•l 0\ }+`\80\80P`\( 0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLğ:f"=: : : 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L/(PM0h -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p"<: -LMT2p0T20H0,08,8T $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT2003 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0`1.\0S R000R0 A60S!0\@Pƭ R 00c0C20000#2wI`-$0S` 4 00hB lp2  h—0l \Z0 00%`-J@s$0S  -LM`@(0 S4p8P!P 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@㕗 T 0 0 mY-Tph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P40 QhBlp2 h2 l,3 `VZ00h -/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`EP, @ ?P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0i,0P @, k4040<0<@   ˛140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p08 08hBlp2`  h˜0l \0S 0 R zP@` ǫX0 P0 ,!ë ,(0=ls"=Mb0 0  Q-L 0S S 0SQ 0 0 d:-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@\%s" 0-L@P0h -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y u"u"u"u"0!<00  0P @r00S  X 000o{000, 0r00  o+ RP 80(S"ˠ ʠ0S80 S0000 ====== -LM04p@PK`Y20 0004iP -LM@P0p14 RP80 TrWL1 R@S`P~090 %20 ` `'0 pUL0$ `Rp 090*o0 #>WS @ $0S Z002`P8g:: p-QLM@`Pp7T 00 @DRT0  0 @DRTʃ0p -LM@*P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳{"D|"$z"$z"$z"$z"$z"|"$z"$z"$z"$z"$z"$z"$z"|"|"4}"p}"}"hB lp2  h—l 0\0ISh— lp2  h2l , }hB lp2  h—l 0hB lp2  h—l 08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0WP`$ @ 0A,(0"A 0 P `4@  D 00p[(04 0,08`090o*0  oľ:0 0P  -LMP@050pSS 004`090LP40S 6,p$0( 90 i P40S i郾: - 0p`L<0@@pP4z 0-0L@P80h0 0 U00#1300"#"0aS -LMh2pl $h2tl ,h2l , h—0\2t"0l\+h—lt"0\@+h2lt",@ cT h—`02lt", P꼑"""p";2o*0|)PP  0hB02,0t" 0l \2H 004 ồ70@6P P@ TP@0T!"1P0 0D@0@:D 0!@0T  0L"@TPh:@TP\ P :@0` @00 `HD``L@h—P0t"0l \o  6q 1m0`!@{h2lt",hR 08lt"10\h—t"l@ 0\*h2t"l ,Z@ cT R\0 Rhh2t"l ,?0h”t"l \= p-PLMP+ t"h2l ,?@p6`ph•t"0 l\T2X"0 T2X"71+T2V0CT2p6h•0t"6l \ 峼oN4 @ᔢT [L0`[4囼x` z `ğ:"=: -Q6600Lt"h66l \ -QLMP`, <0 @Ɩ1p0C S1 !@ɌT 0 0 i"t"h2!@ l,?>*0D <@0T 0-T20QLPT2 |@&Tx2 6S d 0ST20CT20 00qN@ Ρ0ϡԺ"= -LM @R 0 R  "888@S4QPܡ0hhh\:0@-SS0 04@ Q 0 #88R8 ,40S,(4((40bQ,5@   ,20#0Q00S0 00@!S@ p-LMP0U`0@;)s> Rh”t"l ,&00?PUZ00ph!0S p -LMh2t"@ l,6 hw 0-,7PS@LqMo JP 2<SK(0LڧPP-= Q0- L@P Q 0,7Ss>@i -`LPVm MVK&0@0T0Fh2lt",h•00`lt"0\@h•t"l ,0 @ (cT\h•`lt"0\@h•t"l ,0 @(cTݺ"00C0 m7t"h2q @ l,"@ R0 6Tڥt"h• l@ \Th•0t"00l 0\2•hB,0t" 0l \&hBP0t"l 0\h•t"6l \6@Tp&h•lt"2\hBt"l@ 0\@h•t"l ,0 @ (cTh2(t"h2 @ l,-R`@@0' 6TW 2'6@Tt"h2q @ l,-R`@@0 6Tڪt"h• l@ \t"h• l@ p\=h:: 0-Lh@lt"0\hRt"l0\00 %% -LMFTe m H0S6T  X$0 p0 t@x y@꠺"6H SH0&4 010 -L MP `s> pR,  R000 00 2 ,0Ru 0S kS jW00Y00SYP@@ 0, 04$W 6Y8Q70!"#;81;W0   0?04@Wȣ"0"@"L"<0 $P0 00P60000, x0r00 o&XIS R80 R0000 :=,===:==D0HD00DD 0P0R0H0HD0 D0D0S H-0 0@008 0 00  RE0LEZ -LMs> pR@ m ?wy]␠ Ph2lt",h”0lt"@0\0`?D 0`岙Pp W 0 ow= : p-QLM@`PpẍT 00 @DRT0  0 @DRTʃ0p -LM@KP 0h -9L4M , 0 P\ s> R '%@ 0d<0t @0% $R >9R ,R& R 00@8 ,0S ,~\000 R 8RRWd8pWX8R D8R <848R ,8(8R 8R8R 8RVڸ6V1h•t"@@l ,0G*pS񟗩ȩ""""""""""""""""""""d""h•t"l 0\h•t"l 0; S / h•t"A R  0-P L$0S0$000T@0h'0 & p-L MFPT `K?*0?!P ,0 00P0&@)TD `@D06D 0H0D0pp6D0 -L MV`U(pK?*0 !P@'P(,0 0@080&P)U4 `FF404 6ą0<040 0-PL@640F0h -LM<@,P@ P<   BZS.2=6=8  P40 , 0 @  8ڈP@ <P4 ,!4 0P`W >00 0c S @1::#:Jc8彈@`@ d=:#:0P*pP 6. \ p:4 <8040P<0D 8 @ ᧈTP4.4 Z@P @ P ` ) 0`,(P8 p-QLM`P 4@QTp -LM04p@` Pn0 ?04i -L M@P0`ps> 4R80 TQx2 Rl*0 V 0`0 `@0,"`90000P`;hH H , !@  0P471  @ x!0@ L4 0Y`8P8Lp P 08 0Q@ S00 S4p4P 0P 40T0 80Q@P4T Y , 00! oK00͕00 0e`PřhgT:|::@-0s>h@ R @;@ 0-L@BP-0h 0-LP5@0h -LM@RP 0h 0-0L s>@P R )P$0 R0=-0 R0S |Q00  -L$Mp%% 0 P D4 < P@ P`@ 0D@4 8 08 44"8  80T ,` X<0<@  ㏈10< ,0 0 0, 14 <  R, 800004 4 0V0@l0 RP@A8 00 (0 ,! =`"=Mb -0 R0S |Q00s p-LM`P0CT0CSC`0 R Dž0D00 C1T p440D @^e -LM@P 0h -LMs.0P`0SO0  4p0 < $K(K3 PP@ (0$ 0 N$0S 0 R 6@S|0&|00j> 0V0@l0 RP@጗8 S00 (0 ,!O =`"=Mb$0S0$04 0T 1 -LM@P( 0R`0S 0S |Q00  <  0 K$K034@ P P $0 0  p)0S `0 R 00P@!0 (0 0 ,!=`"=Mb  P p-LM` @P080 4`0 p\[; -LM`@ Ƞ Ƞ,Ā\ P 8\ \0 = -LM< @.8\ 0 = 0-@L Ƞ Ƞ,PP 0\ 8^00-Q |0Q 0 R 00L0Q  0 @T 00=RR,@R, -L M@K 0  @ ۛ" Q- L}锢: -L0L\88 00S \0  ]d|e"ieQ Q< -`V`V` pP0UL`p` 3p@6d 0~0S APP U -hp=40 8 dpp 88#0 p廸Ȣ:Ԣ:WEV" 0-D0P @L 0dP 0000P0HU= -LM0s@S* 00 0000 -LMq`PU @ 0@!P6PU $00<0$0@X0 P:00 @?004;0000 `\ @1@!0 H wP@00d@0 H cx=: -LMp0PU  @ {P  0 S X 0`K 0wzPPJPgB: -LMpSt`P0S@0 0 T@  p0S00@@ m@xg= 0-T0L PR 0U@ T 0T000@n= 0-D0L@PT P @T00=(00S S0S= -0L  0 0 eeee 0-L MHP0 @(K00  ,@ 0K# 0S n0g: 0-L MHP0 @(K00  ,@ 0K 0S T0g : -pL0S' P`@V 0PPRPt0   p@hBt `D 0S000,0 R eee eee$: -`P0LS `X@X0p0 0S 0 0C0$ eee 88#4  R00ᐩe 0-L MDP00@K0 P 0 S0 Ĕ0geH: -L Mp0`S  @8PK0S``   0#RP 0 S ( 囔 IgeX:`:Pკ -LMA@ 0  R @se e 0-1Ls8P@  0 08000@ $e= -LM@H 0S00  Q0 0 0S00hw$e 0 0Pe p-LMPK@` _10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: dž -T LM@HT00  (0R ==p^gl: 00= -Lp`P7@T@ h雫 R(( `@ pp00 鄣::= -l`L@PTp P 0S `@T$hr0T0 h=: p-T0LM@PT` P 0S @Tpp= -LM@h 0-pPL0S`0@T P@T00020#J== 0-XPL0S H0@T P@T000 .== p-LMP60@`TL  (`0#pp锣: -LM@ h- -LMx@0SlhѪdϪ@T BLP0 @@ ª0 ,弪@T=:̣::H_;:\%\[; -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QHU=0HU= -L[ P00@-SP@  0P PR  0S0P 0P 0 -LM@QN  0S: -LM$0p@$0  P`y Pq P 3 $0S $kT` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K g::P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0PTP@`2S@PT P Wp == -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5Pog= -PLPM`\p 0K@  0SV 000Pog -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (!l RW xK| K0P x| P@hK0@@ =g=8;p:|:: 0-LM(P@ 0@?0Pog-00 CPog -L\ Tog - 0L0S Tog -L\   Tog -L\Tog -LM$@TTog -L\ Tog -0L0STog -L@PMK!P 0Q0S'H 0 U0 RX7PTPH@ <<0 4Hh@og::|^gg::\[;@:8ogLogX: p-LM`P pP@0T:tPt@0T*dkP 0 @T:@p0wkP 0 @T:ꤪ:8==l\ed[e0>0Up1 @TW 0@H=<= -LM0PhS` /S+ bS` `$pK 0S /@x $ h!$ @PX @ @0f0P,`lSD:\%T:t^gx^gd: p-L MQP@D00CS )#)#)#)#)#T*#*#0 qp-p0 R 0qp`0K0,0 qPU 0S0pD0 R< 0(`$p=|=x=t=#:, 0T@! $1P0$1,0p RQ,W00 R00S = `R0SL @P`08!^` @{p1`@SppW R090` 0, @b0f T@T@!\, _d0`V `%p  d090`,0 W00R00S0  APp x=::: 0-@L 0PS` `0S04 0000dS d0S04 ,000hq0d0q0`0 p-LM0S4PQl0@BO `h`P #3 1Rp0P=Mb-0LS*N#N#hN#hN#|N#|N#|N#$N#$N#hN#hN#|N#|N#|N#|N#|N#|N#0 RD R0ZU00S0\00R B0R0S00 -LMp0`KB@P 0 TQ 0 S \ vQ#Q!@a cTP00Q00Sg: -d3LMap;0, SP\ 1 P0 1 ,^=0 =0 P 0@(1S U1!0O h (10h(1\ P \P 4 P$0U, @0TDd8"^d @o1d@SXwP$0U0900400 $0A Pe00Tc aaP@UPUP!0 b0\PcF0 Y %04 0 :0 S  0P0 c 0c80 a@8aT" P 9 : 0S80S 4DU  X00R00S  X8aP` 00 14e4#PF=Ь:: -3L3aQp4@ h3Qc O3Q x3Q P0S 003Q00P@, P"=0 0T0R00SX =0 0U0R00S ?^ P2Q D2Q,142Q0\002QZ +1Q# 1Q 0@ @cP @0 S @@#`0 0@1Qz08X1Q L1Qjj@1Q 81QcXm<000 f0P\ <0S,QN0PGU0SX@ X0S0X0;  [00 @l`t|0 0a 0`= A @A@A A A@A@A@"A@}fA0@!A @A@A~fA A p-QPLM@`L`Qd@`@0SXPv phD@p^zn00 -0LM0 @Q Ap` =0! $1R@ =0 0R`VQ T@በLᅠ` 0R= -LMAp04P\" X0S `R;0S 0 0 X0;0 + 0S &= 0-LM4P@d BR\0 Ttx l00@dP000000tl @(p\# 0-LM@P0S04P`0S L00 0`P00000@ $XZ# -LM<0PS4p@`0 0S0 0%0%_(0; 0R(0 `0S0 Pt1$00fS0)90S0:0$ `X_` l_80S0040000(!0 40(! 0 0 X0$ 0 % R0%`0S =0 80S 0S,Q`0S m080P $P  0mXZ# p-LM<0PS4`h@p0 0S0 0%; 0%(0R 0(0 d0S0 P0(p08 R 40 0 l40 d0S ph]0X0P (P $ 0S90S00 0 l00p\# R5 R, R0 0 R0 00BST^#T^#x^#x^#T^#^#^#^#^#x^#x^#`^#`^#`^#`^#`^#`^#0S 00CS0SS 0S 0 00S 0 -@P 0 @0 PpL040`@@OP@00 @040@ -L$M 0 \,0 pD  \vʒ /=2D0 r6 0@ S> 0@@K04 <0 DP`PV8 $0PS U V L1 ,0S <,r40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  fPH00H0 PU@H^@0lD -¢gج: -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 ]T01 ,0S x,q0r]T@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z D"] 0HD0 ]H g: p-LMPa0R0 P0S 0s+ 00 \) 0B0$ S0,0 @0S PT 0 S @qpE$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@g: 0-LMP@0q0 00S004 , (0 ,KDP 0 S p0 0S 0P$ $0\ R0P$ $00 Rg: -LtM4 ȟ 0R `p,0 8 g 00 XKB/ @pKP0|P s | X0 80 sp0  0sT0  0sl0 0sP0 0sh0 0sL0 0sd0 XZX@Z | R 0|0 0H0 D @0s | R 0| =0=  0=0=  ,1S0=0 R- 00\ TpKXK T = pK0 X0KPP RTs Th pKX@K ᨀlQ r |0SG ]PP|  r |0S5 PP| 0s ]Ox Kq0K q0[9PP0s Nx Kq0K q0[(PP30S ]Ox Kq0K30x PP30S Nx Kq0K30x PPop0s 1s p04 @0 04K<0 8 @K@PPZ00S 000S0S=000S 000S0S=0t@t | R 0T|0 0Sl|  0s = vq0Sf| R+xq 0 Q01S00| r 00CR01 x0s 0 0bQ02 ,0S ,Qo|0s @pPP0S( =00\00S 0S U =0 00R00S 0S WU PPl0 S0PP= 0u|@qst@` M@P UO B@PU7Y U |yX0T p0 l L0P d0 h p0l X0 T d0h L0 P XKpKi1D.30|0 )|`@ \ @$XKPPHpK{PPBg: -LM40 S`p( 8v 0N0!8 ]_10  10 1 0b^@1H 0k0U30 P1s 04 <0 080 4 <KDP00[ 0p000  00b(00  c( 1,0,000 0 00S010 2 R 1 2<00060<  6 070 7 0 0h 0St0x0|0 YxY|=00(0 S ( ng:\0S\ 0S 0 S00UF -LM\@T W@T - L= -LP@Q< Pp4`D $1P 1P @0S@ yE\0\08@0P 0P0@00H 0@P@0ST0@ 0D=MA0@}fMM, 0-h0@ qL! qPP<0 080< 00@ 0DP=== 0-Ė\@0 !SL801LcPP&Ė\ 0S \  K` T @!T@!qWPP4$0;d#;40S Q   # =D: p-LM80@S @0I^SP p4`S ph<0S0<0 -LMP0@S0P<0d|p0Sh?TP0d p-LMH0IN PPU`@ 4S 440 $P PPE4$0; B#;4$UH0 4SphTtphgp#P0444$0 B;#;R4$00 0S 4 -|1LMaD0I~pR @0SI 4 S:0S#0S M4 S:0X P1PbP@"@0S#4 S*+c [`0UP!UP! VP@ 404H 0S   =L: -0LMQ@@0S  `A p 4S``@ 8 S`1VR T῿dၕX}=l0@0SP0Q H0Q Rp  p0S0p0=}f~f 0- LM0PP!0AT @0S8^d040pD @40L000  p:#04 0qcp=@0 I0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `【 HP2 s2P0PHO;ĭ:8gLg -0L@dap SL|#################################P$0  ("Q *0$00 0 e0b 000  H 0W0 00000`PCpP ?s2P0`PHO;:8gLg p-L M$0P" ` a dI!0S$0  S! 0@0  $0dp$0 pHO;0@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|PCP P0 0 |00  |PC O@- @ 0p`P$4@(8,@ P H@>P0S S cV00:00 0 $B Q0B`( >8 >@0  R@@0Z<T: 0(0 @@8[h:WEV00 -@L `PPp0  A |P aP I9-$0q:$0 -LMAPKopX1S00 `N- -q@0P00L,0`TZ T ```` oBZ kBMBp gB080 0-LMP KP0@00)R 0F@ -LM 0 -L$M8 < @0 8  ԑpx<PU8,0K P4ğ @T)B0PS`0: 0 = 0@p$*,0`, p tP@ ,T 0S0   @0 S@0tp0@0 0tp:3@0P00K P00@H00d0 /0  0P 48<@lP0O, 8X1Sl 0 0 R[040 4 4 4PL0PG9#6!,8 R #h# #x#x# # ## #l2, 4P1d @_R ,0<00S, <00<0,28 ,04,P@ ,0 ,0!,04,,,@ @  0a4K/O m,BX0:AT70P !p W+ A 00@K/@ھP@0 H@00S%,0P0 kFƿ,0xk ,dk,P+`< PXg̍g|:t3=Ѝgȍg -LDM`p(P0|@0  90:#:0* 0 0 8 l P 0H0l 0 80S 0@0D0L $ 800iT1@ Rd 0P?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00^>p?` `! P2 BP:P  -LDM4 0 0 0480 H  pD QtVH0@L0 PP0 00 D6<&<60s4@0S@3 0#2A TL0 dTZ TU%T80BPP$ `RP 00B PP@SL`Dcp`Q- 0S"  X1S00 0 d *0K!U*0[L0X!R H H ReXpT !E!0S !0S !N* K0Q1*0[0 R   ꠻2(3@ S:-0K80PH ,1,!@P @dDFA p2 S 1b1 R000I '>'P @T T  T  T T T|  Tt  TTd T\ T 'kȪgggggHO; gggpggPgg -LM`PX1SS0 C10 $@K @P@A$ H 00S@ 60S; F_` K0P! $0S [ ;@V`0 S:![00b0![000![00b00S <;`$ٺ0  R*0 S`%*Pg -LM@  -LM@   @$ @ $ -L M@`d80p0CS?XP0XPPP p | 0 D040Pv¤ 0R 0 PXpH<A7X@004;00ˤPS៤d;=$: - L3f<:0@o$00CSt#T#T#$#\#h#t#t#0 X1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 Q<9 -L4MPK@p0 ;!!0CXa00/A!b2c2c!babSD[0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0C $$$ p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S p,K0 0PPT0$ 0 0PP`@K 40PPoP  KPPC[B Z#D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ ڞP!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0######ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X C#ܡ  `P PIpH0!>0kK1 ̑  c. . j?K!#[ ̑ -gX: -L,M 0 D 0 ) K3S`@  gP1D RBBV"p  0@tP@01 1PP"0PS@ U3 410  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%x$$$$($\$8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R [!"Z@@@ )K@\0 S*dYD   D0P@( ) K P !=h:!=Pg -LLM@Q@D1U d0 ` 8d0K00pW !Z-Pp@ `K !Z0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 n+pPg0S -L MBpBP ,0  ` 0@ P@"@2V*0S @T:@W p!m! 0 PP: p  0P@0 S 0R , 1P -L$M (14 D @H `p 0S$ 5 P 0 @S@R*0 S  R:R*0@ S S8  Q Q 0S< 4 # S S 40040 0S S SQ 00 Q Q Q Q Q @ 08S8 0!0;L0  H  0 0r0  L0 0Q0 R0S .,K P0 (1, 0(100,0@, $,0, (00(0,,00C,0,(0<0  (1B0(1啞 PR00 4 @c?  P< 6@0S 8?@ @ P6? (10w+Pu,00 0q0 P0D4!(10(1 DHY(1! 0(1,L0 001H  L0 100 0(10(19 00(1 0,4 YZ P% P ?& 0S0 @P @dDFA 02 Sp1b1 R000ڝ>0 ?0 0v01H P_?PX,DABp:4=xgPggggt: p-LM@P0c0? 5Ad`A 4 0P?`p p-LMPU`% *@0 PR@ U: @0\0 ?00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV Pp  @ Ȍ qΌP00 ``iP@0  -L$M`. .\@0  @,  @9Pp@0P 0  00Pp ,0R   . . pȞ -LM@. .\ 0P p`@@ ȌqΌ  p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp$ -`5`LDMCHeHH]SLCC뻋"G!T/w, ş0 0S 0 0@ 0 `8 R08 P<0K < D0娔0S0 0$@`D0x4 ,0l4 1 1`4 l`X ` 2D OC< KCP@O' 0PO,4 $0Y- 0:N0`V000#3@p@A Q-@Q0@0P K3PK@cFF_Pp00 0h.PP@`0*`144,`啢(3 >0H! Co!Fe@눽0S P0S㵛@HPKɉᇛ i"@11@T|OExŸ0 @@ @P@H@0S P0 $"@=0S220SPa $09$00 PP 00!A@0q0@0s0 P 0 @00@0 0X! P Z 0000Zu1 XP_0 PPW0 H>gxgh9(;XggPgg؍gg g<"=.:%<%Pg =xg hhgXgg(iid=ggt$:g:-=4"=:P -@ LHM0, X 00 TK0P0 T ( 'P0 S$ \\Dh:x:: -LK/K KT1 l < dQ 0P 8P XQ HP Pp*,~H0P `: D@P R   R? 0`SDd:d*@P@dDFA@04 Sp0 1d1 R D0D0D00D  ᠈H00H0 D2PUp H0#KPP@f7  42 Pp?KP 0"RX 4"P42p` ?WpWKH0C0Q=8QL" 0p C8P'|l? ,06,08(@P@dyDFA@04 S`ʐ1d1 R 808 08  008  88_ 8NC0@ H0 D"0PT2 U 7  42 Pp?KP0"R T" T" 4"FP42p`P2@f G0 `R T< 0 P"0100b0P 0S42 pw !P0 h0 P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00XPp;42OKcT2( 2 K P2<$P, = P& x q 5|1KS0# 42 42  0K? Pp fp@00@0, p0) 1, V  RD ,07,02 ,0<,00  0  ,0bD%P'{@BL"p 0Fz F<,0S KP:< H2 K( <P.,0 '?lw 1S H R < S <H0 3  @0S@0[30@0S,06,0K < l?K  ,06,0 <@.0 00000 0  0\~ Pl ,0@7<,0Lc2` 0" 2 0 " 082 0S/KK 82 3[VPpH:wM KPpD 0s@ gPp#H@"D00D082帀8"82<@"82$ 8(00(08",00C,08(0,`VŻ*<> 8@4!0Q68Q AL"p 0(T'PzT@1@!@P@dDFA@04 S` 1d1 R 808 08  008  W8~mA< 80R 0R0R,070H,0)ٱ00C +?DUԍg<"=^egggPg,=V4= -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K Q'00K@8,;P4( 0,0 B0RP,0 ( 4K  P@"`V@J,K Q'00K@,P0 ,0`V0P,0 Z  @P  -LM40HH,0 (FD:!$ Dg\ggg h: 0-HP@L@6<08 S800$< @P+  R 0 0 0 LPP0P0P 0  00CS0 PHQ>D 00C0Ү0D>*Ogg,=g -LM,0@ h( -LM8@ $0 @@@9v$ -LM 0 ' -LM  l  \ \  @@    0 0\$  -LM`HHwP@UD ^P, ^ )P#B00jU  t0S: p0S*\0#0C06 0wP hu<@PpX(1p@@( o( )  ),1 ,@1m,5,  0 ;00 , ,0K<0 0M0p 000 !R !@00@0, F, @ k00002@1 Q ,0,00,0,0040 ,0t 0,0,H`@,06,0,0 l0t T0`P 1D0S @,0PH#T@ 0 P@es\ H) HC),  8 ,0 0000  Dp0S 67cAPß0 R400 0 C4 P 180S !80<0 0Q40 T0!P< @ L0P0T0RP0L@0TPD0,0@  @ D @P H H40RX08QG 㲁@2  1 "~Fv 4F"40,S000000000QP4 R ,0 @0 $"@#,000S ,0 P4 00  *!140!0400 67c@[,0 00 0000  ?, 0 0000  1 0 0 000  &s$40,0 \=,=De,=:HU=g%<%g1p$x$ggg XgTgPgV hȱ: -LM@P P80Q 40S @1 R Q\g 0-0-LM@0lKP -@ @P@ 0 0,̌,KBU00xg P0-L@8P ,P04 KBgб: -p0p`PVL  P@  $ p0P`@@@ g,=: 0-XX0@ TL  P0 RP d@T0,= g -Lp$@P`0$ P 000 0p `pp0S 0 S  -LM5 @u p4P 070 ' 0d%` RXQ  0ASK|$܄$T$$x$T$$0S8  0 10P 0000  0 0S 0S 090N# 00 0 0@9" 0P0CP 0 0 MPP0000S0S?0 0 0 0 90 0S #0SQ  0 0S0P 00:0 R0  00 0 0@! 0P0CP 0 MP0S0 0U:00900S00v 00 0 0@! 0P0CP 0g 0 @00 PZ\0S: 0S700C0 0 u0Sr0* 0P:0 R0U: 00 0 0@! 0P0CP 0 MP0S0Si 0Sf }"c`O0S 0SD00C0 ROI0S00C0H0S2  0 (0S% 0S"0P  `090 0@@!PP  0 0S 0S090\0S 0S8 ,>(>gpp@ :<:`:::IJ:: : -LM@0hS0\   '@D$@ 0<S h@$@ @H:l:::: -82LMP`@ H%P ?> P_PS PMPpps~QAgA, 0@S1 V0>0nÃ0g`ƃ. Bx!x00  0L rPP H!H0 0cC61 Vp ಐ 0 f R0 f 0S P00, ~ ,~@Ppp P P pp P p p P  P P p p PppPPppPppg,=::g,= hgg: - @0 0cC61 `BL!bQ}`p T 0 S0``00`m} 0&q ꤖggg,=h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50,=,=,=~e -LMp|`0L Kl !@6$ K@pLPP @ 4$@0@q0HU=,=Le,=ggg -L0à PP PP @P@ P P   P   P  P P   P  PPP -0L8: -LM0@ ;Ph? -<0LM   @)0Sh,g -LM0@ CPhY -LM @ PhI0S00 00 -0SL M00` @ p(P|0 P  0S 0 @ 0 P  #g(9 p-LM@P`@V0D  Pppht -L$M00 3`0 P0Q&Q< , 40 0 {00 @005000"@D0000 000{0D`404x0, 80 Sy 08 a Rm 00070@0 0X D H @0$;H D H 0S8<00D v 0V 0 V 0V P-w 0W 0 W 0W Pu U ROPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p EpT  =`X  6WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T C@@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!FP P,0<,00 R*0SR:0 0S 000 VP -LM.P@,00$g 00CS0/$g 0-0LSP P @ 000 0-L@P Pr 000 0R0 @1 U 0-LP@P0 0@ ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000 Q^0 0P |0 Q P 0T@P@ P ( 0@T@PP.Xg -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP@ @T   @@TpPXg 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @s@js0. p-LM0(@KP `P0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSHĶ$ķ$̷$̷$̷$ط$$L10S0S0P 0R W   Q0 PQ0ba>0>0  0t0ab0PP0<@0 /000B0 P,=,== =0S   -L$M@ , 0 40 r0 @@0Kr@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% \. pW0@R/ ;"M2 0S @##mSPU`!q p0奎 @K3' 9 4,@  4X 8< @K@KP à ]C@TPa`~ pà &@K( 4@@K @Bg= 0-LP| 0\@ IH 0h00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L+@ 0 0 pP*00eg:t.= 00CS0,갱g 0-PL@ q0S  000@000qp0hƅ\0^  00lS R00@,=,=: p-LMP @qT0`SX 0 R0Z<00@4<0 R00T00T0ph?qX R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@  S6 $0D! 1 S S  -1 0140S  @1 RHU?,  kP(?[kU wkPH+Gk,  P 0@ !101,=ȸ:, H*010,  -T1LMP@0!q$@ !$1!S0, 00 ,!(4 01, 40 00 R`5 3k101 1    !1 (1V 0(1 0!$10$101j0<  < $Q001$1(1,1400 ,0  0 og,= 0-LX, 0*00D0, !@P 0hk$0$PPV,= -,#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,\0K  00 D@K l"01p],0TK- 0 @ P <P` @JK  0>P`80S ` ᖵ0 @V \, $16d ECK 0 $T!H0"00./H0 pK|` $t` $1|K\0 (!T` X 06P0 &L  Ơ0H P` 0ὐP`, 7[` pP幯`;P`W, D (0 RO>gԸ::gV-= - LN -LM@P`paT0EP@Sp$x$x$x$p$x$p$p$x$x$x$x$x$x$x$x$x$x$x$x$x$x$p $ 1 01410g4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP 0 0S )  0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:sP 0S* !0S:0D000): -L@`p PXP0 Vp P  00 00S0@ R0000 0 p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PP( 0 S600-= $0R0000 0 -= -PL whUp ``@T @Th?h(`@T @T-= -LDM0`SP\` pw 0B Sq!XKP@>X00C S_$$$,$4$L$<$D$L$T$\$T0儡 S P=\ dP@X'\`0 \KA0TK 0 @Q XT  Q  @ 4Y\ 0YP@ h\K ;P@`\XTP-D@P@$-=.E'>&$$1L)#:' -LGM<\, P`p @ 0B9S9$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0 S ,0BES񟗳,$D$L$d$l$$$$$8$$$$$$$$p$$$$ $p$$$$$$$$$$$$$$$L$|$$$$$$$$ $($d$|$$$$$$$ $$$$$$4$L$h$$$$$$5 u55 5ş 0Zşş 7h0 0K FPPW 0S0\40Ssp0|jğ0 L@P00W00SP4 D0MK 4 41P0GC ϔ>o:04,4 I0ğ0 L@P00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOK$ 0PP3Q 2R  04L 0@2 2 (2 "0L 0PX"T"P"(2^ 2R  0kL 0%ANK 08 SPP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0PP8UL 0!?-= Ag:Tt:\t:t:== = > 0K0 1 z_08 K10, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T(!P=9@ =C, 0 ,0 ,00  "$20   41 !01 !0@ H1@1  00 0 1K?` `0X Q0V/@< i00.3V6?B1-2 -QLTMQ0DSP Y 100CS,0   V 0 00 N 80K`0 \ H D T P0K =p`KX @P <  XKQP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt vP`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKQP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKQP`@P@*0S @T:0l00S0*d -P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` f00dKt d0 `,0  TT070- -LM@Pw0Sz b PU ,nPUPfP_x2p"@`@  @DD2  >P@U`@ p ,0 "S0f" :,0 @ `4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00  T 0PU ` ,0 @4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U-=gg-=-=g|U;: -LM -LQM\@@T`0p"\  8PU D @D  0DP PU\ e@\ cX` 0\ p-L M\@` Q 0 SppQ0 \"\ 0 1PU P P 80K00,0 0080pp 0pp!=!= -LM@Ÿ,0 82^`p@2PU ]2k] i] ]2K/`pP倀/0S0@@,0@S00]Y P ,0!0R,0R   10M PU?0S  1 @00@0 0]1!, 0 ,0# =U,0 Y U !R ,0  10 gPU $ E00P#,0S 0S010%P,J^eggdgdg-g 0-@L ]0PS 10S ,0;,00h\)0-SL 2?\ 00S00 0R0dg -LMP p\2 ?`@T 0S @T o\ 倀 0pGS10S0S 010夀($0$ WdgP= -LM@PP P0S0S Kl00(K"c1 1( $0 P K PK P= -L MQ0S HP0K pP [l00K `?T0P@0Z404 Po5(KG"%$  P=xg -LM0PS\ P $K <P$ P1RH1Rq2b3c1 CpW00Q00S5 q10W0cW0` 01`P  W `fZ 0@`pZQ|0Ϡ$KBl2l3c13D 0 $ oPW00q Z0@c-= =lghgC -LM0PS@9 Z0`S ,@KŒNZ ?4pK*,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K P6\DT@ ,@KP4`KP 0S#P<K,0S(0S QD( 80, <0P=9@ =C, ( , (0 | Y@ Y0$K $0 XP?B -LMP\`^0S@$pK0  0=BR L0 0{0$ S ,K ( 0,cP=9l A =( (0 , , ,0@Q   0R?BL0Q R 40RQ R 00R0 ?B=0S0 0R0=0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00gg00  0-PL@e0  0|0  0 c0cR 0 0 PP$0hw00 PP-=gg -LM@<500 0 00000hV-= 0-L   01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0-=gggg -LMq0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@X#g-=ggg -LM@PT 0倐0c/a"|,K0K p} }0H0\0  b,G$0@T逹ggt:x: 0-L0LD@<84PK@TP0h꼒g::-=gg -LMP@T0@ < 000M0 0-=g'%-=-='%g -P0LM D@R80(0 h+-=-=-==g -LMH@0DSK40$00 -=g-=-=-= -L MaPQY P= P9X0 P@0S ,Q0S" PU qQ0S PQ00 P 0tp K00, 0P@U4 440$--=-=gg-=-==-='% -LM@P  -LĹ: 0-8P8@L ,x $t0h'e e*%`+% 0-l0P@LT  2V0 0 0V404 00$0Ba0hQg= 00*ꔒghgXg-=g=g- p- LM0 P1R@0tt00BP0 0CS0 kP 00CS0tphh 0-P0L @wU@0K/0P10 @00@0$0h?Ug- 0- `0RL PZUH0 K?@1  D00D00h"Uzg-ع: p-L1 M PK`l 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  d坽pu 0R 0R 0@ 0Sglg?B h( 11 R00 gg -LM10@S0%0%0%41%<1%0%0%0%01010S 00h0K/ RT0T ,0  U? R1B 11:g0S,0S00S7  0PS0U 0S PPp!0Si0h 0T0S <|4yp0+-=4:P::d:h: -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP00,`,@08JC8 1!Q4K 08SVg-=:: Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00g -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0JP4K 08S,@=x= -@Pp L4`V 0 h$W  0-= p-LM @`PU 0 phtp: -PLMp 0 Q` @@f`P 0,0 a0S00N P@@00 `AW<  >Z   0P @0S S $@0SP ,00 R f 0R0 S0 0R00 S00g:g^e: -LM`@/PpU PPN 0 S0 (0 @00B 0d! P7$` 0\V@@Tʄ@T@ P fAV 0 !R0,0 ] '0V|M 2S00S \0 !R Q::8:@:`:h:p:: -LM0`<K  ,0 9 @0Sj 0S-aP g,0 S ,~A0S S: $@0S R 0X10  0P 8 0Q 1 U1S RR 0 R <Ke0000 0S Q0 0Q B 0 R00'P g:x=g^e̻:ܻ: 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'O :g@: -xpL@`T 0P$ R U@U00000 g 000g0  B QFg -tp@0L P `R $0S@0  P PT0g p-p0LM PR` $0@S T pV V -P T8g -QLM@0Q 0AT (00@T,00,0,00CS,0 -0LM@ 00  0@@g@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ": -LMPD 88#| , `0 a@Tq LyHq00D!@1`  00,0 <X@ PX`9Z `<@? 0O@X Z 2 8` 0 0,8,@`P T< (0R0꤉%l9%p:;x:::::`;0  0 ggg P0-LP P0 RD0@T ,P @T000gg -LM@ @000000 -LM00@(  e 0 Se Rd}`H00< @0 00 0@ ,ļ:ggg -LM@)& LR 0@00  0 $0 BR  ?ggg: 400Sh40 -LM40@0CsP40B ,K☷h(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*H0P@ ,&?B: k g -PLNX`@08P@H p`40p0t0haN -LgMℑ 0,0  D!(0("4400@$04 T` 0$q$@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< V4Tlegg4:ie\:edA#:<,:P-Ľ:: -LM  rP@- 0 00  /K%K% L% :, R  00SSAπ |. 0 R$0|$0\|-  08eg,: -LM`@pPP   pP0D 000 0  0@.=8e R0 00  0 8e -LM`Pp ^H QDP?1@ T 0S2 @T0NS N%(N%dN%N% 0 -T bM09M0 P4T 0 T 0S 0\8eg@@ R4 000 S00 @eHe -L M8@4^ 0 P00Deg4: -(0LM@T @THe -L MV, 0 XP. ,PGZ@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  #P@ 0-@LTP  @T000@YT R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP+  R 0S 0S * R 0  0004 0\P  # @: -L4M@`paP, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  *<R0#03^0S< 8@ 0P L<0 0Q\8@0P  000 0hP& ,#,0 m0@4 L , @: -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W d U*00 U R000 SPp    H:p: -LM0@`p& PPpU 0W PP  P @R000 ]JWP$(@-JT00@:g p-LM P@* 00  00 R 0  @000ph.J`h J0 p0 0S0 0  @J` phIg -PL M@ L 0@e @T  ^ @T % 됾::ܾ:: Q0-L@0PA 0R Lx0 0 PR0 R P P0000 0S0SS RRga0gg-0x0 R0  0^0\\00 0RP00ga0 R00g0 gg -L1LM P@p|I 0R`) LI000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0Tddd @P` 0R I I#gg : - L@P$IA@`p 00( Sp Hgg 0-1LsDP@   0,0, 800<0H00@H g .=g -LM@ HH 0S00  Q0 0 0S00hHg<0 A P 0-0@ LRPD0|0u 0h۽00000 ~0ggg p-0LMQ@, 0Q 0Q p0 p` H0 $PBcHU0 PPx0Q p0Q T 0  0 0S$  00000}ff@wt@gg~fvt00  -LM0@ S#b%b%b%b%b%b%b%b%b%b%b%b%b%b% EH00 b:0 S H 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 ph h0p( &G@ FLe -LM `@tV`Pp0S:000 0`0 0@0 0WpUP@5 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% `(`0<0`PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pe<<L 0 P] t.=gLeg.=4:<:eD: -LMX @R\0T \0\00X \0 P PQ  Q R0 00  0 .= 0-Lh0P|0 P 07F@P FLe -LMPpH L0Rz `V.P@  `VT  <000T Pd0` 0 d0l0K000@T[ R0000 0 D H0 B0D H0 R00C0 R000  R 0``0 00 S  R000 R 0` 0 `0V0D, 0Q0:""0Sd0` 0 0S0XP `(;`: 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  0 R000  R 000ӭ<00CP 0 R000  R000<K7p 0 S:`=|:z -<@LAP=:P`@P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p` -D ,0LR@p:PPP  ,`VU  0D, 0Q0:U> p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@ro40 p-LMPH`Q`3:Qq 0L`` <@@TQ4p -LM@0T`80  r@T,K ᣬPU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU C@0CD0<,0lS:\$.=Le -LP`pC@ h{C 0-LM@PT $ 0@T0頿: -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXHȿ:: :@:t::::::\[;$:H:|:::: -L* 0S pg`;: -p-LM P.? 0@``>,0 \0 Kp`g -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh`T0q(PW  0U00g=g.= --L0LM,  @!0 \ g --LM 0 --00LM Q0rL= -p-LM@XXP 0`@^00@ R `>p.=.=g p-LM@\PX`  0PP=00@ R Ppx.=.=g --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSUȕ% % %% % % % % % % %T% %<%d% %%%%%%%%%%% % % % % % % % % % %L% % % % % % % % % % %h% % % % % %% % %t% % % % % % % % % %4% %X% % % %d%X% % %x% %%t%t%%%l% %% % %% %%T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,D\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D '0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 oh l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 |P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D Kg::: :(:D:=X:`:H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  P PaPh hp ` Ph l  S -L(; -@LM鼦: -LM @pT0T0P 9 @ 0` 0  00n800@- 0P^c: 2#80S$H *   ,0 9,00 00S" hPK0h`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs Q+, P@ 0S "+@0,0"F0@+T t@,0#T@@0T,0QQ QL@0KP'P| P@T| P@X| @Lp\ d0S`K UP@`KiP@hK⸓\ d0` h0P=9@ =C` \ ` \0 \D| 8P@Q H| 1P@G L| *P@= @K@<0K8 KH0 40KD X0 0 K,0K@KT P0 L )gQ=:|g?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#P@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  p9E 0-04PLS@ SP0P 0R0000|g 0-@LP 00PP0 5* x0@R ,0@@0,00h*10S -S0(0  u|gg -LpMW,0 P`*0 S0! P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0p@p 00 -LLM0d $@0dS0!ph WH0Kp0  Pl dl pPP *p0 R0:z 2 PKBa2a11J"c11L0 P P_XKZL T0PX04"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPK6XP0\Z 4PK`K\ 0`cPl=9 A =` ` \ ` \0 d1R@\!002c2c W), P@ $0S ')@0,0 !F0)Y ,0#Y@0,0 y Y pHKP4 d0l pd pl PZL T0S0L0 P0  vp H =Mb?BgQ=:|g -L M`(pMPP@[|P@Q,K0 KGP@J,0, 4K,00$P,00 K0004P@040 4 0040$4 000<,W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pιt ԛ@0@0c@(0@0<@0e p@ < @0^ <@0Y*0#p@@ 80Pt 㘛@00@0|| 0Pp@0 p@0@0@0@0<@0g::0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||Z=ĭg -LM`lPg0 pO#@"##  0@D  D \@0訠 $☀ ";p05  R @? 0SU 0S 2 )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU WZ x 㼴U WK 0xU U U|Uu 05 00  (0r05^ UZ   ^;8p09` (0S.@H 20U0S 6 =   y0PD 0@$  $ `ghg|9ieLg - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0S&&&&&&&QA0 0(!)^  so 0@d 0 d  0=`H T PPT JO  L-0c Z0 => PH @ 0`0Od  d  -Xg|9; -PLlMUp` e9U9^9U95Z:@| 0S , x0\ $1 1F0S TT)T9@ P@ ,9U+ 9U b8UY 9U 8U p0;p0p0;8U 8Up   5,0p  @ 0S 0S||^ ^^ 00CS0 @ 000@! 0|0@!x @1 ,00,0|~P@ 7U; 7U 7Uh00rX7U! L7U@1| R 〪PxP,06Ur  &uF<nH0>pm0&0p" yt6U7 ch6UU -6U P6UF0Sp0p000p0`0 R ` 0 R @1| R,0 h 52&@5U' 5U5P lU*h0U deh02 P@hP" h0  Q4U 4U 4U哤@1| Q_,0\ P 0SxPx4U :l40SX40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  1`(p@ PKK020 㼱 0<p0 P@WP@Px2U@  㾰PC  x 5: t08t0 @8t0  t07t00@t08t00 t07t0 P. q0S S p0(0(S" @0H0 1P pKl p0 LP D` ^CP@X `d0 `0rg@ `h`EIT  0X , 㒴U0U 0U 000St{t rtzt ^t g/=t,@ot t t at nt ĭgst@f@t@[t@wt@ht@iebt~f}f0=t1=Ztetvtgtt,=h: 4-0L0Œ@PqAp`@ .H0S`VW T8  P`0 p0ie p- 40t 0LM"@`1Ps sP<0 p80<`,00@0ie/=0= 0-=0p 0"L@<P0S00  Q0 0 0S000hie p-LM= x0 2`<P@J 0 p0191p 0Spie 0-=0p 0"L@<P0S00  Q0 0 0S000hie -LM= 40 @2< H >Pie -LM0@  (0 P0SM0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP ,p/= 0-L@PP 0 p-LM@P9` (Q,Q&p0 >;-p0.(php0m h< p0ŒHQHPoHP(ie ײ/= 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@Lp0P0p00h -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =UP@ ( P@0p 5*0p -=`b0V``V=J`VZ0@   p0  X:p0\|9: Q0-L@PA  UPE0 -LMPP2 (`$pKP@ $! P@`P@ $ P@p0:p00>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@Mp0 t h髌x嬪0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10KS4 S1 1R0 0lj$K0, K. HAN=0S 0 $00!0 $0 q?B6c$ O(N=0S(0 ,0 0 ,0 ( (0?B6c, ;|01c1 @R  1P2;P 0 <0/0"bT uDhQ:,:H:h:p:|::?BHh::::P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@Sp0`(0(S U  &pp 0-LMP  0NႸP>T00  pgTg p-LM`P0> S@0B0" Bw ( H P00 D @000 0@pR@ꐪgpgTg& - `0L0C0 R 000  0 (H0 @P@dDFA 02b Sp>L 0 S0``00`h갗Tgpgggg -0  L0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(QTgpgxg -LMQP`/00CS 8.&d.&l.&t.&|.&000 Pi3-p0l0h0PpT0T@ 0  pBhgXgLg`gTgxg-R Rt0t0\ \t0t088Q  -P@pL >vy0E/>1 `W>p 0 0P0  ]` -LM0@S0S000A?I>ݖC>ז p-LM@0`SC 0^P` a/.!0AS1l0PU00\ p -LP`Vp&0S 0\@l0% @l T@ h00S 00`d d0Vp 0SS 0 0Rh0 -L@Pn`\p U/ 0 ` \L ?>1A 0S>0`Q%\L0 Q` \L0 0H`F V0`b 0-@LP( U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h p-LMP@ `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0p?>1 @ ,< P0 p:Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpFu R- R0S1 0 0V$ R! 0 @cR@cT@ 2`dPp  00S 00 0V  R 0 A( P0:@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 ذe@- `0R   00\ La/.!0AS1@ ذe p-LM@`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0p -L Mp0S# 0S 0R |p @@`KP@K ` -`,0p@1P LP@U @ Y 0[ @] -LM`,0p@1P HP@U iY 0%\ @a] -LM`,0p@1P HP@U HY 0\ @@] 0-LM@,P@1 P \0Q T0Q  0P\0@1 Q 0,0000at qt @-,0@@1 00S   @[@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ll LP0h޸ |gdD=1=G=(Xelghgܰegt@&dge?&,0 P 0SP|g -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am -h0LPpU` @ T*0S4@  T:PU|g p-t0LMP`U @ T*(04@S T:PU(0ph  |g= p-|0LMP`U @ T*$04@S T:PU00(0aph |g=gfff p-t` M@Lh 0\P@L 0@w,08 0ph3gL:pgT:(=,=0 <0P$=<1=pg p-LMvl0`PU @ T*,04@S T:PU; 000p |gg p-LM@`OT"@@PLH0@P  1 0a1pgg p-LM@`+T"@@PXT0@P$ 1 0 a!1pgg p-LM@`T"@@Phd0@T  1 0a1T  ġpgg 0-@L P 10C1( 8P<0<0< 8 0 10 x@0 (0S $0, $4屑$ ggpg P-LP! p!` 10C1* 8P<0<0< 8 0 10 @|tUTP (0S $0, $4m$[ggpg -LM`@TT"@@P@T 0 0!1  1 101T !0hZ)P$p Q0p0X0` 00 xgg -LM -LM -L M00 0p`40 JQ14 W V  0W:pcW`0X,0 ,KRV 00@S"PP " 101岡UP 40Su 0!0gS0! 0h \,0$00$8 18 8P!8 0 <` 0S 5`1P1l0:嘡 00c|0 S01W01R@1@! ຣ 00 0 d dR0 0pd0 UX XP# 000PX @P` 1 1 101z V 1@  @ :)01@1 0$ 1 g4ggg Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@! < 00 0 pd dR0 00 VW W`iP!000`` W< @ PP 1!1 101 U ! @$ $ R 1 0 +10 ,( 40#s:0U00SL( 0S% 00#0Z00S 3S0 @/PdPU70778D07|ĥUi  X00R00SuU^ @04 p< 4p4 5 L 0P0P00S 40  707780|7ᏥP 0RS04 00707780|7vLD WU @0 0S 40Zdlh 0Sl4p<  R< V14  4 40pPD @L  aL 1SS P00bP0X0,CX 1000cX00P P0P PdP0pU ZlPZdhlT <& 10C1) 8Q<0<0< 8 0 10 0d0喼TwdP (0S $0, $4呃$8[D0 ՗P yP8 \ H R W|Zdhlw L00bL0!RR P00bP0X0,CX 1000cX0\ @0 Q 0 R  P0d0 dP.@ 0Q 0 R8 2$@ 10C1( 8Q<0<0< 8 0 10 0d0  (0S $0, $4$d` L00bL0!RR P00bP0X0,CX 1000cX0,\ P0d0LdP"@ 10C1( 8Q<0<0< 8 0 10 0Xd0᲻ (0S $0, $4宂$圻4Sv  UTpU 1S, 1)PU 0 9^0 SRY  407077L'8HX 0|7ƣ#>PL' 0@P4 0   @Pp Q! ᗖYpX00W00SP PU ggpg p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033`3033#TK@040N2[03,0(00 00S<003& -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@St&&Ć&؆&P 7tPTPL0T@0T0T`@`00RU 0S@000 00u04  ` nQ!k401#8S#00Sd0W  H0WS 0S 0S S d== -LM^P@p \ 0S*p 00 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0ϓ@ᲓT0 3 003` == -LM@@ D0<)p@h 0-!40r@L$ r 00LP<0<080@(  3(@03 0P2= 2=02= 0-40@$PL)t0S0t0  Q0 0 0S00t0S7070h40$ L 0  191# 3S,000`0Q 0-40@$PL0S00  Q0 0 0S000S;0;0h-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6ޠLd0S 0h[LS0S 60h酠 -LM0@00 68 ᰠ6L30S  -LM0@00 6. ᓠL0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤٶPD Ao0 @0 0 @0 @D@刀 0  0庑Tp`Wp@ 0  1SS 000 0, 1000 0@0S 000!RR 000 0, 1000 0 0S@ ׺gg: p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1000 00S 000!RR 000 0, 1000 0 0S@@ @pw: Q-L@`Pp 1 0\pW 0S0 0J@TW U 101h閻0S] !1R U5 1 \  00c<H  80S< \!1R U@ @ 0P00!RR 000 0, 1000 01010@0@0  寐 00 0 0  1SS0 00$00 00a\U0: -LM 0@S 0S -@`TVLP8T 0S `c c 1SS 00b0 0,C 1000c 0!p 10C1 8P<0<0< 8n 0 10 \@]>VTF R5$00b0!RR 00b0 0,C 1000c 0I!` 10C1; 8P<0<0< 8 0 10 x@%T R T@ @T 0S @ @@ (0S $0, $4 {$e (0S $0, $4z$pMo 0f  000f0!RR00f0uZ @o ggpg: -LM0`SP: 0L0 00b0!RR 00b0 0,C 1000c 0!p 10C10 8P<0<0< 8 0 10 @劳kTP0S  00 (0S $0, $4}z$kggpg -pL @M T`1PP& TV@#$($ R 1 0 +10 ,(0c0Q P0SX0   X RX PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP1/,- @ V05@1 0305 0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$t @,00C,0(0, -LM` KPPp*0 SP 0S !0pS$W  ~PP 0 0 0 $0pPW 0,  B, (0,Ⲗ7PN@P$ $ R 1 0+10 ,P(P0C& 0S0 0000@00h!hQ 0 0STP 41D!0Q 00ph00500n0@ 0,e00 000.0 B600 h08 . XB000000 @<08 . ,0gg gg,g,ggDg$g0gg0@-0 Lt0P@h0 P P0P S P00Sd0S00 5H44gg - pLM`P  4 00 !!10AT P0P S( @T, K P@,0sS4P 0S004X0@``_8 820N0Sd0SL8 0000  0000008T 00L 500 0@@僋08,0 ,0S 5H44gg: 0-LP yP@ 000:00 R0@0(g> 0-~pWL`V80S/ ,*L RPP 00(:00 R 0P8 80H@bHT@!d ΅800808 <0 dS< 8 d80S:S<0@PU o00000H8 H g8000g 80< 8p0>֨(g$g: -LMp`1!0PQ[|1|!0Q l1l!0Q \1 Q;P1@T' +00d 0R00K0 ^P00D X0 000p`4@<lht  0@埊p!Vpl\ 0 @@半pV0呋0gg ggg0gHgg,g:,g$g -1LM 1qa 0K@K 0Re P@PT 0000000 Px0S 00d1\ @Pq 0R8KP 408b00Pc=9 = A@ @ 0@0SP@T0030080> 0C& 80 >0C&   0P@00000  D00 , 0gHg0gggg0gg$g: p-LM@00`< P0X Pމ00  ^00 00  40Sp00;00p: -LM00@ +00x <R00 00S00 00@ 00 h00500h鯊00@000`00d400q0g: -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q PT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  10 60 iP@0!0 R? Z8P0, R ! 00 00Z0Y0S0!0 R  -P060@0K8P8@@K04K8 .PP .00sM 4^ ,0DS2(0H S-:$00S03 $0Q4 L0^0L0  @PK0 0@0K800PK00L @@f@PK 08L00X 0$ Q0S R0 0S0!$0 0S0s@@K @PK80$ QJ0S R0 0S0!$0 ;0S7,0sW@00@ K@PK@008 600@K0P T ,00,01g: -L,M00K ʟP@P `H, V"0(%U 04TJZX 0,-@00X 00000P0,  Ppo00 M + d004 @PP@ K0L `p S80  L8 @_ ,\0 ,-80 S@ HQ f0 80X0 ,80 0 00P@K06000 0A80`p S ڍ00:008@ TT 8PO~ 00L @0 00` +Pd M-LMP0Q 0@0 000 X0 80@ `00 @@00@ X 4& -LMpL00  L H0AP4q ` @ H80Y080004;00 0PU !l \i 0@40, @@00'[8 Y 0S @0@ P040P000P妟4&0gL:x:: -L M@0, 0a + ` 0@0 Rp`0  @<0A ,@@0Pp` W 0-LM@0< P   &< <0<0 | 0P | 0S P<0 <<0 088 T00Q0S <<0 0 Tg: - L0; S Pg 10S080T3=@Q1 0 ! 0- p-LM0`PU Q \t0 \ !0SpH@ `Pq0P Ӟ4=Lg::: -\ 0L!R @0Q1S0!!0Q峞4=Lg: 0-`P@0LS HP@0S0@1S@1S3=@-0S 1 1SL 0DS  @  0!0R03=L;=Lg 0-LMtt@ 0dPLH0H T@@P@@T(P0P:t.=Pgg3=3= -L M$$@ 4 0@X:t.=xg 0-L@PVcUT T 80 Q0(0巗0P0 0 Q0h3=xg -LM@04c00C0hŘxg -L M00 1\ 0, 40 \W\ `P`V 0 <p,PY 010Y P@% 0`0 ,0Y000 0 400 Y 3PYo  @0ppVʺU`g -L M0SPIJpP`^ W @ 0@  Q 0CS-  @T" `(p 0 (, #P0p@Q ( R,0,0,0$0( ,0 pT ?00@0W 0@  0R Q 0S0^ #(pK'`@0K 0GP0`P L'h''(''L'T,0P0  0 S 0 00S/ 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 l3=d3= -LM0P@T`K0&$pK  0pP@ $0DS ',''''$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@004 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr =sus0suu0sXR0S0 uq000 0scg`: -LM 0R ) 0 `R 0 4 Pqp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00} \0 -L,M,0$ 000 `P 0S 0+uhP@ R@@T O000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 $P@380[c  R?@# *\0× 000N0/Se @0 pԔpR ͔R300” 㗓p>@ $ ;0 p媔d妔P墔pGWc:0/S Y0+g6 k)PgHg -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < , 0 /S K  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@v@00@0T $ 00@060 S"P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Tk00CS<< R;T0$ 780S2 T0$  3#0S 8@0S00- #P  @00@08Q   #`20S 0 0 j 0 ( |`V   0S  8 R|`V   ~#00K #X0@@ @ p<QT0$   @00@0<@@@00@0W 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SV0S8 0Q0R00SH@090%Hg @ -LM80@0 p,0   `0SdV 0 R &!PP p 000ZT0$  P0  @00@00`0CS ZT0$ ,0S T0$ 0 @00@0,0S 0  "0@ < RP   " 幗x:: -@ MLdd 0\PVP0P @L@HHH0H @@@@hL t.=:XgDg(gHgg@!T@0\ 0   0V0P@@T@ 0004P g0401S0 R 0S  R0\7@ \ $ \` 1\P@d0 Rd0 0Dz|g -LM@0  01R p-LMP!`@4T  R00`VPZpl@' p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  l[P @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L啑X @呑0 NP  pㄑ 80S@% W@W@TU PKT@ K0@x_x\P0YxtK4V U@KP*P80S@@KPP,,Pg p-LM0 `P0 K0 0  P P@@T|@Kd S0|0 "0ˠˠK Kx P@ pfKP ^ypug 0-LHM080 0\K4 X0 \ 0 gP@ LP80SH@ 8KHP 640MHP@ <0@@T8 KT@ -L 0 00CS 03 0S 0S Xtq0 p@Pޱ@dDFA 02 St1b1 R0``00` ᠱ0|03_W餖ggg -LMp|`V$ 750 @P壱@dDFA 02b SP0 S0``00`c0|03ꤖggg -LM@r r :\[;|0 r,:0S S  (00S 0 < - -LqT:@-| q  qL@H0 800@< (  3 03( 04>=D>=1EP!010 P?U@U  |L1 "  40 $,n|  40 KZP@   8| 0 @|  0@* @%T ?|>1 1E  e.0  | D`<0;<0 | !88#cng:ie4: 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, -n0iel:gG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8=@gųE.HgLgnm99Dgk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$HmQTgPg99=:@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S009 9E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM90@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 9p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 \@0=\gXg -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , PgXg\g@- @  0 201 R 0\ R R  0^0T,0S \gXg0S R00  -LMpx<0 3Qp`@` PUp,0Kd @T0 SP0@=0 Ḩ@H;08"@z(,0P, @ @4@00`  ,P@ ,T 0p 0V ,0t x0sn 4K 00K P@ \4 x?40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8h ,0 ,0 i ,0 j, 6, #40l, 6, #40n, 6, #40p, 7, #40r, 7, #40t, t0, #40h,0xh0, x00#40h0, z000h0, {0000 ,x0sv0000 ,x0swW (q(徼lj i0 | n t0rp h0 0h0d -LMhP<8 p 0` x0s x0S:Wnt0 40 , tpdX0A1g\0$ ZV `X ,0H0C ad00@K/@帻P@ 0帼O00dHh9802 0Z0xp$00W 0, r 40KP@X0, G2# 4Q x0000s0$X0` 70bdX0A1A ,0KP@  7h: -LM0P<@0 x0s.h0`)x U*d0X  B00C2!3r T0Q 0Pp0$0xP0iux 0`!fD: -LMh0@ Xh* -LMp`Md 0S#0 @PY@dDFA 02b S=\ 0 S0``00`@(0 0ꤖggg -LM`@p\0S ,0S 7\0S  T$ 0p0p\0 -LM`l@p;;p80< !,0eS0!W@ PP4X0T l; -L$Mß @@@  YS00Pp D0 P t\0 'h0! Xx0SY ` @0 b2@ZP X0x d#BR  Z `0D 0c2# ZPd0( K`0`"00K,`fQ|"|"4 010001P*0x000 s0 :80K  .P7x0 qD0 4Ht0T$p T q! (0x$嬱 (0K$p Pp( $\ W (0S`Du] ᐱ@0T$p@0R:: -L MQ@p`d%X` 0D 30nR\050@ 70 0/`]PP X 0\ H S00`X H a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P,K0KX PE5 0P@600K4@K00@P@-4\0H0 R $0U  P 0 PE A\0 0S 4XP@ 0\ 00U00S4 -L$M00@0 < D <0 D0PJ 4K 0 K0LPp<@00K408@K@嶯Pp+84H@ `0T*PU  0 @ H0 `0T: ᠰWD00D0  -P 848pᎰ8劰PD\ -LM0p`0K4K 0PP-00K408@K@_P84H 0R *@T T 0S H0 0R:L`I E8A -LM⤐Kp  | P%P@$  ԁ0S   @T8$0@-@T2PQ @0(0$ ,P@x`80S|0" 0Qy0 Q $0 LMj0  0P@  [$0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  P0@)P000m@KY 0(Zao,0Y  (Zae, M| 000 03@c_ K/^ 0 Q10V`\ 0  0iP@  s `|e -L,M|0`p %PP 3P47 V( 0@ 0@@hP U $0000  0PP(KP!4 4 ;PP, 00;000,0iH@i+  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2?S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00c.D80 4Qt0LP 3R3 H0 x0l3H tR880l0-0P R*l0 4p004 C@`\ d00d @0RX OP|0@@,P0 R0 Z P ;zA<u,0,0 |Q-P00B -PP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 忬PP,0\H@ *P 0|0,嵭0,0 y$ *P *P *P{/0  4 8<0@CqYP@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0g:: 9:00 -@L pP`0 A|`PQ>`&<;$0 :$0! -LM0K"@P0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` G.Z C.MB| ?. D j)p p-LM80@SP0 0<l0S 0\S `V p 0z0S0 O -LMQ`0(  $0 ,` h0@Sph, K 0STL - 0NP$  $$'8K :'l `( h0$0X0`\ P<Xd ,0$ 0,0XP Y\ T YLAp0StX Xh0< `LPX 0S th \0X0 0XYX T 4SY pDK &Yxy  T " GPBt p Rp 0 .Rgg:::`;: -#LM0 ,0 `t0 S0p$ x0R#*@K 0@`PK@K:"00 p D0 00 0 000 `X0Hl0Cd0/d@H"H@ y& [H 0#40L [ 4[#40N [ 4[#40O [ J[4[#40F [ 4[#40H [ 4[#40x trh !4;0:L [0 4[#410N [. 4[#4/0O [- J[24[#430F [8 4[#490H [6 4[#470x r> LP.\ K P'@ PK K 0@ PKD @ P tP0  嘺0  0 ,0S ,8J J};[0 [ 740w 5 @0QLKN KO0KX0N0 JKQ0E0FKH KJP0[ 0P0K5g?=(:Pg -LMP` V$ &P 0@ B`T><3P`ԩ0 0 f@`ǩ?  -LM@ - -LYML 0 ,0 d! dA P! h0`! 0h l! p! t  KK!h!0x1 P 0@ 0 $7 ,0S ,$8hA `L0X S! 20A Tp1 T T&T80BPPd `Rl! 00 4L!lA0@Lp d1t 1R2\1  x0s h`V  `=K/=KX X$`P@ld\d0x a0`V`!\T GOK\ `1QKd =K;PP :D1ROK@姢PP HD1@ H0bT!S0!P|1 0U*0S S0t1  Q @tA 8 H T|1  @ 0 PU:~hA0S`LA R0p0l0x!h0XA00dMKx XxQL0 0P>PL0 x0 pĂ0 4ȌD \p@3 (K 4 t\- KK A?(KA/(@K0K0000h0 St! :MK #PP l1S pAl@D 0pA T0l HH A?( K K?K 0 48<S@1SX `H a0C@\1`p 1HF,`$`D2 (@K 0Kt!MK4t HѢr`/=KQ@0R@@0@ T` SbV~KA_x0 s@041 14 (@KV 3 V) (K00000h!0S:MKb#PP @ 0l1S pA@DpA Tl1 `Vڪ @0@ MK 0(@KKK,02%0(KKK,0Al z @Tk Tt  Tfl  Tc T TT  T\L  TYT< TT4 TQg8:gHO;H: gggpggPgg  8j  8 c 08V 0-LM0 PR 000@0T  R00`0X @ c #  0 00 -LMPpd 80@0CSBXP0X`\P | | 0 D0400sO@פ# 0R00`X  l"0  PP0  X|0sH<X@VL;=L: 0-0L@Pt 0@MU 0"P  0 0.$M0d::|U;\: 0-LM 0Px @ 40"00  B00R|T(tT(tT(@T(`T(tT(|T(T(0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QL M,  Q :Q{ Q 000 0` V"@ LEPP $1 010 1   @0 p0bV0p^"@+E0$0/$ R 1 0+10 ,p(p `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 !0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S z(z({({(,{({(z(z(00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P@= - @LM )h%,e( -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  PP11 0AP PP0P0@0@0a!R0 0! Ro> 7 _ 0 X0\0 AA= A=A=A=x:A=|g: -LM@1SA(PY0Z0J0@(@`  p(@000 (0Y%X00` q l0R0 000  0@AV@ @@ p `F0V A=( p-P0LM`%QU @ 60@1ph鷀pA= 0-L׀,0P@T @T0h飀g -L`ÀpQ,H0PU ,0SPUh銀@AD|g p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`PP $ 0`S00@ ph @ A=gg,: p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phO ]@ A=ggD: p-LMP58";502 0("(2 0`$Bx8?kĿ~{ R0 10  0 PA A R0000 0 0SI 5 P 0S0C 0= PQ vQ0% 0S0C 0% %01 $0@T 0 R 01DQ@T&=phy2 2< R@0@ <0@0 < @0 (0(8(@(`E=gthgA=|gg -PLQp` 0@S` TV@0@S0 0C0` o000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@p[@~-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T [0S  @TPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S A=gfff, ,00S0 000A=g Q00 00C0g -LM܀`0 V$0  % P"0 @PPPTU 4pK  9 P`PU@00T00S$0 S $'ggA=X: -LM0@S  P, m% 00ahi%(=Q 000 p-0LM`PV @T 0  R @T`Vp P 5 0S 0 S Ppg p-0LM`PV 5 @T 0 R @T`Vp0S Ppg -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  &P  P 00 P$0  Q 0 gA=A=A=H0Q P 0 RPQg -pL W`4 @T 0S @T XR 5 P Q P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   {/( 0-5P0L5~ @T k@TQ 0 S01 10C1Em0h9 -LM5@05~9h -LM@9 h 0-@PTL @mT00000 p-LM`|p0P@T %5R0C @T{|80ph#(50S g= 0-@0L@PT (P @T00g -LtMXPTU, `@ 47U ,7U  70SP6U ,0 S ,%Pp 6%U p ?6Ul 6Uw c6U- x6U \ p  0  0,~5 |@]{-0P0`0 &P%   %q< 00\5   {@{{@{ 40SPr0S  Pc$5ATQ PUN 0SK0HX0S ;S SK@r w qn {5L@K05 P3K5 053KV{ @TR 0S 0S @TFd#S SS@ 83UN 4,3U $3U$vPPK0K@ Z P @@ " @ \@\P0S  \0S `2U\2 UP@P P .P A1U1U/*1U 1U" 1U!1U1D X`00l1U `1U X1U@K@  0K@ \01U 1U0U 0Ul$^0Uf0XUPO=L#Hgi$ii$zi h:FixIi i i i qϖA=i$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,#P0pD1XU.LK(   0S7 U@` 0S<Kc$ PU Z 00pZ@ PETUXUP0 0eP  0  p<Kr  P PE p ggp: -LM@Q 0 S01 10C1Dj 0-@ L,>PP 0 80 $000 $0(0P0g -LM0`SMPU  P7 PU  PP5  Pp+ 0@T  P& $@TP@ 000@00 pp  0P tq T0P/S0P9Sg p-LM@`TP X P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0 pP R000 0 0  g -LMȀ 0R$0 0@T 00@T$0 S |$"@`TP 4pKV`FK  ' PP@Tgx: -1LM@ T$ P  P $@T$0 S $W"T  R0 @T 00@T@`TP 4pKV`F  ( XPP@Tgg: 0-P0L@PT  P $@T0T 000g 0-`0L@PT g P $@T0T  0P"0g -LM0@S SL  PT(  P h0S꼍9 0-T1L0MLQ@ T  8' P< $@T(@K 0 (0K'K/P@ <P$%P@D@K  /P@ <P %P@0 S X!0 T @T @zTgg:\9: -L$M@0Q0  %2 800S80 0 S hW!<55P2K4 K 800CS80ʴ5<55 g:i -QM 0P P -Ѝ0 ЍP0  Ѝ -L$MPA`AVDP HP @ p2P Z g@S 40 40 \0S @40  TQ 3 R*TAP@P@0 R񟗿ꀩ(ة(X(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة(ة((ة(ة(ة(ة(ة(ة((4PK  @0P]P 1  5 sH0S02K H@ 0 1^  80S $00cN  gZE 1000@*K   D0 S<Kr Q@v!1`R001S00 000!005  !P v  g 10 1v77PF S 0 B0 0   0h0h$0C0C!0{gH @0@4PK b @BK@04PK  PP02Ky (7/P@0<K0D0 @0 @D (@0 '(\@PAP 40 @(P80@0Cp80Pؒgʚ;: -QLM`p@& % 0$   R \ 0S  R\  Pq 0 P11<<1000 |000|0 "48<#X 5 3U  UO 3U00SF0SA0S> l3R: R1 00C B 0 !  80S$00c  wf@T 1000  S0 0C 0 0d0d$0C0Cb^h i fl2  T2 P`u0pS! vu,Ru 0`R 000S@0@0@0iau000e0S,000 0PP0 u1U! |1Ul`1 $ 庹H1 P``u0pS 3u,Q000 0PP0 fu5i^50 ' 咹0 P`8u0pS  uP000 0PP0 >ur P ki9e`gA= i ig5݆th`E=@-@@:@0\#" 00  @Z00De$A= 0-r/0L@P0S0 Y 0X \ZP@Y 0r 01<0 0h00@0  8000E  /s? 0( -LM!@R \0700!R\@-@ *,  0!\ "0! ": 9@-^p`*#!^ ",!1 #: X 9H 9 0-0LSP@/ S /0 =  9 0S0S 0S0S0S 3000  00 00l  d0ST  L 0^ 0 000  0 AA=GA=5A=;A= -LM@pt@,`K4K P@I,0[ 40[A sT  0S  @PP0 00s7 LP@    00 p1 0S!00.A 101s4 s7 s -LM@s@,`K4pK 9P@A.T % K0S  @BPP00CS0 ks R0700 10C1[s4WsSs -@LMhPA= -LMpds`P0S@0 r01 0sTr 0%  0(50 \0%0 0 0 WPX0Z Y@t0 <y0@ꐪg:ȁ((g -40LM @P0 0g -LMpP`@y <P 5mTP 4 10SZp00p0  QM QAB`r 0R1000T!Sp0p00p0601 @`r0S rh0| 0h0  | r000 @@ r000c |r7 (t4b/`@b40 3A0 2th i i:g:Q0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i ̹(i -  0@  -@L`p  PP @  0` pP0 _2: p-RLM`@PPU@p 0-L P@\p 0  30P \ 0 ~P%2 :H: -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ s0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  K@ 0S 1 \1ShA= -LM 0 -LM@ P`P, 0  xSPc0JSTU00U0S X00X0S40  ([- PpA X1  Π L0Ap,0HDL (P$P` ( 0$ ( 8D ( P0380 0< (8 00 S 80S <0S Pl0  )P04 | 8 80,0@00 oꫪC= P0- L @T 0S $0PS 0,0PPP 0R PR* q  000 PH0 -!40 00 p-LM`0@PT@!T 0 S 00 0 0 0d0 00dS00 0p  00 0 p-LM@PTP` 0S0S|2 v0Sp 0P*S~ 0Su |Rk <2R` 0SJl0SGVB VV  2R V6 V1  0V P|00pV p0S p}z 00RpD <00 CD<A@1R V00|0SP0S K0S 0  pq0VV0 DP |0( 0C&0BS0#< q c0#22c !kpC=B p-LM@PT00P``V,0Q#8Q<QQ([-$`pd0( !$D ( $$ ( $$ ( $p -@P0T@!TL0dp` 00 S    0 00  0-D$ <0P0 4 PCD@L<A|D 0x0 00 0@Pt X0dPTPlP`P0C=G-$d A?L0CR0`@0ltAp0PppP00S M,0 8, .!0S 00Q^Ѝ0 S0R 0R 0RP 0R 0R 0R 0R 0R 0R  0R 0R U: 0e,c0 \CRPEڈ0Rh00S0 p-LM$Pl@40d 0a`SRQ` v`F $00A?C0CR$*0S d00l  !l00Sl0 d00 P @0L<#0@0l0 S0 Rp0 &h0d TD< e0eed h0T 0rSe \80 0rSe \` 0-L@p0p`l0RSSd0 @ 0PL 1#0,< @00`8 `@0< 0Vdz $0dA?C f0CRs0S dXX l0R X0RWh B al x0X `Pl :R80@X0d0 d 0@P L2#0< ,@00` 80`@ 6< 0X00CSX0d00d0^ Td P00 `0d0T0L0 Rd 0 0d X0@0P L2#0@000 )l0d 0C l0d X l0SW S^Td P00 `0Ud0T00 R  -L@pl0SSSd0 @ 0PL 1#0,< @00p8 p@0< 0X h0PW\0p XP x0R*$0dA?C g0CR0S 0dXX l0R X0R0S R} p RX0S,`0Sl00C ` dl000 0 SP Td P00 `0d0T0d0l 0 Bd0l 0S\l0 a0 BA`C}l0  Bp0 0Cl p0d0PUdP0 @ 0PL<#< ,0@00p8 p@0< 0p0CQpd 0 XX0d `O Td P00 `0d0T0G0 Rh0 0c S}XP{dy l0SZ S2`0STd P00 ` 0fd0T0"0 R d 000 S 0`0 p-L$MbŸB 1!PPPU  Q 0CA 1Pڨ1PPUQڀaà1#0CP!\1P0PUQ8 K0QP 2[PU02K00Z pP2[PU02K 00\U 2[P02KU00ڔU 2[P02KU00X\FX`PA0  4PUpPePe 9Ĺe 9PePeXeصe 0-0L PR t0l0d0d ;`0$;X0X 0;T0΅&MK(˅0h Dصe 9 9 9 0 R0&=  R0ZL0  R0Z000 00$0$  0t G-0P 0T@T`0 .T0T{X˓ 1 Q:0 R@0T1 Q:L0 R ,00@ TT0THPG-0M  @ 0"00\0Z01T+!0PUE1T P0`1 \ P @ڏUZ0 d`H0 RL0 R 0 0A000J0CZ0X 蠟0P NT;PE! S`P\Ѝ0@ S c0 !! 0l0000PnL0 La0 0! R $00" 4 L6  -L$Mp@`K 0R0(P00"Ƞ@TQ0 @RT000 -L M, 0,  pt"t2pŸ Q0 `@00 PR 1 0R00!0` Tk`0 VŸ 0SW,00!0?`V `FV0Q⨑P 0Xk!T0C 0X l0X0CC!1TkTD!0 0000 Q0PP X[ 0PSX˔0,0C!T˂0.0 oQꔐ`唠0 Q1ҵ> 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 0000 9 -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   vPe 9PePe 9Ĺe- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP h#) P-L@p 0S `P 0S$((8(((((p((X(Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 0:::B:: 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ q()))))@))P) )U XU 0uPUP H@0 0R)8)))PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! T0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 :4:hC= 9T:p: 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000:: -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@0 9d 9::9\9 00a0C=D= p-LMP`P@ $ #P `!Vp@g) -L M<0S 0 0 4L PT# -L MQ, `Pp@V 0T0V00S P00C0 Ptp00C000C0FV2D1 R p(@0T0V00S W1S000 S0000 0   "I0@00F p,  0FXP0@0 oF@ @ggD=g --L|M 0,  `PSp` `  ) 0S 1% @KT0 TF 0p0 0@d8 R3ڠ0X0S <8 V 0 a80QGU '7X7 ,0S ,a86PV &~6 P`7p  0 70S0+p0  V W0p@00Y 9@00 04  P0S pPK@V 0 KL0  0R`0 0 S0S 0 SPnP 8&P p0@S񟗎l)Lm)n)n)n)n)n)n)0S K K0Pp R L $ l 800C800D <0500 KKP㔐p80080 00 0 00 D 6SA x | 00 <0S0  0 | @0x 50@0p0  p  % 0K0@P  P@ 2Z`K 04 00L$ 0 0:7p8P@K""0P0KP NK d@ -p&0P /p  P@ 0 pP 0S P 80080Q 0 S00R0#S0Sl SKPp R|PixPa RUZ @ P P 0SD 0S0C 0= @ 00 0 < P20S 4 0 0 4 $L <050@0S 0S0SD0d@T i 0L  L  0 L @J K   K@4 P  ]PP 0S0 xP0S P 0 PEpw ^S\QS M "P@  0 S:P 00 |@7PP7 xgg,D=D= D=@:g@:00 00 0-@PL(00  0 0 $ 0 p-0LM@`,PT*\0 T0#03 P00Sp@ 0B00R@@ 0@-L`SYt)t)`u)hu)p3PWP/U+ @ pp@K1P 0$ 0A0Q0  p5@ T0S0p04C@x$C$ R 1 0 +10 ,(AD0P0CS~)~)))@P0 VD K# V! @!T@,P80K  X8  000hS0:  10 ?A1c0 P DKD0  @  pPxz)gfffg -`LM~ r2si 00e ,0O00pP@0S0PU@ڐA< 1R!   7&!L!L0Sd00d01c-0Q v?1`:!hU 0 (P00?>1e  1E# = S000 0S000 0S000 "=" S000 >S0 00)tD=l:t: -LM@ !qR1 11 h 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 e`:: P P111< 1N P PP1N  -LLMß0qP@ `,0 0 h ^dKh hP,0S5UPUd0[pWTK8zh R2b3c13d0<3 ,0S ,,,dK0  @T@p0d0[W*Ɩ 0  0 0  B0 Ɩ ƖƖ@2 1l0 0Ɩ|rh _U 0pWp p00  t0 P@pp0Wl @ 0Ɩ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0 0Ɩ 0Ɩ 0Ɩl B0l0 0Ɩl 0Ɩl0 0xƖzg:L9 Q00S Q -LM$P8S ySp S p  Wp,0S7 B `<` ` ``VW < @R4p@TP1 R P4D7 S7D4S gV ꤊ)))))))))6<6x 46<P` W@<\Ġ @Tyrpp iS Sppp 0-0 0 7PS007L@Sl)̋))x))))))<0 0XK000 00CS$)8)D)P)\)080000808070:00;0<0<0: -LM7@SC \ ǀ 0 S057A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPd9 -,0LS1P` QY2/A Vy00S\ \g ApVT?>1 g.Q L00E\@Q0?>1 g. 1LQ 1?0@7\@Q $1g> 0@@T@@R0`G 1g> 0@@T@00 0g.S L0100S:9: 0-$7L P|000 R̠0S 000S20S@D0T0d0 `0Q00R0S>S "=" S Rx)D))))D)T 1S1 RP 7S 90 1 SR90 0000  p@-1 @^PT * ^0 0S0:W0 0CR  000 ^00S0 00p00d0bT00 R 0S00 000S00C0 ̫ -LM8@S!08 -L( TL 80 8*191 k$E=D=:ʚ;A= :0:P:p: -L$M 0pS +Pp  @K h3 QH  *?0[@0 S ꠣ)`)h))<K 6K  0V 0D0 D KZL K̒D@Tx7`PP 011$ 01  @@!@ @7UZ 1:)01@]0$0 0 `hV+D0S0    B0cc  0R `) 0L ZPLP (DpH0S 1@0C8#8#$0$ 7@Pb$g7$ R 1 01+00 (0,0 0 R!`80`86 P 7S d80d8 / @X  00 P Pu 7SH 0 0S 6Q6  #C,@ @@)<DX0H ? 0#l0T0 7L@r@P@s804 @ 7S PU00X00S 1S   7@60  00  7S0Ss0P@S ,4 R 666P<7sH30#  3 R   `66O P 4@ >7S 90 1"0L P BT +7S\T80T8P \80\88@ U$ UM0dS5ڈ8'0RA8 R <7Z@ 5 o ⣾ p(0"  0dSڸ1S p8'0Rp80 8  ,@ 0@z0dSڌ8'0RA8 R <7Z 5 h  7S 7ST8 4 0 *0S4@  BS0@ 00@T:4 R 4@0S0P 0 RR <60R007P 6 0@0S <7Z , 4 80 P 0 P2S8@ ꤖggg<|U;H:x:: -L M1PS@ pP`^  "K"[9 S 5 2[ (Td9R 5 ׽[ 9(TxX. 0Sx0|000  B @R0 001S5 006S6؆0܆6⧽( h'5 ᘽ 4(5 Ꮍ ::8:l:: -LM%@: 0S# $ 00;P L9 -LM`4@Kp)0 , 80 C`XW@<#0# <0 Pa T P ,0 S , 8KP76 06  W@T 8K P<!( H8K P00 < \4<# ( <<(@ y0 `s m8K ^P t t0T (@P@TP0PPYpWP@@yg:::P: :,:\::|U;:: -`LMPp @# 60 07ll0X0C4W B  `0R )TS  v353576r0b0s c t0 d0969696l0p0t:70x0#Px00x0<7Wx00x0d 0-@PL F #B0760 8B0 W0CX2535367b0r0c s d0t0696969l00p t00' 0 -:LM:, \@P` :\ :\ j:\: :\ `: ,0S ,x:4P`@\ P6;67S 7S 6  <{# uP 4`6{;6 9P`1p ȠDž \9g> 0  R! 1?0@77 7S7S<7@ l R09Q<79\ 9\ 0=`8ͻP`6@ 108%S84`|z8庻P`t8 R 6j 6 ;g4`6d6 a ;<8\ B08\ (8\T7唻P`N7!S F64`207偻P`;7S8 52`4 & 06  7 S&  X'0o2cH'047\4 #(7\6PP` 7S Pp x0  jPp`6\ 7S<7l7S@$6P`vPp <7P` 0S S Sp 00 0x5P`60SKP 㜐Kp 0HS   0SP`ZpV0CZ) 11C R# r P6<6<M K6`@pG 0Sp@` 7aZZ0'RP W<4 @R\,4\ , 4\ 4\ 4\C6@3PQ><6#500#0053\ 3\.7S >1(q.  0R3\ &t3\ l3\ PpK!  7S y> P KP [OK! k<607P0KP [2\U *2\6 00`8p00P0SZPp2`V70'庺P` ,2\v`Pp 0|S:GK | ᝺`V0|00Pp| 0S*;Pp  0ҹP`PK! P`P0[ SyN@ |P ['OKu 7S'R~ 6 { dc _`<#gii iii:gT9i i ~ti8i i =:i|i|ii !i ii5i i 6i(i i i|i8i| 0-!h71T'X7!1L|\'`7 p1P' QPp'X1 T1Q08!002a V2V( V#!V80B@@,.0pS700 -GT  h0@ x @V V  V  V V Vh  V`  VVP VH Vt))`))D=g:\9 gggpggPgg -LMl'p7@Rl'p7RTPl70l7 0-LP@T 00l0-000-0d 0@T@ 6 0  <7l UhAiN @0<'00lP  -5L`@ 6 6 7) 㓾p003036  037Sr007{ x(t4: p-LM`lP1g> 0l@yT@'0@@R l0S@7S,#6@ # @ 7@S 6 R @6 p{# P @y7P  # -L$M\5 `$  6@#<3( 403vN @R60627PSs PpA 0@S \ S WTPW/  <\l@2100'R <  <7W R & 06 $0S $o?7S6  7SP &0S !0000o6 @$PWp 0 RpPP DpKllA 0  PPDK?> g. 0!LS2 0S2 \\ 'o?>1 g. 1LQ @p \g$:,:H:\:D7<'sX  7S0 p-LMM+T`P0S@0 0 +T p韬@Xg -`LQ0 @P@d&+DFA 02p Sb` 0 S0 0 000 *00 ꤖggg -L`0 @P*@dDFA 02b SpD 0 S0``00`h*ꤖggg 0-P@L 000 00-P@L 00*7 SvL' h7S07XL0h* p-LM`@PUh80 h8p p-LM`@PUh8 0h8 < ##b<7l l p 0-LMHP@0vN K@0 PKB 0S 0gp: p-LM7@SP 0 pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP7<ǐP@ S`` 0SF S p 0PQ Q 7S # CPP ;PS00S)@)`)`) 7SS# #PPP00'R# 00'RPPV 0SpA= -LM@PAAP`p Q2 P 0iSS  0id%!1`R1SP1P0Q10  1 0005   % 10 1%(7: -QLMp`} 001p  80S $00c`  `VW 1000@ p  9P21) ) ݻ~ ٻ #ջ1!S-5 7S  PZ ܯlPl@0*!(0O006S`6f060f50S)!0@00 S 0 B0 0  0f0f$0C0C $E=D=:: -LM`Pp  P? 0iSS;0@S)0&00S!)X))X)P` 00`C20`0E*S=)4))4)4)4)4)4)4)<)4)4)4)4)4)4)4)4)4)4)<)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)<)PX`@ ὸ@㹸@P -L4M, PPi `p pᚸ@~ 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 ,0<(0 0` pt<:|9 0-0@0PLUPP ɹ@0 0-0LPCS  @0200Pᵹ@ 0-0@0 LP᩹@0*00 40 Ƒ R  R     -`LM Vp:"X"@v0PU$ 1 0 q!1j"UV"X"@`U0$0Y"$0S !0 ;00,(Pp 0  l0    `T@9`0W@`0`Y uPY{6 1 Pp @00 㝳<7"`32'R  l0   <6 7<W7`S% 00  l Q00   00  003 R <W `00  p 7#40l` #300lX` #31@r0`0Y/ Y5"P!`Pp 2!$ ! PP!P P!W4  00 M! ((0%!`Pp 1!$ ! PP!P P W DH$H0DS0SP T00R00S Q00P00S00T00  0Q00`P00 \ S @7SP00 㪷T1915r ⷫ ' Pp 0y00'l` BO@ t̠gg::: -LM("x` @_PU$ 1  !0 !1S U0  @0 0K00p @F  B808gg -L`!xU @"PU$ 1  !0 !1 U~ 0 @0 0;00p 808gg -6 pL- dPS @0P0 PP~ `# Qn3"`27S  l0  6004 W@0`0PPl`Q00  0 R 0`0c0 0`00  00P006 7`A= p-LM0PS@ ` 1S 00|0SP0xP0|P0@p0005 }0 0(20p0:D D0D @0@ 0!Z0 0D'7 0!1 H* J)| *) -LM@Q 0 S66 60C6Q 0 S66 60C6 -` V `PULp@0@ 0C^SPUU dV@PLPU<V@(hPPU|:;:: -PL`@pP** *L * nid0 . Q( ]0@!T\TWLOHMV@T,hE  @>T:63 #2 ⧩(⢩#⛩▩\ ⏩x⊩, ⅩT
D::::::\[;H_;;::D=;::::: -L$M@0 ,  D7s 0 l, W0< , W` R8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0D' 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY, 7S 0S40040 @ -LM 66 600|0 \@  \ L0 R 6 67 6767S6  -Q66 8861LS p-LM GP 1P P .  b \K:82 R  8K0< K;0K  0!LK #1U@K㭡0)T1U   @T 0 R @T1P 00ST 81U K@ㅡ D DK5PKd d  PKT TإD Dӥ5 T TF̥h900YFV@0 X 40QG0 ] M giil:i@ii X: -L$M`, D0 @DPP0000 h H00\^g 0-0PL 5h0HX0@T 0%H h0X  Q <@T%  00000%  0 00%  P0000gp-. P, Q0Q 5Q \ 0 R \H0P X0P 80P ,0 R 00P (0PgE= -L(M 0p(0 ` BP' 0S <P! 0SP tPU 0 S PU 0SU 00 0 C (0 S h($6 ĎPP 0 0 `@T? 0S <@T9 0ST4 @ 0t 0 0R t 00t0tP00 \80K7 K4  H K P  R000  0S0C 0 6 ꉿ6 gg:1i p-L$M`0@0  0P0CS 0   0S 哶p R000  0S0C 0 04( < K+0K 6֎Cg:2i 0-P@0L ᥣ\0 $ P  010::!Q Ƞ Q 0\ Lx0("S*d0"1@ 040\ L(0("S:0" 0$g -LMDB^` 0@P@x מ2" 2 "00`@Z  S` @@ @ 10S!0 0 0 A(P<.$4<,(, 4 "x %< 0! 00 ! R1@(P<4(<"4%<000A(<4,$ T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD嵙1 <1.X0 ,0S ,q0  00 0P  0 0@, T00T0 Tz`gg8:g -L M 0@p@A`0d` 0p0#!dPG0 0d0  0ppg  -LMKdX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`ߝ*xp0 p匝``P PU2P+PG=G=G= 0-LM PP@ 40P00 KPP幵0SL L<@808 fP000-0H=}* 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hJT:<0\ T0L0P0SSP@0H=DH= -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $; 0@P  0pp2D0<0. 10 S gH:gE=`: - 0L RPG=G=lg - LMR 40 S 0 0 }: -(!XL"x H` P o hjU H -LD!!Q#7011A!1 ȠD1 D0A0 x!0hp00 cT1(0000 c( D ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEنHe:e8ee&9ؒgbH=Be`H=De 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0`H=/uؒgDe8e>e@eEن @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V   "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `z R0@00@ ,$00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP`(`崷0V0C0@  P`婷00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P @dDFA 02 S`(1b1 R000S0 0 0! 0 0 0!B W P 0P U  `~`! h00h0V 0S0 0 0 0\!0005 00C0Q Q001P@P00 Y 00S0<0 0 0 0 0 0  00 00 o}gH=gggggg - @LTp ` PQ R000@ ߶0U0C0 R000 0@P@dDFA 02 S`T1b1 R0pp00ph}H=gggg -L`p0S000 R P00C0@ T h@00mP 80S0C8000h`꿭 00 0gggg p-LMt`u0S JpX@00E0Sg00ph<(P000^0Sggg -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@TgH=H=g -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( 㾑|P H 㶑000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0|P, PE0S P yT P 0 0Hm000  R H 0D0 P |P |Tx D XPi4@K L2 [R3[Q0S 10[#0 210K[8K@  310[0S% S 2[0<KA <0 #20[020K@0iPpS20[3 [0Si t d |P. 20[020K20[3 [0SX0L0@ 0|P H  H=`I=dI=gH= p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 嬫P@p0gg p-LM@0`+TP p0D #10Pae\I= p-0LM$0 (K0 (K'K1KᓫPP+ 4 10 S 80S0C80p00 R0`V @T 00 Q @T`V80S0C80p֫;P80S0C80pëg -PLP& %P` 0@10 0 pD00 P?@PE0U :0U0*00\I=`e p-LM` 001PC@ c  0!0e 000e00 000p -LM1P `@,P 0P  l$(00(0oIP 0S8tX  0R $P 80S0C80ß000 00 0 I\3  0#$(,"(DRD #0Pp 0#!DQD#p00C0< 0R 8#0 S0!0# P"(00(0 ",0S$00$0p ,00,0WN APA****************************************`***************|***********P, , 00j1 R lP 40 80S0C80P@ 4"$ " 3T @3@p` PP 40 0S1!< !@ 8 40 c"4 4:10  0:00#$(,"(Q0ձh:0ű8 `8#8#$0$ 0 0P ` ,"4 4Q0x 0u @0Sr 00 0h2x  x XD H0 0H0 !48<#XD {0!<400 @!D0@1#$0$,0 S ? ,0; @0S8 00 0x  x ,Q ,0HB?  CD\00R00S @17 H <  < ,0  H\ 0P@ P00 P0 R@H40J{8C{ 7<0H 0<0 8  @10 006@7<0H 0<0 00 0(gglgg -LMpP 48<`J#8, SV*0S010$ fQM*FHP@ 8 2$020 1  1 T0   00 @ 0 P 00P 0p , 00 "4 408#8#$0$  0 0  0 gglg -LM001pCW`P 0S@ S0 @T@ pdW`0h@C 0@0P -L@RP` p P X P P0CS*꼹**h*h*h*h*h**̹*̹*̹*̹*̹*******`*`*`*`*`*`*`*`*`*`*h*h*h*m  dX*X 0S 0pW Wh000h0Wh00 0h0 00-X 0S 0EpS **(*@*X***********************p***mp0GStpƕWh0h000Wh0h000Wh0h000Wh0h000Wh0h0@0@00GSpƕ0CS5@*******@*************************0S 0&  0媈 *m0 0hp 0pp0p-0  T0 E 0R꨽***Ľ*н*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ؼ*ܽ***mptph0ph00h0#1h03h0#3p -LPpR@W@L QG 2,00S,*0@P 0 ,㽃TQ` Q T`V00V0SQ  Q @fTP 0,SpIV@D`F 00C 0` D63 -LMH`0V,0 P@p 0ES>̿*** *p*T 0S p@T 3R ,0 S ,厚5r@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 @Q   @X4A 0@44 3Pa u3Pa Lt0 0 t0 t07t0u 0R > 0Kt07t0bt00t00S6S}t07t0Rt2 R= ; 0t0 0Ÿ0D"00| @_$2X|0 |P h0  HP0  L@ 10SF   @L@ d0!t0` 0 0A S  0bSQ0\0S 0R @ 000 S @1 0P000 0 ?0P!U &0Pa U ꔿhg@: I=PhI=H2=@hI=@hH?4hXhKJIJ=xhhJ=8h=HhXeXhh h4hI=HhI=hLh80PaU >@0P0l01 c! 0?0 Ŏ PU  0R? @1 0c0cS0006/ Q V10 R ,* 000  6!06 8CR 6S 1'0 1 0 GP!|P$1`嬎0Q0'0 !\@0< <m $!0, 0cS `4 000x"0"?08Nt0`0`S t07t00K )t07t000C0#(3(#0#R?60  000cS0l#LL10T13@_0h 00 0 R000 0 0 &0 07\0O$$lT!00bSLʠ0X0/t$? R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S \  0 0bS ⾍00[>6t S7 10T01t 0c 0 0bS^0 00 & &0$&?08et0`0`S? +t07t0 0K@t07t00!R$ 1'0 10000S00C0 `af 0O&0 0 P7bt7t'|'R? R =X 70 S\ L!p00bS P0Q0R00S 0S T@0S\ X10cSL0T1p L!Հ`Vw 00cS0nS 1S:6Sht 0R00 l R8 0!R 410cSb l 8 X  |P h0  HP2@t 0h!0bS5t0`1 S`500 1R 40 ;0S m -)0?0 p❌ a 0RpQ lT@L\X a0lS0VBX: d  0000|  @_X| 0 |P h0  HP40 ' ^L@ 0St<; R  0t00p+t0t   0L@}9 a+0 ?08HPKd`K*w'w\ \  D 0@ @KG0KH@K{0\K 4Kd@KcK}{K0 &Q Qw ! 0 S- 00 %0 S   0P p  DX Ta( 101  g R =@T2 0R #3Rʌ tK 0P P P  vP1010 S010101P 0 ( z z0} z0H0KGK D d0KKcK0`0 K]> P   0R00 R PD1010 d0M  00 0~  04 `p0t0 0<4(<"4! r 0 Q1 !0npP\0 tp z Zt S2\ Z h hXZ0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R8=!,=xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00 0S J? dh `Xt ɃXh  r X00R00S0,h00h0 0!0bSHD0OD@ ВPp 2 02$0  1 W' ˟h00SW ` 0 h  h00c<  80S Xژ\ 0P \ 0Sy h0| 0x0S ox 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$Q,!$#, 4 T0x#^7^9ɟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S8ȟ 40!0000@ 0R x(0?0 Q400t1SV uSS `Q-d1l\d@00@0tp 00 0tpZ1 0cS0Xt0 tP=x,0 S ,匁0t0E7Q ` (R `02SAS6S@7`pópt0`7~|7 1!"4 40| l t00| m0&00 |@S;0 0H @` S!@( B"40 0l 0|i| 00H <0 Ga ~FZ 1 0cS!S 0d0 0 8#8#$(,"8S`PKdK(0D@XK0;808( 1gh:4J==H=:FrH=?+Lh -@Lt0`0p h, N? , O?Ɍ LQUP1 Q 0r0+0r0P0,H0l <^*40  ^:00000Yꔿh:J=DhhJ= p-L M@t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08uphp<00<<0 ꔿh@hJ=Hh=U 0 Q  0oI 0o딿hI==E: -L M`@pP, 0 S_ UD 0 R R/ ,  07 0V, V ,k W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 0W 0 W* 70t0 0.V 6 P k p-LM0PS T0S0 FP@|ṿP@ p`HP Fh0 00t1@000@070plJ=pJ=Lh 0-6| SL@@Pڲ0 0S LL P@70y@ -LM6@S T+T+T+T+T+T+06@T 6S|0@6P S000 0όs060=@h -LM⬒X`, P P0SR9 Q㍯K"!: /VP@/D2(K0S S| K 0P@t 0KMK}P@l1X ( K0SZ SM X W DP @0  @XR,0 S x,u5W @ 0  000 @ 040 X9/ )W040 00 0(K 0 S S W`x@X , 8 0cZ S 0 B0 0  0e0e$0C0C0L϶(0S9@sJ=hhMЍ -LM QP`@p 0Q0T00SQj+|k+k+m+k+m+pl+l+Lm+m+?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l oM ,{@0 SP,0 M,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -LM@ , F, p `b b$,0  O 4 P'e eTP hP!?!0@?PP@ eiv@@Pn p@t?0S:@Pk?0S: -Lp M0`,0 @4K  b!;@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,RTg:D9: -@LMT $ @@(; 0 E9G-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(ЍD9 -RLMp+ >?A @` R,: (, "?,!P`(` pl?W `\ @pG0@?W@W( ?0@(>0@ -PLM, pX 0 @0KP9H0@ G9G-^MtP N `p (08 aqQ N 1^nA~00Q``ap P0@#L40@ p P`P1LAPL!(|#9$I0@,p0@(,Ǡp LpP1 ) GĀLq{7, p%d\pP!`" p`LDP刁 4$p P`΍p'(  @ 0  p ~  0 pll1 /!? 0.,p.pp 0 @ @* ~  )0#@$ࠀlpp1 ",Alq娀| ΍p#1h p  pPP!`"0N @.p lq夀Cp$3p~Ⰰ΍ P%`&0 @ p! " P`>- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍ4E9 -RLM`pG @>0A! c RX:P ;!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP D;!0@ R:@0S*H0P@ P*;!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~<6,p00@ ,oA,0l P+6 Ppl&6, PP,`pPP60P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o5 -@LMT@ , .:P5H0@ G9 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,ox5A-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 i74H9H0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 |X9|\9|`9|d9G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`|`9|d9|X9|\9G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y N, , , ,T, , , ,T, , , ,,000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y 'L,,,,8,,,,,,,,,  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A!P GPe xK=UUUUK=|9P -L M@|q@*) *))* )**)333 *))* )*`)0PK@ဠ*) 0 , V   0,0 )*))$* )*x*!)*))(* )*T*"))0)$) ), **$ **, UUUU3333 -L MQ00 Sp`9 5p4 0\ * @ 0 R,0\@:w`VY w 0!(K₂p 0 P` ,00 @0004ڐ4֐0 V Z  01 R Qw 0!"0P pQVA <   $ (P @0  pꨫg| -LM0`=$0S㼑G<0S @P@dDFA@04 Spx1d1 R0``00`ɈL @@dPDFA@04 Spʄ1dA R<0 <000<0 <ᤈ<L ꔠ匐@@dP忈DFA@04 Spʄ1dXA R$0 $000$0 $~$L ꨖggg -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dNVPHH::,:D: -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dVPiHfH`:|:::Q@-@  P 0 0RQJ PQ00P00S 0@1  -LMR`@p/Q,P  U$010^c^PT UP 0  nT 1@bPTH G:::<: -LDM,ȟh h`, d Pl Pp@Zd l`  0p  <K }d 0Z d <0K 1 0 l `q0V  0P 3 "R @+ RTd 00 R0 0#0Qh`0l 0`0  `eV00 Q030"S@VL5 ,0S <,0< KY\K<K h0Q0 0#0Q 0gCPQ0!0@Q0a005:c0PQ0C00",@0("@cP径DFA@04 S`1d1 R ,0, 0,  00,  }l, Ew,0  vl!,@0d!@cP卄DFA@04 S`41d1 R ,0, 0,  00,  Ll,rlln, KL 0>v?l `.| @T Tl  Td  T T TL  TD  T T4 T, T갩gggg gggpggPgg -QPLMPe u R̥ ĥ0X* 1S X:0S 0= 0X9 0UaA ` @R  @5 # ҃P a00CS,Xt,t,t,t,t,t,v,v,v,w,w,t,w,$x,,x,P 060#0 ?.P ?.&"(  ?.!@ b("(L0/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pm7@r~1 0 ?.! 0 ?.&"( 0\qXATql @V0P  q 10A q(q&q$Al :00l 1P`d@ 0P@0`  !l0 S00vM=M=g M=0M=TM=xM=M=PN=L=L=lN=N=N=O=M=0O=LO=hO=,N=N=N=N=M= - 2LM P0S 1SPC ̑` !00CS4z,4z,4z,4z,4z,H{,H{,H{,z,z,4z,Dz,8{,8{,Dz,4z,Dz,H{,H{,H{,4z,0 S%D1P@Z@dDFA 02 Sp1b1 R0``00`0aVl>@PP l-l'P @PP lM=M=ggg -PLMPe $QY 0SV 1p WW*l0!R000`Q 0AT; 0 S @T4 0ST/ 00CS*|,|,|,|,|,0},0},0},0},0},|,(},0},0},},|,(},0},0},0},|,  0P4`V 0 eP0 000 M=M= 0-L`M@0lPKSX0th h0 h d ` \ X T P L H D 8 4 @  0 , $ n0AM={,s,hy,t: 0 0 -@LpXp`P0l S000 %0S g -L`0@ 0@bP*DFA 02p Sbl` 0 S0 0 000 00ꤖggg -ML0 A -ML,04 -@LPp`0l S00 0 ᱀Bk0S d0S]P"ꐪg -L`0@ 0@bP婀DFA 02p Sbl` 0 S0 0 000 g00ꤖggg  / -LM@px\`P0l S000 F0("( pgH -L`0@ 0@bPNDFA 02p Sbld 0 S0 0 000  002Hggg  0 -LM@pX`P0l S000 u hXg -L`d0@ 0@bPDFA 02p Sbl` 0 S0 0 000 00ꤖggg   -@LpT`P0l S00(0 (Yg -LM 們倡p`1S,` V(0@@cPDFA 02 S`ʂ1bQ R0 0000 L00lq0 A@bPdDFA 02 Sblp 0 S00!!  0  0!  0Dꨖggg  -LM@p/t`P0l S00z0 ~z!i0Syꐪg -zL`u0@ 0@bPDFA 02p Sbl` 0 S0 0 000 ~00ꤖggg -LM@ @h; p-LM`0@0  0A00 Q,PK 00 0#0Q 0S N(pg|: -RLMPḀ`0p!ژ~0@S0 0Al0 e~A@! B*0\0C  Q00ꐪg -AL`0@ 0@bP_~DFA 02p Sbl` 0 S0 0 000 ~00Cꤖggg (-"(L/ (-"(L (-"(Lm (-"(L (-"(L (-"(LK0 0  -LMXK@p 00  `b0K`V Z8(ZX@ 80 4 0 Tp  WW W(W80B@@}0PS0 00 }0S0p 0 C 0ZL0 H  8 P70QZ P.T0SH H RXR$ WuWk Wf'W80B@@}0`S E 000P m}E 0S L0 E0 00E P pHp 0R0- ` F0 @&@cPv}DFA 02p SblƟ 0 S0FF  00 0 F 0 F  `/}F 0SZ 1 0F Jl E &@W W% W% W W W% W% WW%W%W}D Q Q Q\%Q80B@@}0PS000 | 0S| Z 0`00 0SE 0q0G XI0G 0G 0 00G @$0P@c|DFA 02 S)ʂ1b\ RpGpG 0 00 01C 0C  |0K!b`↠K0!R 0 0pG l G  { G000t @0l#@cP|DFA 02 Sʂ1b< RpGpG 0 00 01C 0C N|pG ls k l Z"80B@QI  R"80B QAt"80B Q<  R  RP"80B Q2@"80B Q- R$"80BQ%"80BQ  z!0  el L!@W= W! W8x! W5 W W`! W.X! W+WH!W&@!W#A T,T" T T80BPP{0`S0 00 {0Sb 0@ 0 l G @T Tx  Tp  T T TX  TP  TT@ T8 T,,gO=ggg gggpggPggO=l l -LMPp`@0@@T@000` 0@0T000@-@T`pP*000  000000 !@T: p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q $pg:  0 00 -LM @00`XpW PU (<0L1`0/1"b0bS5T 0 +P:$0WpW6 0iP 0 R h00h0 00pŏP@0000 0*PT@ H0*;<;0 SQ4,::: -LM ^00 , 4 `@^ p (<0H4`0/1"b0bS 0 R0011(pX R /,@K00@P@000lT<0  0*P@8  00P4P 6 0 R h00h0 040@_00 0Q0 ,d0X 3@_RX00S U:,<00<00, H0  ,0 0^$0 YR Rw<0PS( 0"?A3cP@ Ÿ8 0P@0 oP1 0 R' < Ġ /0 0\0 d0, 3X O,Ð,<00<00, 0H. ,0 0Q <h04h0T `P5 @0  ::@,P 40S 0)'0,0 0|;xd<0(0CD0/"b\0P000 0,:$MQ:4,::::,:H:x: -LM  00 $5S% `dp X0P00C 0 @_0  a0X00 XY X`K0K 5"PK0K -"P0S `0( 0 P0pS 0!0 Su@UPŸ 0PY pW!` 0W `p80 W`0(0Y4 a0S- %0T0S" p W`d 1X0S0 M d03!OX p80 W`媍姍a000Q 0 T0(0Y/+ 00@`K/P @P0H00 y@A 00K/P P0 @D`HX <,O=0 RO= -L M0p00 00 P0, S j V@ 0,T@#  V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 9S8 0Sh0 0S 0Sh0Po0`0 `9 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S P 0S``l0P0S 0Sl0P0s  0S0l0P0pll00Sl0  ,0`@ 0P*8D8L#0S0__@Lꔶ,:::::: -LM P@,` 0  4  0<  D D@/">C2"/P!008BS@ C 4p?#@W8 40$tDCY8 ,0 <  004,  ` T@, P@1@#W< P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp飺,@% PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@p P 1PBt0 0Z 8 0 T 1P- @ `,@ ` VP3"0 SPPP#0 SP8 0 `80 -LMPp  P,P ,@`VPUPa 0 P` ,@V,0| `VP 0 PP`,0UPV -L$M P@P`4  T 0cSP 8 \0 B0C0 R0 0 0 !d0 @0,@K/@厊P@,H"H`Q@ 8  3S 2 0O  T ZBT< !8?\>`0 0/ ?> 00cR#p@[ T80@0aX`!8?\>`0 0/ ?> 00c0R#l @T<TZ!D!400C40 h!40040T0ZCT$@ ?Q>`0 0?>0 0c$0@0C$0 P B 4 T 00C 0 @ 00,岊 ,,RU ؒg -LM PP 4 pP0 00W 0 0 !d0 0/,@K@ΉPl,"H`0S 3S NJY00W "0O00W T08 WsW@!40 S@TTA 0 0P7^!?Q>`0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400,哊$,Y,^ 0 ,? 0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040,Љ0 ,U ؒg -LMH2@Q`0o`T p P  0Pc (@80 P(W`@ZD 3 000C0 P B 00C0\%@1R6 |0P  t @P 0 j 0` f PEz 0 RX0  200000C0 0 RT000T00C000 0哢 800c@9 ` Z"P U T -LM `Tp 1S0 0 !d0 0/,@K@fP, 8 80"H@0S 3S 8\h$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000  P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  P80PU,080 , 8 8堈80``0P,080 3U (: -LM `pP@4 PP00 0 0 !d0 @0/,@K@帇P, ,划H Z8  3 S  0S P2 U0O@ @=P> Z!\000/ > 00cR#< 018 a^ Ϡ\0.QA00/ P  p1@R\0/ PPJ @1 Z\0`000?0Q0P PP1420.Z\0!00> 00c# 00 0C 0  P B 40 P00C0 ,؇0W U0 00 P 2 020 03U ؒg0:H:l:: -LM p`0PR 0O0  0328T 0A0U2Sʼ@0 $0X: p3 0hş R00p  L0200 00 !d0 0/,@K@廆P,,$HZ 3S 4 0O I00U 80A040 ?80 d448Z`0.!48000?.a 0 bS1P4 0< \ T0USZ% #@?T>`0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0 2 `R4 `0RA 4 P00,͆$08 0a$08P×n 0 0n 00000 P 000\%1R |04@P@P0 0` PEl1 RX0  2000000 ,1 RT000T000 020` Z`0PB D P! 0 R`0   0M000 P 0 000\%L0R|0Pk0 (l2(::: ::U ؒgT:<:\: -LM Pp,0 Wy*0 0 !d0 0,@K/@SP@, ,!H`X4  3S I`1 0O 414AQ\000?00p S28 - 08X\000/ 0100 0W0p50 0 0  P 0 P00 ,庅00C0 P B 20C 20< 1=S0 00U ؒg|::: -RLM`, p{ @}?Q1 Q`000.,0Ae8崁/.  b  B020!Pp1 @R, `08P/.  b  B020!P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` R1X 0, 0@ H18,0, @/>QU O=|99:;(;H;G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 t;00 85 0 00 0 @ R@  PU00\pP@ l` VV V 0 4R@_ 0S}:0Sy:0 @T00 T00S:  Rʴp0(`VP@Pa P@P  0S:0S: 0S @ P00/PeP PbV; 8%0@@0L 0`@V PU  /0PAPP (0 P0@ xK P`@ PP 0x0(     0S:60S3*@5L 0`(0 @ xK 0bPP \ 0/PP忄 0d x0X2O 0<H @0@P0`|0Kd KPPP | 0` B| 1X`tKV P >   pd G 00/@K@巂PPR`G|0H Qa V p0S @00xK  PP6x`` d G 00/PPY d0X3O0 00 H<[0dK@P @܂PP ?Q00Sa 0 B  Ȃd tKPR0s @0 0t@K T` *0 :00T`:Q00 V0  0۷OD 0 h00dh0   R0qd0G 00/@K@P @`0KH i嶂 0 W  4VD@P`K0! 0 @ 00 xK DPP} x`\` @00/PP垃 d03XO0 0 P0`@K!a XjU0<H0@P곂 \J  @00/@K@垁PP90 05P00/[ d0X3O 0 ,@ 00xK  PPx`Xt` 00/PP: d0X3O pK H<=0@PPP` 01X` X0 0  (0 xK00 @  @PP[P @@000x1( P U  僁  S>00K L0 R-PK ?@K 00 KKK K0P00@f0S:0] ^,,gd;;- M Ѝ -LM`< Tp$ 80  000    0 08 00R00S 0K  0 R 0V 000O 0 R V0D  0 R 0W( 000O 0 R} W0  @ \0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RG `p 0 0 0 0$@x`0d CB_00 4@K@DP@@0Q+x40 H }8P < T0$ @ 4ڀ4冀4%,5Sʴ0 70W0   W 0000qV0]V 0000NT; -LNKgMTQ`U@|a &8 0BRS p 0S XQ0S R mPP >K ᔗp`,0<4 DP 0 pSlq  0~K0``T\OX!QKlQTa45S:05XqS*NK P aS?K P0` 0PP 0 R 0^K000nK F q L000  0L\0K0K 'lX850p1  0 R 0~K0l^K000P `P?~K@ 00@.K@`Klq8Kt 0KPSo`t0崀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Sjt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pմ000  0PRoK p 0S㴀1( ? 0p0 0 S0p (0P UP@K p 0S㴀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  ΚXK@ 0 l`PtS/ PKt0 p0QO0@H K㴀t 0S t.Ka00h1dA0e@K 0 RYtPt Z\@ 0T PQ 0SG 1p0.Kh1dA0PE\!0OT`aS\\6 0S `a.K1p0h1dA0) \QUlQ0 0S ^K000\aVBlQ0QT @aT pմlq^KT0`Q3/nK h |a p崀d|a 0S ^K000 0 R |qg /0 00| 0 |ah00fh0K0`q WNKlP Z p 0 S# 0S:0S*la LS>R-`0 .K a0000Q관 0S:0 K0w`a VjNKlP  0S" 0S:Z0SW*la LS>R-`0 .K a00D00Q= 0S:0 5`^K1( 0O& 0S!0(0 1p0p` U pl P01R/0 0S:0S :l0@h  &| pഀ| lKS>0 lAL R-NK ?  K00@관 0S:0 1( nK0O`!SlQ~Kd @FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l1h0 |AxQ p崀@|A c0t 1X t^K1X a0OPXqW0K0 ta0R00X0  p崀0^K000>l>KP @@A NKPp` S?K 0P0 PP 0 RY 0^K000Wl0@ 80S L1pqHg8L~ L|L?} VlP  p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@관 0S:0 0.K00.K0MT 0( S/& 0S :0S:(0Sh0S 0S 0(pS  : 0 R 0 0f00` 0S:0 0TaS鴀Xq0S0TSd'g; -L4M0 4 0L P P80  \ @ D t0@D@T D 8Y D^00@p40/0DH@ ^}< 00 m3 ,00,0<0 <80&Q0 <0OX d<IPP80<sH/ 0@ TT Tl#T80BPPf`Q@ 00 f<0 H@t0@T !t0@TT0$ @<{PPP @t D0@B4  T0cpa@DVWD Tp8 RQDaV2@Q( L2L"@P@dfDFA 02 S`1b1 R0@ @ @00GfL0P@j< 00:00{d 0,KC" 00#PPP,0LP L  0R0d ",K P0P0LP0 ,0PL L0H0 00L0 <{v @ V @TG T  TB  T? T Tp  T8h  T5TX T0P T-<{ `0.&ggggg gggpggPgg; -LM @0KPP0 K 80 h P 0 5R/; 0S&:0S":000,@K 0/ @PzP@8 R,854H 0 80, ,A{ LRS>-0`pǏ00 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠO=|99800CS,,,,,,,,0S0 #Q00 #LQ0 R0S800CSd,,X,,X,X,X,X,000 10B0  2 R0  00800CS, ,,<,,,,,000 10B0  2 R0  00800CS,,,,,,,,0S1 S20#B1  0S 00 -L$; -h1LM`Q`!00pP@<1S΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T0#PD P DPDLDP ,"D ,L$DP*!OPDx$!PWX00 9004X 3uX040 ]ghd9TTH; ;p;\;E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M$0Qp `; P@ҍ X00#00* PP@р L(|  0 0Q 夨@匊P  $0ԑ:$0  -$0L Ppԁ  P@`@0 S@`V P@P @ 0 0 @  -p`P\LP0d -40( 8$@<( 2@`@, T0C0,0VZ  rZ nMBl j D T; p-LM80@SP0 0hl0S  I`V p  0夨0S0 y݉ -LMa@@ -RPp =SAT8 K8 4P , 0@  8p $0 #=0T00S<K <0PpST 0$ @ 9  0Z0S  p/H@ =S Pp 8 -0:; -LM4 Q8  8 `V4,0K`ß 劇@TpN0h"0 P@00@0, p,002 0P@ ,BT ` 0 0 0$ @x`0d CB_00 0@K@3rP@ ,01s8  d@x 00 H d0s0xt1 4,0KP@A 0S@@l0P0S 0S1 P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʴ 0p00t0 0S0l0P0l,唈80080`(h`h;O=h,h$hT@-@1T0, T:F@ 0000 0S00l0P00 -LMP, 40@E0 PPp#800 S40 g0@d0/0;s H`,QD Qr80p W0\'d0T   cM0 h0s`00h HL5H sP5,5S,>QS. "r0q0P0 SHŒp011pGWq00P000 ؒg p-L Mp@P0Td``  pH@`R< 80`@Iph et.=`h;;h@-QM@ 00CS ---- P0 Ѝ@-@Ѝ $  R=$R=O=O= -LlM< D 0@ P0 @H@  45R 05RDPP @D,@ 0S @P0  0S@P@0000`PU`V6P H0P p0@KX@@ Hl Pt H0p D@H08%0p L0 cZ! 0OTS00Kt x l@x 0S 0SJ0SG3 R: lP@ 0$S00 ,K<  wP@%@P$0,@0 c YY HL  D P@,(qD,@ 0S}P@000q,@@ $0 S$0 ,@K<  0@o0S00Sp4@K8 8K,@K<  0 @p40 S0PK@0t x gl x 0S 0S:0S*H@l0L S>0R-0K0`@K` ? Kh00 0S:0 0SZ0V  WDHP t -@  l 0S1 @@0S:0S*H H@S>0R-LPK ?`@K 0H0` 00p0 0PK0H00p P K 0`0@0 0S:0 @ H@ @0l P@t@ BU? R= -L\M0 08  4 00PL 0UT0 p4@80S S T8l  8 0l R0000  0S6d |6X 0S 0lS00S 0 Sl 0< S%4%R:05S:8408 0P0R00S T@ l  R:0S* X 0SD 0@K0T`\ ^P <0l P <8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000<L 4, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 P`\0S<@H0 0Sf ,nX00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^V T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 jw,n,*n,0H Hr< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP姕P@@T0( R)0[*0[S""[0R0 0R@ R T{@00T@ K0P@ @P T @PA{V@..;- -LM@ KP 0 0 0-@DP L@P00 4 0 0 -( L0S 00&e 0-LMP@ KP  0S 0Sl0P0S zF0000 0- D0@L PP0s|03= p-LMP0 @B 0  P 0sc 000Hp @_ 0S0( 0p00z0@8@{@p3=0 0S00D d< X R  0S 000 p-L M0@ `Rp K[0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 ؒg -LM`P@2 80SI-I-I-I-I-I-I-I-I-T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0}  -LMp0P$K`家0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KKؒg -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R RP R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P P \0  0:P(q00000(s00 000Pq T0$   0Bu  00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+ 0H1 HQ9 H1L 0RD0R Tp DH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HPqtLnttYD!000@!8PD0 0C0 RD  00C0D!00008Mt0: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u 㲽sKPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp  0 P2r 0r2 ,0S ,m0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000rT1H E 0Pp3TPpMOK 2TP 0GpW y l P109o0 0C000C00000000PqT巑  0S00t00t07gPg;DR=,R= -LMPp@` Vv |0S kqiq00S Bu XqVq iP 0 R00D!d1 1@R#`@ P; j3!0bR0S- PP0S$ P cP@?>1!D , B 0H 0C0,T$0"A , -LM `,劂PBP00  0Ɩ6 ,@K@8SP^,0UH(@ (@>1 1@R#P  e> Aq XP/ 0lQ0 PP.!1E0,0C000*  R0C 0,& 101,S(0Z"p @P;  $ ,S0:,;T;t; -L M Pp``$q0V:  , 6 $@K@RP$0$`H@A?> 1@`R#  0,0 00D 00$Y 4QN4N ؒg -LMp`W l8 0BRSRE P7  K0 W 4V10FƑ& PK 0P    ee ?e M000 0%~N 6P 0&} K 0P   F2e e0eHCO M@0Ɛ& MP@ @4 6#!B0 6(#1D `, 6< 4|K0 @ 4K1S01X40K!@TZ @ T 01@D T( 00 00K(< c|K(< ^K-Wl"0  Ki @ 6 #1 c< 6@34 a B8 00XPU+4K1S @TZ @ Tڴ0!(P@DU T  0\50#0`00000"0(06 @0K&4K"1KN4K1P  S0  0 0 X0VM: 5Q000 0T0(P0OTSU@0S (Q @g -L,MH L 0 40 8 \@8 < @ p Pff&1@P U@ 4X@0 0/ N00d ]D` 3 ,00,00 <80&Q0 0OX  OP@4H\-8F TT TX#T80BPP{7 `R< 00 K78 &<J80&"!h! BC VLLP<@L 8@ 6#1PCU bpaPEVX@Up4 RP@yaV2< R) @2@"@<0@dP37DFA 02 S`1b1 R0<<< 00 6H0L<00 :00L80&L0,K"0$PL@,0HL H  0R08&",K H @,0LT L H H0D 00H0 9< [ @TL T  TG  TD T Tp  T=h  T:TX T5P T2 GL0P0ggggg gggpggPggp; 0-@PLB/t  0000 000000 -LUM0 ,0 08`1 Q`0p h 0l t &`1 B@00PT`UK@e TW?KT1 @ P XA DA T T,#T80BPPG6pP0`0 60S  0UK \a Pd -D1P0c0Vx1 $*@TMKPd  ~`!>K0\ mPd l1ğS t@t Pl1 xU:h!1!@P5@dDFA 02 Sp;1b1 R0``00`50@yh!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,f0忷 0㶷$t  l 0t!p! i `^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5ggggg; gggpggPgg -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `~h@h0@ PP<0 X@ \ h x  4T0$  00CS4` MPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S-p@L@ pP t t0 BOK|  @K  PPPp80S|@< D0 ,0H @0S 8 R8 R  Q00 000cSH S@  < 8 Q  0R 0P0 0P00 TRT p0SLQA0L 0,P`l RRKx0SH 0!RD 4@T0$ =0d 4*~PPL8\$ <@T 0R T T0t@@ 00 0 X+\  4Xp w060| @K P0 `@X0 S0;04p ~06x Rc 04d |PP!0|@P0l00S, 400 KT0PP 0   d@Q 0Q 00 R ^X`\ 4Xp >~060044@00@0` ,H}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  |t0 0c p ?H@_UT pL ,K/0&PP(R=;(; 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@;;;;0;D;; -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C S-- -- -- -- -- -- A?(K h1KK  >hA 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa KXP@`Q0 0R@`pd0S0@ 0Pp@d ` p0V`0MKS >K>Kp @Pl!d_}0P0@00S c0`P/VUh1 0a@ J H F D B @ > A?(K 80  $ 700 H@DC ؿ0>! '0807!( 0S/0 ,0K4dPP @00@0d0S,0 0S005050d0,T0$ 0008 ,T80PP ah@h;hhh`+H1U =@=p -L MP, 6Y pƕ ^0`/0>&,@0H,0S = 6pV0Y0X00S = -0#LRL R0SR T0 S5S Lq`0 Qd0 S;;- 03= p-LMPt0!` 0 wP@ 000Hq0(S08@ET@p3=0   0 0S  -LM      &W -L Mp0P(K`0\ 00 (00\ (0\0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST04 $  L0T@$K48 8$0ؒg -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0$  0R PM 000 0D0 100 0 0000D Q 0 0  qk T0$ T 0P"0sX 80SS PSI 0pRP(q; T0$ 5 0R ̱P \0 03pP (q T0$  00000(s00 000Pq T0$  000sT0$  S0s0s -@P0 LRp` wP$ R 80S   MP    0:0000   <0 0   MRO -Pq@p@`0  v`SL 8P  QR0`00R@ 0S 0;0Q 0S 0;0TV P -@L80SpP` 0 00   U $Q"QT P aP P0!RBY ~>4T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0bDX Qn0 lH0P0X00S*X"0S TL Q 0 0 0 X D-nTL 0\ 00 .RdDX n 0lX n80S mNNHLN gNDeN00 0 0P 0DK 0 J D $m$ ;4;H;D ;` ; ;.. ; -LC@0 hhe -4qLM|0x 0PbU|081  0jP`5 䠟 R0@0&  P `0S00@@ ȭx 0 0Q0x h p0Q0p  b6@B hHU=xgexh ; ; |00`|0 h-8p0P0 0Cp  0  xh h 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 020W/1@xh h -LM 0@SH@0 S p00Cp0 hP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TPe p-LMP P` P p@ ? `202 + -(0AL0$1@TPop 0S @TP \0@S000@`p@ ¬0Sh p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000  h ; ; -LM @R)(0 Z$$ aV p@P0S@PUZ0`qV$ Zcw|oeH?p00Cp0@T  @0T~n@@ p`㼎0 @ ⱎL 0T0Q00S ,0V 08W@3HU=DU=DMg^e- ^  0>0>0 S   -L MRP`HA \ b ゠ { 0oD0 0r -LM@ 0H*0H1HU=0 00@- @58 0  0 @2(  0P 6O h -LM 0 孰@;xg -0P@LT`p ,0"  @TV 0 R@X 0m@U10S SL0 Q* Q 0`0SpPXg hXU= -|0LM\ d \0+ KKOB&T$)!I ) hxhhL; -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ 9 P<   X00 P00S 0 X3ZP<@e, T @!8 < P d0p` @000 `ݯ0  FP0000,h 00K L00  0P<\ F &HU=<9" -1LM ,0 0`fp,@p娐PLA P 0c,p^,K 0  n TP@ 0J P00(Qhhxhee e h(i'HU=h; -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0JP(  PP ;;; -0ap #6RL`QP: P@ 2% " ZU:["@T  P PU@  0S:P 0S*2 "!64" -0a #6RLP Q@: PJ" T: R p$`QV  @P 0S:Q 0S*" -LM.0 L (0K^ #̌P@# 0p` @@XPD ,1, UL0`pc!  0  @T  ~0 04 jzZEUd,4UH0 h p0S &,0 0IHU=(;(i h 0.  0; -LM0@`p P000 `0 ჋P0000 . . (0KPP  0  (P b<9" -L$M┡L~(K!@xp00 `@0 P@ 0`PJ<1, WL04 c P` 0P@  4 P嵭Wy00S,,4@ `20 @@@@Th40 44 4 zGX%bxh'HU=4;@;L; p-LM΁TL0K! 0@`P `@4Ppxh' -LMPNPA@Tp`Lp,K, X0    \$ 0,1Lxh'p;0 -L`@P T@@0p*t@  p-LM@P `*ph  -`L0S 0 !,B$ R; 00S000@T `p`P 00@0 T0,  S(<@0hh~eHU=h hY.0 ᚉY.|; -LMĀĐp@T 0R 0尬@ 0TP`P @TPPU H  0P00 0S 园 hhHU=h; -LMP/ x`xp@0Th `U @v D 0Su0 0C 0h h ;h -LM@   0@00h h h -LM@p@ X`P0S@ 00   0<@Xg p-`@LM,P00LP (@DH@@P@T 0@\ @@@p ( 00S0` ph} ;h -L M@`p0 P000 `ݫ0t FP000 ,0K 0  ,PM-<9"000 - 0 BRL` LP 0 @PL @dDFA 02b SpD 0 S0``00`h 5ꤖggg -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php p-LM00PU* '`Px@T T10T1x0T0pP  X0,P0 0tt? @¬P `wX0 P Lȿ@TP8¿0@$^exh h 1gLU=;HU={՞ 5{000 ɞ$ 80wP T $0SD00CD0@T $0S02 0\ T00  {<9" -LM0`Pp @000#Pv0 zP0000XHP,@U pD0S PU0 00 z $ Dp=000@ 0  zHP,pU 80S D0S$  0CPUd2 H &RZ 46 S\ P 80SbPU000  {zHPU= D0SG PUX4  jz000(U@ 80SD00CD0PUHPU 80S PU0   IzD00CSD0 0 $ D0՝000  0zǝ $ 80tP D^4   0(\ $@@D0D00  z<9" h -L$M@ 00 @ yP L0Z!Y1 Y !, K P ,P 0 S*,40 $ ZQ 0\ 0P S:  QP< [*L080 ( S4 + 00 ( 2 R$ $0 a Spi piW HD DAP` @T 0 00CSdp.p...x.p.00S3 zW $0 Spi pi 0`4, P 0 , <0 404 00@ @4<P< P  Q:@ cy<Q2 kE 8 0Sʼ2SD:00CS0@Ay@ ;y妹TU=; -LMp KP`@PT  *,R 0T :800S$@ T: -LM`p$@ 0P@h -LpP @`00S0 XW 70p0ܮp 0 0 000 p-LM `P0S @' @phup -LM P`0S   @  @ƴm[`p0 @000(!`/0 xP0000 01 LP 0!`p0 @000 `0t pxP000D,0QLP.0  mpWx<9" -LM0@0CS0&0`p P000 `ʚ0 3xP00000Sܴ00@ULP P 0KP P 2<9"h -L M `Pp @00d#0P博  @wP 0 00P L( HP, U0 4 p 0S @0SE "S 8@T LDpP&(P 00S0D00D0  @0@P U0 0   w$0  CH"&0 0ppr@T 㤎LPU(P 00SK40p 040Dp0D00D0  @0@IL R 0D0S  0pp>L D0S R R 4 <004080$ 0〱噳4 <0 80 $ 0 s$0  CH"&0> 嗷<9";; -LM`LpP0 P@@$U, H@,PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@T ;8;l;;; -LM@0`p P0S+W@T   ?C00cSP @TP ?C00cS <$;$;4;L;VUUUH;\[;\; -LEM00,0  pKŸ2"KoKe2!^4@P2 0 000 0P  X( " @ Q  Q6 T "0&! 4!00B@@T  R R R 0 ,0S ,R0  "0"2@@ @T   R R  RXRPgh;H9t;9x;;;;h@;X;;;hxh;;;; -X0X L1?0c1Q< 8 80 ?RhbؒggfffhXU=xg0@-0 @R K100CS |.|. .,.,.,.|.0S RHP  +a51"% !\00SXg\U= -L,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,ЗZ ``0K 0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0@ lPD  H D Hs0 KP 0D0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K jVp:00L00 S  0<S: Hs4@ )DL V8 (*80S0)0K 00 Ha9P 0S)KZ )0[ S  )KjpV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,⟖  0 @`` 0K VP000 /\P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0<PH 10S     0@ |0 @P80 J,0( 0C,0 : O, VʦU^  R  1 0R-*  ( -LM`P @;9 0S6 *S"*`R 0T-@PbT >0N@T# 0U T p  00 1  )r( KP(0$ @D  PrX -L Mp P  0RP p`R >0. RF 0WCZ@:SW<: @0` P000 `s0 qP0000 0P ,0K<0  ,Pq0  q<9" -LM0S  *"*R 0Q bQ >0Q 0\  0P P  -LM@ʠ,ʠ\  0R lR >0. R 0^  00P P -L *"*R 0Q& bQ >0Q 0\^ .....4.<. 0  b  0 *  0 p-LM*"*R 0\-b\ >0\# 0^ 0 H,&R `0d$&@PQ:`0S*#p  0P pp h -LM ʠ,ʠ\ 0R lR >0. R 0^  0\P  -0LS   0 ` P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<X0Q9 `p0 @000x"`Ē0d -pP000@- 42 H)&R R 46S  @ ,  0p,0 0P@, o\ 0 80S 0 @ KT 0 < @<\ Tlj 80S   |0@ 0 P 4 00 T|0 0 , :#:S 05$<9" h -p| '6Jh0@@``LA@HVT 0 S @T 0S0Sxh2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0 hhhh2-0C22HSD000   202  B h h -LM2@ P0 00  202  B 2 0h0h0   @@2402   " @002 hhhh2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0h hhh202202G840 #Q:0 Q: 10b1h -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 L0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8j4#xhhhU=1g4;hB}1g h1ghlU=`;; -PL R: 00B 0 0 P  h; -LM,a> 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $T:尩|>Ph5*DD@+0>0>0 0pU=1g1g;8h(i;; -LM␢0^@xRxŸ@0ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UTI 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UhU=xhhL;x; 0-LP@HP@ T0 -LM@P\# ^/T%*p`V \ 0S\\ 1`1 @0 0X屬T 0@P<04m(塬 h;;hU=hh;;X;;; -2L M0Z ! 0CZ pWpWad1Ό 00 `PP00 T Z !0Z0%0G Z, `Ph0dp3qPU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h` P!UDF Z,<0X ,00 ooRhU=hxhHU=1g; - LM C0\ , 0` @,pP 000 p)8 00\, ($0$dohU= ;h@;d;p;xhx; -LM,0 `@@S <00 R4 @0R D0R܎Z 00S, 0 Q00S(0QP 22L Q 2 Q 0`8` p8pT TL} 08!`Vk R0000 0   B 2 $00C$08 R 2 00  004 04 00P,0"S 0",I 0"`2 8 R 240Q2<Z% (& :h `P00P%,   IF 0`,0 0 0` " "000,1`VT@qL0!`V0aV|Q_ hhgxh0g; -LMp\`P-X* " 0`P "%&:h `P00P%FF``  0ph ` 0p " "000 #&:h `00$q R 0 0 00 0  @ R 000 0 0 " "00C0"0 0"xh -2L P0` V0 2Dr# :h ` $7 R 0 0 00 0   R 000 0 0V " "00C0"0 0" 2a |aR 0p10  0 " "00C02 0: R $12 000 202  B 2S02 00C 02<20@000 0P0P20$ 0R0l0 D h R @0V p 2p 0 2xh hhhlU=h -`LMVp At00TPPU `V2  "  0S 0$"ی2 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B ៦P 2<2x0 0S0@@@ 0$ 0 0$ h\0 R `00S0@@@P 0 00 hxhg -LM KD@0#&R:0aR*0 (ih p-L MP`@ 5@@@t0l l0@@X0X ET`@@1@0STphHU= hhh$1g(1gtU= -L$Mp0 0 4 00 P4,P Ǡ,K 0 PP\`0 젟 @L T 0  @@\x0  , X,@ 0P4D 04 4 00PRjVJ0古, h;$1g(1ggxh;hh -D!L M0PC (@0`p P000 `堊0 hP0000 ,0K@@o 0S 0  | $,P`Bg@z,0@@t,@ $1g h<9"h(i(1g -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V 0!6 P0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 02メ10@T0 $C02 瑡灡!2022  0 p   0!6 000 `0 0,A0 0 0Ή .h -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TX 00 dP) Р2@ Z00S  !2022@02H@TLg$P,.<.<.<.<.$.<.<.<.<.<.<.<.<.<.<.,.<.<.<.<.<.4.<.<.<.<.<.<.<.<.<.<.<.<.D.L. -LM``@`0L pQPP H(P 00h60 Qxhg;0h=pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0 hVUUU -0LM @`PL ~ `Pp@ 0Gp҇1 0V1`0 p @ ?CSD00D SD0\ ,0,R0Sgxh h;VUUU0h -䐟LMp K0`S' PS00U 008 0B6C0@5``TP,0XH冈T`8偈Q(,J m0h h0hhh$: -LM pW     ? W̠ b ,@,0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0d1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 002f0X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q    Rg 2d0 `0K$ T  T 202n08! W8!  2  0a h0K @0 0@0!6 k K LP 202 @@ T K 0 !64D 0 P  ' 0!6#0P P@ @@ 2(10(1,10,1# h -8RL101@@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W<1pG0<1 0!6 VP 2J02 J `2"02p T00R00 S n8,P101z hhhh -LM @00 8 (븡4 ( 0 S< * TP'*0%Q :c0!Qr*`, @2Z U:< R0 < R@0RD 0S#4<Q<0@ 2#40 0Q!00@00 00C0" $0 0C$0"82Q08 200  00@@80<0 hhhxh -`LM Vj3PP >0^P%&@< w 0<S V# R 0SS:넒0 ( 0Sa 8 4 z \wH$&R:0Ra0, 53:q 0,&R:0R03:0S @1,0a<1pP12" Q4 0*R0#  R 8P, P\ , 1`ABP?2#40!Q0!0000 00C0" $00C$0"0 2b```"00 PP,00S ,0 4 0 < R@0RD 0S<*04 0 hhxhh -LMp@T' P`Q0000 0002000@0$ 0R@0$0 D @Tixh hlU= -@0LM@T 0( T  @U=; p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`p h;;L;;;;,;\;;;;$;`;;;;,;T;;;xh; 0- LM0PS0P 0PdP0 P!\0PPP墓x@Tp 0@ \ PwP L0 Po0hI0彠댏gh01g hl|e;$;,1gh,;4;h<; -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P5@dDFA 02 ST1b1 R000 \b01g hggg@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd001g h -X0LM\  0R \ @ TT000@a01g p-d0ML` @P0 K@ @当P0,d(4p,1g`;-X0^ P ($\,40\DP ^01g -EMLPM0,0 |$ pb0S S jP@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗔////<//X/80S|0# @ b3 ,0S |,p,PP@ @ \@` P\`# q00@d80S|00 0080S+  x\ `BK@$@0 mPP@ 80S \a\`=j<(0SjPP@ 0 K@\ pC`PP@  STz @vB~KpGpGG>K0C+lP@F jT1`  P@a0SIBKAG>KA0C+lP= 1` Y( PU! WpG 4 O#J6; 0YjP@An4$QjP`@,DTU WpG Y|@<0@d |4 gU=pep;|;g8;;01g h -L|Mܒ@0XpP 0 0'P@80S S @0X 0 0'%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !Ɵ0P C@\0PP@ 0R50X @00@0 !0D!000dh00h0 !T0,0 $4>0CFT0 0㏑P`dEB0 P 0K 0m'P@qp KT$;, PP@cT0 4P$Lvg_eU=; hHg;;;;D; p-LM0@( +($00PP(0; (*P` 0 00p@80S$ 0@ P0  &t$h00bh0@IP oL0(,$0a0嚐\T_ph@ {g h,1gX; -L M @ 6@!a0$0/ -L M@ 0@a0$0/ -LMXp$K4#&:@cP`! ($@Đ@b0O&#J86$;\ @ \@P0Oin(0 0+400 Pqi x; -L,M< @@ `d壖D @D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 9o4K 8K,0K'P40s Z<Ld  ?n80P@f"pd`T^Pc@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8  e$0 0e#&B@;A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -L0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S USwX0 ae 0HK 0  <PP TX  ;g p-LM0 PU@ p0 S@`@0P0@0    g -L M0 p` 0S 0S0000P 0-LMPV1@0T0 U( T0S% (@T@T 01 P0S @0@T0hV0  (Q,0,0, 0<0000S @0 0@0000S0@h41g<1g0S@-+@,  0 000@訔 ;U=U= RQ-L 0P0000 P 00S000D, ; RQ-L P P 00S00000S%T ; -L@M\TK K < 4 <#:0K [0*":("000| ; 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000ڒ ; -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0WP\ 0R,0  0S0sJ 0SI R 0S0S0S  TP5 02,\ ,48 <#R: ^]P, 00P @0  0,\,, P , #010く/hgh -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h\ ,,00@*P cz1cf`PX UPE000P:Pp 48<#h\ d,,00@P:f\P p E=E=E=E=h -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K 1Pk H0, ,pLK=P L0S10L0 (0 S h(zH0S<0H0 H,0sS$[ 00S40S80S0 0@@vP0,0S 00S 40S80SQ  l0` x0cl R,<4< 4l :0 l 31g ;Xe -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,Uz R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  bP@0S X 3S@0S<0S80S40S ,@K bPZ 3 SP0\ 0RP0 L,@K bPT bP(HKsg ;90]*Ye\9 p-LM`P@ Pcb00P3,@0 .p p-LM`P@ PIb00P3@0 p -LPM✡0``PKpDKA(0 d` *b'b K`P` P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P V^P 0S \00\0_IeK K_^PpQ|兎L5T <5T5` (K``]` P K0[ pS (K@K K 1 0 1\K^Pp 0P WY e^\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @_1.cdmUy @_1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S 1 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0fn 1T3Xe JaWu 0Q0 T 0Q0Q*00Q 0gliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i H!;T!;Ri Ii Qi Si Ti ؒgi Gi Mi >i€!;Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 & 5 -0S S/cH0SVG Q@ HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q8(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,upP0005S Y eP d0 UKe^5$#Ġ0Č$7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dK>^\K0HKd0KcK4^|Ɵ@K.44HKHK GK3K0P y}P@  ,dP 80S0C80ž@T 80S0C80ŝ .KaPL 00S 00$105 H0Kw Ph ]|şP.DD0HK CKH0KGK0P 6}P@7  cP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cx4 R*) i(0  h巋q}GOK@]HK dK  ,ğ(P0Q Q 4P  X} .KP 00S 00$3 R /  (0}x7}^@K@f]Xß HK( dK0 ~P  I }=2 R (0 Y hK v]P 000 ` ׀P0 82 R 0L -Pa 1 R0 1 0  CVD  KP`7q \00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`C U 0 R Ί0 R 0[S0[0S[Q5#$0$)K%"48<#Q !PSgZeؒg!;99Lg8g܍9!;";P";";h";#; p-LM@ P;T0 `0S R Q0000S ph P0`00 0(0 `bh#; p-LM@P R0000 0P @`U00 0S S @0S SS0020S0@ R \00C\0 0@ 0 [ 0S0C 0 phy| h#;#; 0- LQP 0 @R T0h; c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,s0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx[  ` K `U00  3  R0TK\0KhP 0@ X8 !xK _U0h0  d  P` 0@QP@0pS0S 12XKOK\[0)v2Xq  SK _0T1 `V OK0 S `VT\ _T< PU p ` 0S0C 0 00 R 0PV PpP%z0ST PU p ` 0S0C 0 00 0@0S00PVPpPz2gH$;@-|0\ 0S \ Q @ 0 0R 0 0^@0 02g p-LMp`@PT 0S @T 6H@Y0 0P0 S00@@ p2g -p0LM@T 0S @T P P R0600 h)I2g -LIMp`0,0 00 P 0SvP,6 oHP`g 0 0 PU 0SPU6H 100,0 S ,p0SU P 0 0 0R 0OK`0`0>YMK@0K<0A1T (K 000S<  R0600 H 0S0C 0 yS/K t700SP` V 2YP 00 0 `gl$;1i -LJMp0P 0 w 0`0CS 0 G 0S  p< R000  R 0CS  NKXJK00<0 K 0-K 6CHxg|$;2i -pL@P 6 G`V70 0 @T6@ H -LM@P6H P RP0S0S 00S0 0- @LTP 0S@T00S XP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\UeD1gUe -LM0@S S  +XPP P 0P P P0P P̍9 -LM@PPP  0-P0L@T P0 WP0@T00h-P* 003P: 00 ? >-RALQBp`L㓅 WPUe 0 S\D@ @\P0 S gx9$;$; -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ喅0ghhXe%; -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0Xe -LM@ @0T0  0 R @T0K /M%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PgUe 0- LP  D @U DU DU;0 -LM@; 5E 2E h.E -LpMpxPK0@X 0 Ux0 p`K Y0 00   00#0 Q  lg8gLg<%; p-LM P\ 0S \pQ  R X00G\`@` \^ %P QP ;PTTP oUP < iUP T# T 00#0  p  UUP00 0  00  0 00   pY#PT0S T000   P GPP PT@#UeUe -LM@pPrPT T kPD P1@T T `P, @T'Pa0S( ‚0S 0 @ `( PpP@ P`p孂(奃0 h`0S h(0( ⛂@`0S(0( < `0S(   gZeL%;%;%;%; &;4&; -LMtP0夀K@(x,0 dT  S5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  4PI@%P 5X0S0 000AK`!TQ @K@KKKK 1 !0 1\ڸ0[00K [ K  QP ,0 S ,-k QP/P t0 R0 T KP ,0 R ߁g,9`&;Zex&;&; -L|MPK0`x@(p$0 S RSLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$j80 0\0ꔁgL9̍9&;Ze&; -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ R [000[S  A0BS 000S |@KX9SAK O [PKJ(S00l0 0 %"4 4  0 W$0 S $HjlgP'; p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S jp X0S 58J0 R (  x0 R TPSH,K_PPgZe\';';';Ue̍9 -L0MԢ0p(0 : PU 0` RP U PU `0S6 VPDPKXB:R`K0S( *YKP'WZ'08 HQ 1 0@80zHP1J0  0eOj 'KP E,0K8 P<080  , 0R0% ~*0x2g2gh2g|XehhxXehTh hL: -PLUp `2X !@@$O( O0 ?:Z P$4D 00b02: 00C0醨hh0 0   00 80<808 8<<80808 < -LM0aS00Է8PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0Sͷ00壷 o頷 0@<b2ghhhxXeh -造L㲷0S `P00傷80S Hp`80@@80S㘷00mm2gh h -LZ-(0]n 0 Wn0XeXeXeXeQ0-4 $Q Q(0 `0P@ 0R4/P/X/`/h/ 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  8P @0 S00 0RwXel(; -4L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @0 40 1P0MS1~  80S $00cn 0 mXX 10000 00SZ:XN p4 M M R= R1  R) R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S S00000S 00S S0 0 0 00S1 Rt]/v0V0S: 00 B00 0  0h0h$0C0CMcq1P@ ᡦ 0R0% :P 0 SR0M0P@ 00K 㚬P 0 0R0% * V UV (P?vhZe(;h h$hL: -L$M8 4 8 p0Qg ! 0@40X<0 9 0 S<%D ` ":V :4 0@ WPP0,!!- 0 @0S ʀS S eS) X< R4@  @0P84K  < <0@40 0S0v4P 1   0 @@0S긭//(/4/D/4`;P@ 40S 1 0@4 @ 440@0 4 S S4P 1 (  0 @@\ \40@P4P 1  0 @@\ \404 40S 1 0  0 @40S=ʂS400S 1 @0@@ RW X&S 40S 1 x  0 @4H)0ݥP 2+<4.+ 4 F940S1 p 8^400S 1  0 @X400S 1 8  0 @@\Al(4 0㥥P@@44 f 1 0D S`*㬴@PynP 1(1$ 101@ kZ< 1:)011@01$ <L ( UK QK00 0g(0 0D(@0~ Z0  ǟA.L` BP`0@ `4Piᯤ@ 44 0DS : 00K 㵪P 0 0R0% *S! ʇSf DS! Sj400S 1 h  0 @@\'X;%4 0P  ^4 @ 400S 1 `  0 @@0S}XP%40ߤP  :=4 :400S 1 P  0 @@P\X$4@0㾤P  ?4 ?400S 1 X  0 @@ R;XL$4@0㝤P  64 6S 0CS40S X X#40}P Z ß `LP`0@ (` @0Su@@<BmP 40(#1140$ 101@ 2Z 1@ p 0g ̐  80 S- p32( < Y J J0E4\ J4 @1P:)014P 4巫$004 s0 (0P$00 p00g4C@0S@PX:400S 1 H  0 @@\~XX!4 0P  n>>4 i>1 R$!4`P0@0S 1  0@4<  0Es0P@ ,0K 0P`4  , 0R0%` *P `P@rhZe(;hʚ;4hggSKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0W~000 , v0 `  Do@`g0$0߭$ R 1 0 +10 ,(0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S C@P0pi0\0jS\ 0jSg %@P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P ?P040 g -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 SPK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,KC  C00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 gؒg -#L4M0P,0 0pT0 Pp 0R0% :Z. HK>0H0KT0 0G Kc HKX0 @T9 h0 @@TW1 h 20S'@HKLP0 *PᬜPP x2 ,0S p,U鞜@L$@0S  P K ኜ2P@ r0:S,0S00S40S80S T , >P0S 0S$0S(0S X >PQ 0"0 # W $!0ԜP h 00S! ቞@P0LHK ᲰP  4PP0P0 pi,@Lⲯ@0S   P Ko L0K ,PP7 L 0R0% 0*kg,hd); L L000 #Pj 0Sg  Pp`t@AaP 5"$ " pp!p p6XE Y@h&a$+$Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b L R,#Y0T 0000R:P  0 0R 40 0 SP  P p`0@0: 00 @ @@=  =(v0(0@@@@@40 PQ 0P =@ =P L !P(` L gY0 0@T0 R4 30 S T  Q@a@ 0DS:?>0R@19!0 0 g 000 PU0Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4(  40 0@@ P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,O00S000 00S0 0 000S000 00S0 0 0aߘ kbA٘g00SR\P 0SM 1 0( LY *<`g?XsU o0  P <P00S0P0 gLh\Xeggpgdh,; -LM`@PT :Rp/U U S*` T : \(`P Q` <`S*`0S` j @<`0T0U00S̕ - 0L LPXeXe6g 0-LM PZWP@ 40P00 KPP2Y0SL LW@808 \P0W0W0Xe/ - LMR 40 S L00P00 0 Xe,; - LMR 40 S 0 0 Xhe,; p-L MQPPP 0@S0 `ph&P 0<P@p*p 0 phApXeh -LM@00K p" 0@ 00 "@0P ,` U0@K!!  80K  ?@0@K 8 p0 -LM`v94r0@!0c48l0!0c4<f0 0c4 D`0 0c4 D@!390Q 00R D G9pZP, @09PP A0 R ~p0H, 00 S0 L 0C # 0 0 R 9Yp@ꫪؒg -LM, 0PR* L0Qڂ, 0S*@Dp`@40x v9@T4<@0 ,0H 4 800 _,ؒgHYe -LYe -LM 㧒P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  Jh\ dB!2b2c621b1c1\ 0dUeh(XeYeth -; -4@LM@6 J0hJhl0= p-LMdP0S `㼣@T 0 S00 00C0刣T 0Spth - LM(080 0 4 !@  0S'= '=P@ 0S ! 0@4`P0@ 'R`00`S +0@0S1  ΐ0@4 ! 0@@T \0S 0S$0S *0@0S 1 PUe  R 0S0s \0S 0s R 0S0S0SC \0S 0S$0S8 0%  R, R R R R R R R 5 U Uh y0S 40NP X9P@ 80S0C80<00$ =50  0 99  QQ 400S 8 R  04,0 PU 4, (0AS}:(Q 0Sq a(I40Sc @0S\ `0S 0S0sN 0S0S 0sE ȟ0@X 1 @ 0@7@U gwHL0 S4K8K @T480\ |ǟ011 T7PP0@0S1 0  @04 &@ Rᑒ ,04 (00&0@,K0K4 K80KP4` 04%,0S"P&0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps4 x5 R0@0 .|5P@ <0K( GP4  < 0R0% *7$%40@0S1 8 T<0X R@04 1910  @ 4 RF @  0b;S  74P$0Y@4P@ 0S 1 0@40 P 0S#Pß0@ R p L0@0S 1 80@00S0SP@ T  3P@4T00SD?P04 8 0@0 40n00S S+ !48<#,#80 4 00S 00S S !48<#,#8 0 4 00S00S S 04 1P@ 00S 00S S 04 00S 5#00S1@(p嵓P4 G!0@WT 1  0@00Sl> @ 0T  # 0@ 05S1#=#=``hhhhdhhhh\XeX ᯄ\o \E:Q](4070707070202020202020707070703030703030302070(4070(40707070707060(40(40(40404040 70(40707060(406060606070202020$30(4070(4020 70 70 zX  00SP0  Sh000 0X0 h0Sh00 0h0 00V X 0E P Q񟗇d3030l10303030h0!h P0S88h0!h P0S88Y h0!h P0S77\Y h0!h P0S 7 7h0!h P0S66Y0 V0 P 7QH(50l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10l10@50l1050l10l10l10l10l10l1050505050 60,60l10L60l10l10l10p60l10l10l10l10l10l10l10l10l1060l1060P 0 S g3Sd,0Sa00S^40S[80SX5 R P0SQ aP0SLP0Sh0h033Gh Rdh Nhh Jh 5jh BP0S77/h )P0S66'T P0Sh0h011h00PK/ @h P0S55 P0Sh0h055h0X 0S 0 *V 0PK P 0E:S񟗖9090909090`80`80`80`80`809090909090x80x8090x80x80x80D80909090909090909090D;0909090909090D;0909090D;090D;0D;0D;0D;090,;0,;0,;090909090,;0D;0D;0㄂0 08 X 20ES80808080809060P0 j0 0 P00h08h0#9h0   P h0#:0HT 9 TK0 PkPX "T0L@KS T %T0X00 6  `)0X0 *X 7S񟗷:0808080808080808080:0808080808080808080808080:080:080808080808080809080:0:080;080808080808080808080808080;080 ;0h09z0yh0u 00r| 00S0mh0=ih0:fh0?dh0#;`h0;]0   Eg@.;9 -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :Rpp 0 0pT \ -LM@0`TpP% `U` 0S X P 0  0P`@{ h{@g -LMh@#0`00\0 -LM@0pS`Ph{ P@ @0 -L(Mh`0#A( D0 @` pQz?0P@0P@0P@0P@0P@0P@0?0P@0P@0P@0>0P@0 @0(@04@0D@0P@0P@0P@0P@0P@0P@0P@0P@0P@0X@0x@0P Pp<@K#p`ԀVPV `(0 S \(: '"@,J$$ R 1 0 +10 ,(40S  R0S 0S$0S R R  0s RS$0S S8PKp L!0S  E!0S A00S !48<#,#8 000S00\0a0 @P0 0#(0a0 @P0 gthp.; p-T0T@LMK`` 00P`  0,@pd7g6g6g p-LMP @5`#Ġ0Č P 00S qD #211@,0($ph$(ZeQd7g 0-0|%L"4 40`P%@"4 40$0S 0oP 00S 0h7ZeZe -LM 0R @`P :U  0S z 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V P`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp P`V 00S0S 0S0S0S  PX (0S S00 (  n0$0(5#$(,""( 0Sd0P@ $0K MP@P$ $ 0R0%P *HQZed7g$hL: -pL0P@S㻈0 @TP  0`@VPTV ( R  BR(  U` PV mpT 0`@VT$d7gh -LM`8 qP 0s@@BPP  2$020 1  1 5U X@%BPp  1010!1  W @@0( 0 p@ Z  0: `000  Xh  0@ 080`0``````` 0SI ( :04K 40 j804!p`! 0@Y0K4  1 0@80S ʂS Z00 Y1   0@80SY 1 B/Y1 , 00S ` ` wgg9h6g -LMP 0 0 0 RT@00 DD.<00aah. hG@[ep7ghh0=|.; 0- LP|88@00T0@  00?040: "# ? 0 00uMb|W ! -LMX0@S #S\ t0 \00h0QQT0 Qh( 00GR 0\ 0@Ue.;v p-LM`@(P0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0([G.;/; p-PLM@PdW 0SS 0SLapP: 0BS(h0h0\i0h0h0 1S 0S0P U 0S p@0 \ GG0S |  1S$0SL `@0P`(`p F,/;ZeL/;ZeDht/;/;h/; p-LM@Pq0U`$L0@ $0 00 -ph4 00-=ؒg -LM@N 0 S  iPUq <`Vm H1Q p QgWh 1S k0k0k0l0ll01 Q Q 0 0<   0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000E (E E/;Ze=MbZeZe0;0;D0; p-LM㶅P `H,D1D!00 ,01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@TphA@I@l0hZe=hؒgh8[e p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R% \` 0S 0Sh8[eh\XetXeZe -L0M졟0D`KPp(0 M0@15SQ CSd0PUhb@0  000 ?0#3 00h=g<[eMb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0_ 0 @@?pY o5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@Vo00@!@10 r!01 !1 0 g! P@ H0pkPApָPp\0S @40b0@0 {0\@PZ s0 P@` 80< 0CR80E1;=MbZeZeX0GS S S#S 5SS ʇSS S p-LM@!`\ XP P np3000  00  00p#P00pQ 0 0S X?npPUt( (? p02;X2; -SLMpP@` R00Q00S3R`U-  P$ W W *`X  c0X0P00S` U  `   -L Mp, }0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4}0.0 0D D 001100 %!h -LM, 4 0 }, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <@}8< @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  ^08#X: =8[e2; -LM\0@,0 `p XK hK 0R60帐 0 弐 Đ 0% P@ i:T_ `xK 0S@ u0S.0Sş@0 .m,0 S |,n&XKh ==0S hKH 4=(50S xKٶ$ *=ҶP϶ @(0=X0ST0SP0SL0S&[4R t0S =d0S`0S\0[Sx0[S S pG@K QP R010 0S  0S 0S 0Y0R00Sh0[ xKSpp_P`z K0P@BY Y0 00 S 8s0S[ xK] Y0@4@@@K H5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 z@3$y$ R 1 0 +10 ,( 0( 50000* 0( |y5 ( lt5 R 0T00  0| 0S C pphU'ph\58;D8;8;8;7g -LM00 0 0 @0@ @@g -PLM@ -|0 0R h0 Rծ 0P (0h#5Q 0Shy000 4X[eZe8;9; -PLM@ R000h_4<9; -LpLM0P,0 `@ <KN T2 l Rl@2 Rh 0S# (2 RŸ@0 d1 ,0S ,sPp @(04<0S80S40S00S5 0R0% A:P7 d@KH ?P%` R 0 l 僡 Y0 00 S 0 R <K6Y0 J4@ <Kl  0@0 R q40P@ h0K [jPp h 0R0% *(4gtXe\XeZeh\9;l9;9;9;$hL: -LpM0@,0 `1PK  6 R 0 0S# 6 RƟ@0 ddƟ,0 S `,D ­P⿭ @(0, 40[S 6 R K⭭ 30[0S 0R0%` Y:VO @KPE MP= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KY0 Di3<0K@ @g90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 22 R  0P132 R լ 0%3 R 0S 3 R0S\ 0SX SR 0 SB K`0 K0KK\ 0h [0  /h K0h [2 00h0K1\K 0$(,<42gtXeZeh:; :;X:;ؒg6Mb<[e:;:; ;;L;;;;;;(<;T<;$hL: p-LXPKLM`@@Y<@ 0 PT0T P L  @ D @ 4 PP.p -LlM0HpK@d`K,0 @ PK1.+xK0 H0KG K0Kd0K Kc Kh@ q0K @PP%0@S T0$0tq ,0S $,: 800C80g<; p-X0LM@`TP 0S  @TpPph p-0LM `RP0 R#$0S R 000  0 p @T QPs@T+Vf|phF` \XetXeh8[e -LlM0HK`dpK,0 @K` PxK 0@KHKG@K`KdK@Kc@Kh` P$0S  ,0$ S 4, 80S8*#g<; -(0LM@T @Th -LMp1PpQ`1 R t1 Rip P0L=1DQ @U: $ V00R00S`RV)@TU V P HP 1S(@%TPV VSV PPP0 P HP 1SPPӸ\XetXeZe<;h<; -LMpbp PPC a@V; 0 @0a P, `R00$q00 0q PU @T PUP00 ``MpU  P 0``ooP1S (| wP` (@wpohTP0SP p-LMP` | OP@  PT0T S@`0T@ php \0|00 0-`0L@PT 0S @T0XX0\ P 8[e -LM`pP`| P@@ `` {U@X(0T0咪0( P00Zo0S 000@[oL0W &PP D0 R ┩X0 (P/ 8[eZe(=; p-L MP0 P< 8 \0SpMo `R000 TP @|DTo|; -LMT@T  :P HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R ҧX0 \`!.P` 01 RP ⾧X0 ` .00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKF8[ehhZeP>; -L;Ze>;?;h?; -xLTM P0, h 0l0 HpK0@Kp0 @P p d`KGPKH@KZ(\K cPKd@KQ hK0 POP0h0QP0F1@T T P0 @Th R 80S L1 ,0S @,080hX0XP S p0S P` 0 R Sl0 (X0(`,&|0 R =lX0( \,<0 R+X0 {,g8[e?;Ze?;@;H@; -LM!X@0PK,0 ܥPM МT`(0Kx0 F K0K 0K00K@ KP`p    000 400 80TK0 <0 00\0K0 [0K@0<@8@0K 0@ 4 @0 P@ K⣥0 ,0S t,3h0 RK⫥0H @+,0 R $`( 0gx@;Ze@;@; -L<8 Q q\ 000|H D000 0@0,0 R 0 +ؒgZe@;p, 000 0p 0000ؒg -L@P"p.k0`S hk040S ,4 40d0 -L M0 @R 0S  P4 0 0 Pl0 RP X0 Q H 0S P00 ,0$0  A=A=h7g^,h -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK0 H0KG K HK X ޮ` VA h0 l` VU9 h 30S/P0.]@HKLL0 WoPZLPp3P@ H,0 LS D,Z@LJn@0S  L K`P0@!   0@T;\ PP0S 1 ( 0@00c T2P@Zr0S TS,0S00S40S80S , Pz0S 0S$0S(0S X Ph0s T0@P 0 0a fP  0@KU& !0ZP@ h 00S)P u\@L0LHK nP ZLP 0P@ 0L0 P Z@Lm@0S  L KTY,hg,hhHA; hWS @0h[@0h -L,M@, ppL ^`P- ^ 0H0 0H00H0X00H000080@0H0H0P0`0H0XtW 0 L0 Y AWLH4 ,0S <,f(4@$ jPL MZPL  ff00rPfc@0S000 f R0 0SE\ 0  XP Q5\434#@P@dfDFA@04 S`ʄ1dA R0 0000 Mf00r 0@S 02 R 0S 10v R 0S0s R 0S0S0S P 0,W 0@S1 R 0S /0I LKH0,P *P h7L0S4 P000)90&i% S80H@Kp0@K G0KHK  0L S 0SHKH@KG0[ShC|&-0ו 0g`A;lA;XeXe,hgxA;gggg9lA; -LM$ğP`, @ S3@ pK 0P p T 0@S 00 UX KU`3 ,0S P,(0S/00S 0S 0S$0S(pW 80K0K@K0 [0 EP ,KH0RP 3Sv 1k  80S $00c[ 0 U`VR 10000#0Y"(p0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<0   0( y8(,0h 0,000H  S70N0S: 00 B00 0  0f0f$0C0C ɒP 80S51020S  0S$0S(0S90% #,0 0 h ggA;hh z \%0 ꄎ9 -RLM@  -RLM@  -RLM@  p-L`Pp P 0 RL tC dd0@000ႋ+00C0-d L -|p\e^gB;Hh -\0L0TS 0S p00R0S Pg(i -LpP`P@U U UPEP PE0R0@hp%pp00$B; -LMp8 Q@ 4 < ; P,, K00K("P4 , X3 X-4%j6+Fcj 8ؠT@!08 T d8  0@T0X00< X,008 R4@8@'%0 :#:RJc0n<0 0`0(ih0~n0`pfUPP 0f0V@0*` `VT( K,0K JTZ:08 P, 0L00 HU=(i -L!$D; -L!@D;00-@P 6 0 -0LP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS 11111111111111111111111111111111111111111D1111P181h1x111111111111111111 1 1,14111T1l1|111111111111101 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024Pꐎ9`9F;F;F;H:DU;\[;F;<ȣ;G;l `Sl h0 $$ à 0 < 0 $00G;`G;9hG;tG; -pL`@Pu$ T 4 Z DU pP@TXD4(4PG;G;G;G;G;DU; -L0 Z\@`%Z' !00St 0t  rW\PD  e/G;|U;G;`D;hD;: -O8@LMpOSP!b$ $00S 0 hdX@@  fG;@|U;G;`D;G;G;: -@$40$&S !PL$pdxl dVHG;G;G;G;|U;`D;:hD;:mB; ) 9 -LMpH`@PL 8P$1( <0D $00HH!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -LM@!R ,0  10 <Q 0K/ 0-g -LM t0@ ,0 ) L0 Rh0, $ 00 hgh p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `gP0  R R R 0  R R R0Spp p-LM0OThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0p,ii8i0i$i@i(iDi i7g7g7g4i -La0 PP p0P h0P `0P X0P A\Lx HD0 nA(- $i0$ii ,i0,i .i0.i]eh<iG; -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00@0?00?0^ehhi 0-H1L@4 P{8040< 8 H0<0 @ 0 -Ld p -LMp$`H Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK Pp10! 8PHD1X <04Y 10 1$`K 0 gh 0-LPMQ@$P> P dKUP8\00S 0H!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08< 100 -LL,M0@!00H!`4 R   R  R0Rႁ0僁0#q W0P KL0 P pH00CH0 p 020 iP0P L20 HPK A X@ j8!P hgH! 0 20E -LMp`_ZLP0 S@0 0 ,Z`@xg$ 0S00Hi -` LR000 | |0@P-Z@dDFA 02b SpD 0 S0``00`hYꤖggg -` LMT ^LL @Q Q\ 0 @6gxg (1 R 00Hi7g1 -LM0P 0 !H1pAHp!Z5 `000F4 0 QH1P0AT  0P @T` H 0V mwD&T`  0pgxg hHiXH; -`,1LM 080@0K(PUK  PU Kp0(  PP  PU K0@ @ P_0ٞP00P0GH 0-tPtL0n@Q011!!PLP@0H!0*4 " 40L0C0l@d=i~eixghipi(igt:~eH;HU=H;^eDMgI;^e^e^eLe hLI;dI;I;I; -LMQ300CS'L$1$1h$1$1$1$10 #0\ 0S- 0 X00S000  0K\-0 -^eiugp@-P0@S` 0 p ?2c0TQ000S0"c2`Q0$0 p^e^ef~e^eQHRg -L@A,@` pPP 0 J 0 P0 0   $ ( 000$0(000U -L MP S$(`p@, (KH,K @P,00$`p(0 -L MP$(` pQ-0V80, @ R0@\00T00S\0, $0 0( `0  (K,KU -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -LJ;00$0(000 0-LMP@ @40H0S?Q'|*1)1*1*1*10ES *1<*1P*1X*1 *1 0 @@X0@D@@H|xt  0P  0P@ 0 Q0X00J;4ihTJ;lJ;J;J; -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @lii -0L M0KSP00 , ' 00^*@p`0.&R:c0 R054 5ƒ0:00  0 0 ^: Z sh ->0LMn<`p4 vJP@B 40 R08 &8 P00U* Vؠ 0. \   0Z UJjF:804 0S80 d@X00K@, KP00L00  HU=h(iJ;>0 >0 cIHU=M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K A, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K>y(i  0-LMP 0 .@K PP@ PqP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHh4i -LM`0VPp R a :VP@bT@!W W `d L 0D@WHh4i 0-`@L\0P 0  ,0R 0 0S0hqihDJ; -LM`PV r @0S  2S @2S2S lphLdI0JS 81818181H:181H:1H:1H:10  7020@-0 P(1`VAA0S 1 R$ 1 ?#+0AB%@  Z 11@T !mt h81\ ?# $1H1@Q1@!+B%0@ P00 0X u" 0|  cm,9i+;:,P;0S@ Tǟ#&R:0R*0a00  1@W2 0@0 HQ`  @0 `6W  T  8 4S44SSD0 SH0H0S S L6!X@0`0ó @0` &U  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`zTU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` U  @0`00@0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48  0 `D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` x!U:  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D87 0@ 0S 0P O0 |eg)*(":1"(Q 001 0Rih(iiD9hhi,EgV;V; -L0? =#& R6:0R3*0l$0  1"R 8\ 0P \0T\ 0 @00@0   $0 2R @ ` #& R:0R*0l(0  1"R 8\ 0P \0T\ @00@0  hh -,0L ^  08gh -!*(L":M1Q"( 001 0R  0`* " !Q:0Q *0b!0 P 0h -LM 0HQp@+0 T ?= ?0S% D` 00#! @R00  00#!H0S  S 0 0iC0Qghi 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00h(ig@Mg Hg -LM 0@S000L00h -PLM` 0S 0Sz0000CS0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VHq& 10S 0 R *(I0  0 $R$4$4$4 i@00#!0 hP0 0  "!0000~(ig@Mg HghxgLeDghP-0 R0P  0S 0S  R00L00 08   0 000@Mg(i Hg 0-<04 [ 0P L$@060hkHgHgh p-0LM 40 x`pP0\\@ 0 S@R0Tp@iHgHghg p-LM 084P4@KX0K@ P0@ H`[PP@P@@00phGgHgHgHgh0 0 ii -PL0@P$ EB0pS*`|'\ 0 $>"*01\06S0:0@<,AiHg(ih 0-0 L"*("1"(P  \@! 0 SP!0!;   @00h(ih@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000h@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pGP ` `000@0  0@0$0)$;i(iHg HgHV; -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,P0 "R@@ŸP 0$T D@ 0@0!@&0 @0!@< hPJT:ko`P@) E1? P 0 01  @`P 1 000R ;P= 9W 0pĀ 7g(ihiGgiHgHgHgiiiGgFgHg HgHgpV;t.=(Dg(DgN1(Eg^exV;,EgV;EgFgN1V;FgGgN1V;V;7gW;@W; -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U0? ihidW; p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p (iW; -80L0 00 Ơ t0 ~e i i,Egi -d0L \R00#P00*0 $]30hi^eHU=^e00 R 0  \05055i^e^e -L$M2(/1"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPbH0H 000 <0040 000 000 $0 PPX;|X;iiiiiiX;0i -``LM0pS P0  @P@^00 RiP0P0S  \:00Q0Si0@-l0@P 0S P  T :00U0S000i0-0L 0 000 00 0 0 0 x0x p0p p0?00?X0 ii iiiiiiiy1ix1iiiiiii$i -0L0Όn`VPp@0?0?0000?%:F%6;PK #;J jV!Z{^e^eX; -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:h(i 0-80L@T (PT q DT0(Eg(i\[; -X2LMP, @ @,8\, 00$ V080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $01!R.P I P 광111141111<1111L1DP  0PP0!?#=?00c?S @Tjڣh,@Y@ BP@CPmPFP$(iY;(Y;U#&R :0R*0a!B 0 T H4$4DL8@T V 0 *$@T@HghY;Y; -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P GgGgiFgi -0LM@@pPP% KNPU$: 8 #! R#8 001 R00*"5*f `  0@OP4 xh(i -LM@p k P 0SPTT0 R0 00b81Q00@R}pe_e~e^eY; -LMB2< r R0S tRP "88 #$0LH2`" P 0S@ th P0Up7*!A06T&*46!SAQ  Rx1 :P}p`UJ1 16T:0U00 pW0#02S0ES11̘1111111111111111131<#  "88 #$h(0S} dPipeh^e_eZ;i8Z; i:(i@Z;LZ;@BPZ;hZ;tZ;Z;Z;Z;Z; 0-LMPK P@ 008@h -LM0@Xh -0LS S  -H@LH`P. p#H!.@ H1:404H1L@H@H!L 0V800`H`0 0 048 -LM 0@<  htxgPq$ -:#:LMS`@PR pK D  XjVJZ)(iZ; -L M00' H ~p@g0>0L ^| P/U@`H@ $@K,0  $ 00ZUzj^e(iZ; p-LM`00l H0N@0d0>0^P 0,0 -L 0L0H p(i^eZ;40 ( 40(S"4Sh|e40 ( 40(S"4Sh|e 0h|e -0LM @R 00 Sz;뷘w T9B? S p0  "!  PLv4?3?00^e-=@[;`[;<[;`[; -L$MP@ ]g0帇 00;8 K<0KL5<8P.v||ǟ@etǟ$F@llǟl 0GPXpPn00 @0b@#64G00 )P@ 9#9S*00 S0)\:00 0C0 000b1,0 PUZ0Q I$IT d0 C\8fs:0 0C0\6* Ɵ0 C\$Vb:0(0C *00 L0b1\0uK:0 0C05*i|0 L0b1\05:0 0C0p5*S\$0 L0b1\0:0 0C05*=0 L0b1\0 :0 0C04*'ğt0 0a@1^0:4L*0p4$w,A `P oPUE `Z d BP dPUE `Z#ß@ef 3D @D >0ß> P@0&nD0 0[D `0n 0Q8: 0J #: 0C3 :0<Ÿ: 05,0 9.B(P `:@$PU @Z D`2 0xP0 ">0>0P2PD@1l . ($BP   0 1!HHtd!T1!1 1!1 tI! 0 J ,"7[0@0 l0C ^:00C00 0b10 @b|[;g iti[;De[; i~e ili[;xii\;`iii ii|ipi4 i=iطi4\;? h9De`\;hUUUUxgi\;1TeA1Pe8`e\; p-PLMP x1R p1 pdA00Ta 0D!P@0 SS  QQQ00 Q9 1P0-S SP& 0-S0S a0C@S181(1018181818181818181818181818181H1@0000SpK@@0@0 S DSBOgi~e~e\; -h LM0\SX@ 00oD0 <<0<CP ,0  $Ig9~e~eDe =\; 0  Ag p-LMDP`@ P @Tp1p~e0 0 QP~e -LMP@ D@0@T 0S( @T\;g\;\[; Q-LP. `Pp@aFQ00`V00S00@0@T 0S @T`PP 02$04 40g\; -L#$0 h5D;<14"=^e -LMll0 , P RHe "4"@ !$"R`bpK0%PcP@   0ad0S Q4 0000 pKQ R a x }5PLs@@FsK5TQT0 S*R T  0K!P c0S)  R R b  I5Ps @s5T 0K\MP 0SC  0s0 0 00S  ,0S ,,88 #Č2` a ,R@Ÿ00 !((!4q"$0 T "U0s0 0 0 S00 0S񟗳11L1111[,((0 "4400$04  PbY@D00 0KP Q  )@BP1 RP# BP@0 "4  0$ 020$0  pb꬀000 `@:P0c 0K U ggle~e8:];~e$];H];X];`;h];tepex];];I%e];\;];]; -LdM(0p Stp xp l p p P<3(05<0S2<080S` (x0 \0Z 0S<00(| Kl0pD08_V00 S s X t0 Z1 0Ol4( 00< 8 I@p0fL P ($x Hh@Ko@ x00 Zx- S 0S 0S \x x 0 01 0 | 0 |0R00000,0S0?0,080S00, 8V 0SEO < Q\VV00 S 0S(: ` 0(H0 4S S 0 4C Q ˠˠ\d2d"0\"4SR 0S1| 0OX 0"@0(00 <0p KP1x0 H@(0e?CT 1R x R1x0 0@e?CTx0S lp Px W 00:00Hx0S8T!Sx P`(He/x`  > 0SsQq S 00 0S S S` 0 0`^ 0\S St 0Rt0 P`0S  0CSS`0];^;U^;WEV4^;D^; -80LSP`p (0S KKT r> 1R0S PV# (@2@R0`! 0R 0R: 0S  P 0 0 V08~e/ye/sWEV -LLM(0@pfIPD@8X p p @0l 1( < 00@ J P@`JHhKo@ @ 0S 0S`Pv v 0 01l0 p 0Ol0 @0(0<00  JP@H( @0e?C\ 0R 0e?C@T e/000 J@00:00G0SP (HWEV -LM(p< P`DD8/\",0 ĠB X 0OT SX0c\@. 4<0(p,4 0O RQ /RQ00,0S0 4 8 00 E0@4000;0000 0-LMxP@dT 0 0L P|@0< Pt(0(0P0h<~e i_;_; i iؽ10  B Q<~e i - L0 ᘰP1_;_; -LMd1pP0S`' `开@T R0000 0 '1I1Ph;@T010< @ 0S@T$e 1}<~e i= i_;_;S 00-L`PX@pHP 0 0`0P@ p j0 i i -LM@`00pS1P0U 'PCP0S UPP M0`0C00P@L10100P_; i`; 0- @LPX!000 U $00S0(0h i -L,MRP,`Kp@ %40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0  0 N`; -LM2(KJP`0p ,0 @p(@K@ @z0' -L M$PK@p`0:$0K      $  8k$P0 P ` PKG' -LM2(KJP`0p o40(K $`KPp@ @&0 -L M,`KpSL0PH@X@0 ,K@+PK(KP P0u' -LMP0`Kp/,@0K UP#K0 /K.KP @,PK -L$M@4`Kp `0PT@!$Z4K-K [0 3K2K@ P,@K0 0 0bS00-0  4$ 00bS -L MYP pR`@0 0SX1 h 400Sd  0P@8 04SOX00 0>S  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P)0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p``$U-Kz4K 0 3KP `p,@K -L M0pK@` $P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hPu,0P# P 0`V U004P< (0;4P00@ @0$0 0SeV hFP 0,0hP -LM0$ p@(X p, ,0P,1\1h1x1p1`V -00 P0p P>0 -V 00SOp 0,0`#P`;X`; -Lp`PP Y@  ` 0$0  00 @0 000P 0ҕ20•U@ pP -#U`m-  -LM,0@S$101111101@1\100Cs0 0 00, 0S P;p  ,0S `; 0-LM0@0S S T@D P0`` PP0@DS000Sa`E/g`; - `L$0p04@S0P0p0CS0ԕ PK111p1111`1111h11p1$0( R0(0P 0  0@0PS 0 x$R l1Rd1Rh:  R50ˠʌ ʌ00ɌH0 @P`*00P  phU*0 `00  004`;00l*PB8```긫;;Ы;7U 7UV 0kd7U \7UHQ #  3IP 0+;6U=6U"*6U 6U"P$6UQ Qc00 "  d 0@P 0 {0006U 5U 5U㲀R!U@ R0`0 !!㲳0HS"5%@PZ0   S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 徧@ 4K 00K @ @ 0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  鉤5,KX0L @` `?0S0@00 |خ9`; -LX  0 P0$0B(0P S 0L i@>2 i|U;;; p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!pL i h p-LM0@P`SX=2=2=2=2=2=2=2@ D0P!!00P ` p@@@L iв;-0!! R R0000 0  0!! d -LM Z@ 0@0.hmi i Q- L 鐬: -QLM@   ;; p-LM@ ,`K0Ps  00 ,0 02K80 $ 0 P 0 pt:>2 -0LP 0-0@00LHPf 80S0h 0\[;?2 -LM ("(\`, p\PUB 0PCpu UpZ" 0S Up @PPEu, P@ 0SQ, P@  , P@PEu   PPE@u  p,   -LMKK!@ 0KK@ @s -LM K [Kl@( 0"( @@] p-LȠMP`,Ƞ@ 0 @P`Jp@-$0 @,@@dKghKgiKg 0-LM K0[S00Q@@TpP0X0 0KK @P 00K[0 idKghKg p-LM K0[S00QPPU|`x0@`0 K 0KP P P0 K K [0[p idKghKg 0-,P@0LS 00iKg -LMU HTᘕ_ 0040 08#4 RT hX `@h(H&hX00$HTP0< P80 p@0@08H#8$HTP  8  B8 qp<00<0 U< R008 R0S~8 PR< <0 R 0@ 80 Tp@P0@08H#8$HTP 8  B8 @p<00<0 U8 <0SRQ 8 <0pRp0S0D0 000 SP4 P= X7 V1Z] @0SL W: D R) Z PU@ 110D P P  P,0 S0  R p H T 0` V Vp H T 0` V V 00`00,0 , (8h"(#8(&h, 00 ]@0@0H8$H#8T2w@t@H$H T&(j@g0@0H8$H#8T\@Y@H$H TN H;;$; PP-L +P)P NP00LPP3 pc`P@^00S' X0`S0P@pTWV G @PC0P@ T:$ 0MP,;8;$ 0S R i -ALM0p6`0P00 0VP0pU0P `0S`P UW pP@00S 8PUY o dJg@;P;\[;\; -LMpϟ` 0 SV RᘟL0>0IP 0P( P NAP APU Pj #P\ HP  JP  -V .V (0FS-0FS-V ,@F0Sk0S\W <@K P. 02d;l;t;;;;;;;;ij;г;س;;;;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;ȴ;д;ش;;;;;;;;; ;(;0;8;@;H;T;\;h;H@0S@|0,S\p?Ppp\P: UP|0,S?z PGupIqPpP P?gPHbP@] 1p?W P@RANBJXq,@F0S?A`P|q 0S?8Pq 0S?/Pqz.V,V /Vu?$Pp@qk -L$M4 @400 )@K蠟P08@ 80僀 0 80`R:p )0K pp pP@  0 `Q*800S80 04  ile0 2S-L 0 p-LMPp@0`00 X04 @0P P0D H0H H08L 8@P` 8 ph3|;|b2b2,c2$c2i p-L MP @K `%M0S  c0 p 0-LM0P@KcP0-- -LM00` KP`p0#@ K0KK@@ p,P 00 u00餵; -LM00@P0#`0K10KP1`K PP 00L00*[+[0P[/`[.p[,[!2 B"1??@R@L NDB   A P`p{P`p P`p Ե; -LdM d d0,"{>Ch0 @0C8@ P0>~ 0p`gPP 0g0V0@ p WT( K,0K jVJZ0 P, 0L00 HU=(i p-PLMn@P^P^`0PPfS p0 phHU=0 0-LMP QH0:Q *^ lP*4@D P0 -Lp뼶; -Lj; -L M`Q9:#V6*0S`02* c 0>0~N0@pdPP *"*0 T *` ^V\$ K(0K JTZ:86 P( 0L00 HU=(i 0-@@0N@P@@eLn0 0h(iHU= -L ; -L4; -PLp `, ,@ ,?@igȷ;;E.;;$;@;> -\ LM0S H0K0 \ 0   0S 괒gil; -40L R 0P p-LM@P_400  `V` 0  phH`s|0@004 0\040 \0@40 \phꌸ;;; p-0LMx @0t0D L0l l0P T0d d0@`(PKX \0H`<<<@0 0( $@ \p鰑2̑22Ȓ22202;>2  `A|  `;| -LM`dP{004 ,@}PU 0;P0 P0~n0p`fPP 0f0V@0*` VT( K,0K JTZ:0ű P, 0L00 HU=(i -Lʵp; p-PLMn@᯷P^P^`0PPfS p0 phHU= -L⥵딼;000s0 e p-LM@4P 0 0   0S`T ph齶]04 `0S 8 p ph髶 ;O!;R R | 0\q 0 Q  -LdM030 | |3| ,  |0_40|#0 02  9P/XK  @0S S P@0'\00tV|(Z|g[\2\0S0P1P!|HC>  505(2  5@055Z@C 2/@=H_00%0P'x@K !| 0/x0Kl K[P |100|0\000hT1d! 0ᒋP Z D巛 1 ,0S ,,&|!0`9.͊_0@@%0ߵEΠP0`@#Hh P 8`p@=0Pl0%|\張g=d:;(;D;Le-=2`2p;:|;RNL;Խ; -@L#`$P P00$ ;004P$ $P؀0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0ⷤ(O!M!`|e2_ed|eie-= -LMD@!88#0!%Pp0 , 80040|Õ 0s 0 0 pl ⼃< 0H .0$X0 00$80l;|;WEV -LMP@p`$(|(0"4 40\0$L0@ Dt 0\T 0 | \P | 0S000h2 - XX%tLM' `4 $ᥠ P@0  Ő0s 1Vm (1V 1V | 0[0 ᣠ0 001V ,0Ke/ P1V8 :D10S  0pYP0 % %0 0 P0 |# 0S0000V 505A4  %44000 0|E0 00 "   000 0S0058emdedAsd rdAhdk~gdh2 - 88@#DLM$` Pp 0*H0 P(TBĠ*0  |PP!PP 8e -LBCMB\`, p 8 8#T % ʟP@ |# 0 SȀ(PᒅPᛅpᗅP`  0S ,0 S ,0`QP!ء00 |3 WNSⴡ0 S_ Xa0%S0000|00@0000( S0!lhtC0PA P( p1S242h2p22}0 S 00u4! q4!'0(S 1 !pbS0!W㑓)`h@00,K0,0B]/|K/K<[KKXOPLH~|Peg8e;TeXe;;@;\[;ľ;;;;; -L`|PzP@ P P0pW U ,w( 6H垁@00;00000Evv|#00<;p; p-L$M|#@0PSp8`K 5 @0 U00K10K002K8 KT0|,0 nVP <հ2[2[  ̰Ȱ0ux;;̿; p-LMP@8`XP+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 40aX0pp222 0- 0@ JLP 0h0,= -L$M`12l1,0,0 p ^8` 6^X5 00O@l5 [SP X,  0$00$0  o) 0(+@ğ@/,NP0$0 o0@ ,@0S000 2080 080 00S 0 00(̓0 0 C,P4#8@P4 00 0@b 0  W 0 5`%`@ 0D80HP0 (0$ wO@l3 RP0) @ Ƞ_,Ƞ0  WD L$0 0$00q X$0   0  " S$0 0$04@  00PP{V0 ``0 S 0!0(S Tڰ0Q0I 0 9`)`O@2 RP90-40 0 0S\0#1 00 CV0 1 cRP ,vP( 0 ,$T 0(+@@ @ Ƞ_,Ƞ0  zV0 ``0 0 4`$`0 0` `` P,@ڂ0040 0P@Ђ0Pق 0 @T0(΂T00ş  0 峭\2'; ;D;|;; -LMP12l1, p ^ `0@yR420 QPc 00 [ 0@@= 0T R P0$0@(0 T- 0 崮0$0@T  0 0 0 000 bQڰ0 '0$0c zT 0  (00 00  nSdX @ 0p@d0@0$0/ E  0 P ' ;;;;D;p; p-LMPJ `@)>V0 00$ 0 ( p(ph p-LM`J@ P00!V000  phO( -LM02ct$Y1 pP,` 0 S 22L2T22 22\222P2媬0$00$0@ 0PPCt00 k(0!L00 0@ 0S 000@  @T @0 000C000,   0S\0#10 T0 00S  0  xT 0" 0 00 0 @六(0  p倭0$00 0L+Dt+ 0$0( dY 0  0@^@0$0 @*z@ 0XPPA00 (0! 0} 00   T0000@d@ 0*PP@00 (0!T d@ 0PP@00 (0!] d@ 0 PP\@00 (0!Y d';;2;;;;;;];;-08$0"R(00  0$0+ (  2( S0<0( 0@000$0 -LMđ0勯Kp _K,0 @ } }0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R RP(K0m ,0 S ,委  Ձ09 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" g `;NEFX' -L M<`Kp@ P}0<0K0 60K@?4 K7@KSK00 5 KQP3[= -LM 00 0 @R 0S PQ0 0 0S -LMp\W`pP @WĠeT 0@T8ҀP pee|U;H;:; -LM@ 0 S 000k h| -LM 0@S4l0 0 -LM0S@PM!0pQ- 0S0%\a2Pa 0 0#r UP c0`00Spe00P0W0SPUUP  J`PP0U\\ P8P`0Q #(; -LMP@pA@` 0R X 00000 Q- L"; 00sS0S  -p @l 0L S0$\0) \ @0\`0 00d00h PPp`\0 0dS\hߪT0@ܪj$\{\ 00\利Lg؂ee;\[;Lg(; p-8@LM 0`P0 P `pLgLg0   LgLgQ p-LMl0PS<1  X@T 0S1P !00 S P0 {p0`0CS0000 R000S0S0x 2c1<PHX0@ |004Lgd|e2ie=<;D; -XPLU @ ?#<0 p` @cT0p  Q@e0S 0 S0@m{00md; -d0` L - (L(" P` 0AT P0S XpW4P$`P`Xp+鰂e0X0 -T0LM (("!X@ T  00X鰂e -t0LM Ƞ Ƞ,A04S 0000 0CS0 逋 갂e@-$ @.MЍ@갂e 0-LMP@@ 0@0CS00[ -LM\. 0\ 02pXP @1` Q 40P d0\ \0\XP @1 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 d`p 0 d`p p3^ x3^p 00 P3^H  00  p2^w G2^B )2^0S!1p h rP` Ci % ~\ wH2^HrP`0 00  000 1^# 1^yp0       0 0 p1^d0 S0 ! ra rP`,0 t   x  0|0 000d`A@< S \0 K  $@ P`\@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @eW@؂e W WW W-00 Ƞ Ƞ,1X0S갂e -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ 00LgLgeLgLg -@0L R 000 0S 0S 0LgLgLg -4L,\ \ LgLg 0- 0P @@ @  @ @RL h0T d`  0h@0R  Q 00# 0Q 0 000 (-"H 8TLpP#h1 '0T 0S \0 0 : S 0Tl0S 0 R00L\ :@@0T\ 9\ : .= -LMQ0 P @p/ T( R0R 1`T R 00Kp0; S, H# Rr Re R  T PPM P `@0`0VA` Ƞ ;,H; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A11,R0W0 R001T; 00l1R d1R R;00A Rx(!t Ha[0 080 030 0.0 0)0 0$0 @00 00 <0 <0 9 ,`K 0<0 0L  -p!LM04 S\q1Tq080 0K  %{8P`@`V@DPEAJ3[ S"[00b0cS { 0K{X8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3ee 4S @08#<@8oS: S>; S P 0 R0,Rس9 -LM@Q 22222<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S M ; p-LM0`PP@ SeP ed0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ a 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S= ;;0Q 0`c Q- Lj;\0`0_\[;Q p-LMX@PT 0S1P!00 S P0 6p0`0CS0000 R00k0S0S|0t 2c1PxD0@ t00d|e3ie=;; -LMp ,0 0'0#0#@00 40 %XY 4@ l0d@0l04 @p0,0p04  D t00h0t00P @ <0 R"8 ` x0S P?#<00cS{ 00pIUOP\- >`XP  \0\XKPUeOX0\eO\h 0 Rh 8 @P@ |zP\0@01eO\0` d0Q3R3; -LM, @00 +P4 `e NPP ` __00$00 1020 \ 4 T0C @2356 P 0S P 0SPz X0 Q~< 0S00 0 Q p@$ 0 0@P@p<` 0p@T` bW `0 R4 0S,0S) 04 50<P@4P@  C  ;4d 11 1DQ@T XcXCXT#00LßQD   0S 00B0S S3  X 0f KP` 2X  0S00S 0S  ` KyP ` ` P L 00S 8 V f;L0X0f840` p\PP` 00B0S Sf zKPd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 /P@TX 0 L  E01 0CĠ UKV0Kg\[;;; ;|U;d;:;;;;;]3;0;L;h;,a3;;; -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  T͊ GP 0  0 00  `PP   嫊 d ᢊ  W R d 0SS00D ჊4 ~0 ,;H;p;;;; -00QLX0 Q S R 1!B bQ\^P` VZ U5` V 4\p0 ?>1!B bQ 0h B0P` V0x t |0CKh 倇thKVK| 0  Q 0 ,0S ,Vogt;|;; -L@M!0!`(0 3 4dpK5K06K2 @0Q0K, R@KP@  ?K0BL D0 0 ?0PT C (0S P(o 0e%0 )PU@0Tg|U; ;;P;P R0$00S<  S \ 0S 00S 0 $000S 0S$00 0$0 R 0P 0S -LM@$0SPp P 1`1P,  P L1P P <1P 40 P  1P1P 1P P0P<@S0P! 0P ʼ0P0P 0P0P0Pʈ0P|0Ptp;"<;::;;:;а;  ;;: -L\MŸt !p x t0p A,0 p Bl YW| 0| Y I0W 0$0P00 l 345KY@H| 46KVK'0  X,0 S ,m0I \V0Kf`KPW0 Y04 E F \P`x0tp hK T(s3ds3s3s3s3Dr3s3s3s3t3 0CKUK0 ՅhKl0CK U0K0 \\@ 0CKUK@0@ |@x@X pUKdd< 0CK0 D <g;;;|U;t;;;;;;;;$; -L@M̀!!P( 0p00 0` (0S |(fm 3dK4@ 5K<6KR@KQD0Q@K,0 0?K0 f0S 0S ig0;|U;P; -LDMܠp P, 0`0 @ @hKX  ,0S h, m 3VK45K<6K 40UK00 0$ CK hK(g\;|U;t; -L@MĀ!!0@(0 0p00`PK0 0dK P (0S \(l 3RPK45K<6K00QPK,0 0 ?K g;|U;; -LMp\ ; @W 1@S0pT oDP`# 0PS@01S@T0S Y0 0 1 pbPW; -LMp1a @T 0PU 0PS 0U #DP@   Y  0 0p D @\  PU1SPU D00000CS(,z3y3@z3z3{3{3{3d|3 CP  CP@ 0 040iGjD@ك CP 0@ x1 1  @@ CP P0T0@ Y  00 PU@@ CP P0T0@ :  00 PU @mCPty *  0  @@ VCP P0T0@   00 PU@@ 7CPi P0T0@   00 PU{C<+u@@ CP E 00@p; 0-L@PIP 00h -PpL`pf B`Vh pC!dT! lcd@pClLXlftCpCh; -L,M` P @$Rp0S  0 R 0$S0S0 R 0S 0 $᷂0S00S0 0S000H0 P '0P  HY00Q00SH Y00R00SL0 oH Y00RQa 0%S0S00S0 0SL 0^^$@ ^ 80BS083Ԁ3333^t30 ^t30 ^  0B K D0KDK0,0 CK< 8 4@ 0 0H0Sx300x3t3@0t3t30t3`rt30t304 K(L^;@;h;;;; -L M 0 KT`(p 02P $\@\0d3 \ 0 p 0P $\$\x3S с;L; -LM@( Kd00"0P , 0S P4 0$S0S 0 DQ0(0  4 S4 d#h3  AP`@ }R PU@* 0S 0$S yp W1Q Ap W$ P@T 0 S q p Wp W P@T 0AS;x3X3l33333Ѕ3Hp Wp P0S pWP A0S 0@T `0@P0TA P0 0AA  5  1  -        0P sAl;;;;ط9 -? LRP3\ t333<3@0 0@@$0 WL\00I|# 2lA %W$0 0 $ `V, V 00 8(wW0<0 @ 000  C` (  0C W0, ˀ00@00  C`VP 0(0 ,`KWD@p FWX` @00 @$ h @00 @$ D @00 @$ ;`; :: ;;$:? R  x3  x3  -LMt0@s<]2s hV -<L0 p-LMD0`0S9 ޲` 0R& 00 P `0 0S`0: `l0 P h0d 0Rh0 ᖲ0d0፲$ `l0 P h00h0偲# 0-@L0< R0S0铲`0PS0hed0S0d0| -L M0`<@\  $0K #T$PP' 0"Q1 @T 0S 0S $\ \0 pW 0p W$$0@S$0 P#9 p-LM0@<0S hP`0U l`l 0S`l0h00Ch0 R $0S PU`0Sd0pphp p-LM\`2 ,2 0 p\6\- \00 p\0SPU0P000 0 " 0S R00 00 Hp20 0 K@T00DSļ3D33D3PU0P 00R20 0΅PU2 00 P 0R0ޅ 0΅20 00 0TPU2 $20  P0$(0!P:00p震e-0S S s 0S0S s0S sP   R 0B30 R e P0-L@ Tr @0S @P80P4 4 r0S000hr;teDU;;F;;P 0S S0S0 00 0 -LM@ 000CS0h` p-LM 0`S@P*kr$000( 8 0T0 < 040 L 0P0 d 0h0, t 00x0 | 庚H0H 0 @`, 0q0`pAr;\[;33; -`@0PL0p<XP7㴰0@0CS0 W p0 0B)p0 ax0PU|| 00S PU@ 0@ 0W ᜚00LJd|eX3ieQ Q -LM0 @  0 R=/= -LBKpL WLL0<P*P 04R !R,$ p(0 S (QPp PpBKpL WLL0<PP0 S;#S,4 Hg;;; p- 8LM8l# 20ATP0 U0`0CS0pꔌeDQ Q0H1  -Lp `112D@PT P1PU@Z`V㒧 P00CS0CO`J`VNZYh0PXX 00 S P0 0 a6HDd|e3ie -RL M@ R0K R K  <ʓ 0 0| J -LMR0 pR ,0K @0HS *,0QD @T<0% d 0 H@H0%0 8 4 劐0P 80U` D @@`T@! =@0D 0S@0<0Pd@0U`4 0 800Z80 L 0 00 00|0 0>J3 -L MP@0!K`P T!0[T0( KP "K(P"0[@Sp(z0 01R1 20D Dppp0" [@R(P(P"0[@S(T0 01R1 20D DP(00" [@R -qLMp`P 0( KP& [%0[UD@ 'P00 PZ(0 0UD`@ ' P!= -LM0 KfP  -LPlM@P`'5R` [5RE T 5R/ P5RH x5R p5R 0 <0)KP)0[0 5R 5RP P 0p KPP 0p KPpP000 T4R 6H4R @4R BpP <'t K30tL K^t0 ࠁ|0KL0 `PD0K| `pH 4@ x < 8@ 0 ;@'t3R. #h3Rv  Ppo 0s   0P  u']0s& 2RR0K0} 0@ t` R R@ 2R=  W;*W 0Kl0 d0K 茠h T P p \p X &T0S! !0!0"X10 P00 W T0S Y 'l K j; l Ke;P  Pp 0s  yP <0s  nPp  bPl D%Q 112Cϓ 0S 0S 0 000 0h0R112Cϓ 0L0HrUqUhU pUtAdU@iU@fU eUkUmU jUoUlUnU ~f p-L Ƞ M Ƞ,@   Qh`@ 0 X0@0CS0pꔌeD -0L.2A0 \` 4p)011RCO# h0  REp R 5A @ H0SpO yRA  0Sp锌eH 0-1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S T P 0S0  0S   -LBM p0004p`7Ps@tb0 \bx w0@0X0 @T@0s 3@R{ CKA A Bf0 ,1R6 #P111s- Q 0]1S,0 0 Y$0 (P @ B FBd00] ,K0JH| '1<0 S0SS!0@S40104;iS9De\[;9299 -QLM@CϠ m? R  0S T @ hy Q0- L@P Q 0|1Sm?@I p-LM1 S@P\`|P50p I`}\ɱ 0 ;i -0 RL`p@ @*PX@ P 0p000 @WP:!1E? R 1S 1S 1S m$>FO*B\ AmA>FOB A00Ba4=Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!P2P @T*0P\?@T:@T*0\%@T:L0W 1S c LK61q@TTP LK0|  @yTQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a0 00@W0@m004\[00$Mg(Mg; 0-LM00P@K4U 4 0000^ 00C$Mg 0 i -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ{@40Oφh P40RφL P40Uφ0 Pt;;;;;; -L M@K K, 0%P -t2L0M<00P00 @4 0p04K(18 K0(1(1<`K0(108@!4`Pt < 0S 1Z0L!48`P` < 0S 0!48X`PC <00SXp7 `0Kp0 (48prP `VF 1(Q! 0,Y,1`Vdp0 (48pS,1`V pڤ DK0D @@ /E4(1Z0(10#(10d 48`6P @Y`#40D;`;1;2|U;;d;;928$; Q0- L@P Q 041SN?@F -40PLF0 -LMp`@$L,  00cX00 (1,1`XPd@ P0E S e,1PU @,0 0 001X 410Sܗ@4, 00Jo骗N? R$1S010$1 0$1e0Q00 W@ - 0LS n P 0S0S00CS -L M pW` @Y0  X BPr 0 P4V*0SW 0PU:PU ᪾P '@(K@aှ) [0T<0D0 <0s W0 0D0D0S(!  X40 800 = X00P 0 S00S< )0[@T00SD    pX 0R0S 0S0S $X\[;T;;;;;;(;;Q Q p-LM`@0P0.HP)0@0CS0(἖0PUtt 00S PU@ 0@@? 0:0 㽺p钽ꐽd|e)4ie 0-LM0088@PLĠK^0 K0K@KKKKPKPKPKP[0 p-L M8`8@ PK00LĠ 0K#0KK 0K@K@K@K@KP p0!0 0KؾL 0SP -LM 88 `#4V *0X 40S 0S Q 0 @0  P0@b" ?#? UC1@8#P0S0/"?CQ@00CS0 @04< P0CP1 R> D0s; 4DH0P60O00LK0LP0P SP PP@kH@h딐HIPFLT`pH@@P 00 pMPH0 0 pFLr00@G00@0-zte=@;e)4 -LM080@# 0 <@   ( &VH;X;l; 0-0 LA0S 0@0PSH0S00]HLHPPP0S ٻPPֻLP@Pte -LM@0`ᴻPp- 〻PP& 0 S9#S$0 ᷻ $+p0W D@$K P Pp0 S9#S$0 ᖻ ; 0-`0LA0S 0000P0CS0 0te 0- LP@0!PP 0 λP 0S 000CSPPP 00 -LMP`@bV ^V000 4 080P@XY\` 0X0 Y 0\0 ` 0S4刻Pp X0S0S S0 X0Y R 00CS񟗩4444444444140 Y0X0S S0BSp44x4444h1444#0 VT 0S0@T<0S~ =Q{ X Ru R00e 4D0 cP i4<@0 YPX0SI 00p@墺Pp @TZX 0S/ 6S, 0S' S|2Y T00BS24343424 34P0 i0,U UU17P X S4>H0 P P= iU>0S4ǺP 0 S00S=  X0S 0@Tf 00S> 00S<  iTUPJ a > < : 8 6S(0Y0 00S PS 00\[;;;;t:;;9;;;9;;<;D;L;P;X; -pL`@P@P(PU@Z㐓0@0CS0̿`AT P0W1 !0 i sAp:@ -QL1  Q S 0S B -L`p@PPPU@Z@P`@PPU@Z鬸@`ꎹp -LM0@S  1S01 1S鶸P P1 010C1P1 ;Sh; -LM`pP @ 0TP@@ Ƞ,Ƞ S0000 R P@@q= -LM@PP`  h0!T` 0=0040 R PࠁࠓF=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @叹0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qrt$  ( 0P00p000 0 0PPEDd 0 P@00 0S Axꠎe= p-L M0PS@- 0BS<4(>4=40>4<40>4D@4t@4@4T 0R0P RA R*R# T00CS000@  0PPpph90\#  S m( 0 8T T 0Q0ph S(D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48 P`7 H00H0  R@1J#T ,K,@ < >@贷0S ,H"P,0S:0 S:#S@6H00CSH0 5S S<# Ďe; -@1LM (("AL0`SA0Pp: ıPP3 H00H0  R*#R$ H00CSH0 $!X >hD$K PHP0 S:#S$0 P P<ͱ Ďe; -LPP 0 !!$ !0``1` `HU! k@8>$=$ R 1 0+10 ,`(`|w4= p-AMLAO0P `0t P 0 C400|\\  BP202p# D`p'v4; -LM@? R#? R 5+Q P 5;5Q 0S010C1<P5 ;%5 -? LRP0p₏5@@ V)~o @xTڴ5 H , l7P9 7P3 H \ U Ndx2S 5O@05% +%w) X>)T0m>)P m܁(xC ;|w4=$; p-LM@? ?dئPP? 3'dϦPP = τ%dd @*nPP ̠x ` P)Up; 40Cp4 0 s4t4@;`;; 0-? LR_? ( R $@T d0@Ttc0 0-@LOPc000,  0 -P?pLP@`wt1TZ1TD*1T4 1T ` =%# = S =@S @ 8C8`2%2  . n2 # @ o5050 R0sj 0 4P`5@`0V l0T `0TT0P\բڠD0T/0`2i 1i i i 5i i 6i( p-L Mt0@0t0P``BO0 K`匧 1Sᬀp8ꘕ: -LM@h -00%P-@%LU  (xPS|P:P!`PpPP`PpP P ? rpbrpbTP P02 A A>P |ۥP0|2 xAޭ dA(P xťPxRϭ ,Aɭ A;;;; ;@;2,02 -LM@  20CS2h邬 -L MϠ ^`Pp  @0?0(0K:HCʠHC6 GD(K!K%K#@K"0K'PK&K$pKX@T -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0pp8A+ d; -LMϠ P`UCĠp@ K 0Kih 0P} K L0v @40Po[T pA! |; -LM82/ 6S00@ RA?< R 0, G0Sh@; 0- 0$3_(0LS $@T b0@T2a0 0-@LOPQa000,  0 -LM?D 0Rp( 00 ,0  (0S (( 04K4 [30[ d1R`hU&h@ P0K< 50 0 ~0Si 0KΠ =0!U @P`g; 0/Q 0-@MLP 0@Kl 0X 0@0@ @H(1[#4S4  <0@H 0@HK <0@@yHۭ 0@pHҭ H0@gHɭ 0@^0 04@WH㹭  0   0-LMP@ 0P@H(㢭Ϡ  ^0  0P/H 㑭 H0P&H㈭ 0 0PH | 0PH<s H0PHj 0P (0" -LM 0S0 0GP 009 -LM`Pps?0p2 aP@"0 $#?㕯@@"0R\#T3@/2RP@ p$C?ܬHb3!L p%.pဤ  `2?ˬ0< H" 0S;9830@TLlP 0 S00S\" 0@T} υ08e?0j  >/0@  0`K0`K0`L υ0E!?@@Y>~ 7  X0P10p|!5x1 t!0p1o h!40d18  <0 L!L1p  0)^$ R "0 " 3 U$0  |H <00S`"x00SX"s ip>\[;9\4;4;R; ;;``0+d:̜44T4؃4܄44444; ; -LM00PS0`A$ ? hP9dP4lP/H@H=|2p0CS25@O B^N 2 0CS 2|H 㚠mkiQ Q? 0-L|@Y6PU$ 1  !0 !1M|U0 o|@<60$0@|$0 S !0 0,(0S2020K2Ks@ 0 ql@'P4 -LM@$3S 5+Q P 5;5Q 0S010C1<P5 ;%5 -LM`Xzpp 7P0p $7P} /0@d 1/0 4?  H2 R95  0?L? PP p @;iy?L? PP p )Nd8  P_募%_@ %5;5yN! !0i!/0` @D `0 @, 0E@p,A;p;)*;;$484=; -X2LMQP@`pr42Q\*,2QH $2Q p%9 = S# =@S @ 8C8t23%t2  0 Ka [ 0[40 W:t2 X 0 KJ [ 0[40 p@ l505%@ 0 R0b 0,4Pp5@p0x0Q l0Q-Pڜ0P\0S\<0Q/ 04p{2i 1i i i  5i i 6i( p-L Mt0@0t0pP`: yO0 K`峟 1Sxpk; -@L 00%P-%UM dPRhP9lP `PpPP`PpP|P0$3|r%ibribꍟP l*P0l23p (:-p ":wP hP0h2p x:p d :aP dPdRp ,9p 9;(;L;p;;; 0-LM?@0TA KPK0K 0?0 0K00K0K0K@K@KK@K屠PPP[ -L M?@TA K0K ?0 0K00K00KK@K@KK@K呠P0 [0[4 p-L M?@\AdBT0 K  p@0  0K00KPK`KK@KKKnP00 0-LMQP@ ?0@00K AĠ0EKK@KPK0KKK0KQP0 0-LM?0@P K0K 00KK@K@K@K@K@K90PS0Q90; -LM0p5`,? <5 ??\ !?@?\ RU@ P5<5% ?@;;1D"  0S ;;!D0U@P5A= -L M?@ \K @0 0K 00KKKKKKK彟P 㞦8 ; -LM 0S4 0 0僠P 00\e -L MP`p;@$8 8C ᘧP R!1 p1/p2/1/2bb, K>P 8,@$ɝ0PT,ƝPL 0 S@00S0" 40@T(@KvP [8~ 0 0@5 0 0 X 0`g 0  v  㷚00S4"00S,"  8&8\[;;D;*d44d;(; 44 4(; -@L`  0S0Pv5p@ Z00Vv  p3Q Q? -RLM`pP P$ ; 0 0i PVv@#0PP 0 !!$ !0``1` `vU! ;v@0$ v$ R 1 0+10 ,`(`~o gd@8Tڴ5`   /r7P5 H7P/ $ # "  82S 5O@05%+%t De@0ie P it5;@4=$; p-LM@? ?$PP? #$*nPP ̠8 L Pg哙py n5pr |4`;; -P?LP@p`ks1T\1TF*1T6 1T ` s%% = S =@S @ 8C8`2/%2  `9 `y2 `, @ [5050 R0\ 0l4P`5@`040T(0P\դڢ2i 1i i i i  -LMP0/@|To t00t04Ys0 K p 1S sꘕ: -00%P-@%LU` 8PP<P7@P`PpPP`PpPPjrpcbdrjcbؙP @uP0@2~ s4x m4™P <_P0<2h x]4b dW4꬙P 8IP8RS ,H4M B4;;;; ;@; 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(Mp8K<P@~,0[+ [4S3<K@ K~P` !03< 30 Ġ(̌"Č!̌  P`T0 Ġ(̌L"ČD#̌L8#D !L 0 @P`6@<P Ġ4(̌<"Č!4L.< ̌DL8#D 0%L @qP` < UCn鎟 L 3< 鄟 (ꀟ ;;D;t;;;; -LM05P <5Ϡ000  m/B0T00p` @ 0ȠȠ W p" G P `HT@5O<5 H 8  #8 5# -LM @P/P 3 hˠ ; -LM 0S4! 0 0峚P 009 -LMpBP KᐘP  2 ` 0@VJ(2S ,2S 0P|1 fPHP 1qO@` P $2~ 1!0@5 1!0 X 0pb 0  p ͗P 0 S00S," 0`V00S0"00S("  4]2;d;;4;#\;(;4$44(; -LMp`ΟP@A2 =2֟ +0Slr`` ἀ!ΠT开0\D i靔/i2\[;;D;4g-= -@LpH2`Shpf0P0S 5@ Z00Vp|0H2Q Q? -RLM`pP P$ ; 0 0 PXp@%*PP 0 !!$ !0``1` `pU! =p@ *$p$ R 1 0+10 ,`(`; p-AMLAO0P `0` P  0/"-C4? 0@ 8\X  d吔P|20|2pq f0YpT4; -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 -L M0p5P@` n@~υ 0@/ 005  00 @ 7Pp v7P 42S %@ %5;5iUn P  /;$; p-LM@? ? RPP?  I&nPP ̠4 L P嵔pǛ /p d4`;; -P?LP@p`j-n1T[1TE*1T5 1T ` m%$ = S =@S @ 8C8`@2N%@2  ?  7@2 ?  @ [505.0 R0+W 04P`5@`040T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t0"/m0 K pO @1Somꘕ: -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPPPr]Xb꺓dr]lb.P <˒P0<2Ԛ .Κ .P 8嵒P082꾚 x.긚 d.P 4埒P4R꩚ ,.꣚ .;;;; ;@; 0-LM @P0ГPP 0@  ?PP 0S 0`9 -LM`P@0b. $^.02  "0 P'>'.0@ 22 PA.鈓p僓(PU>2s| 2sl l`2~OP$K0` ~ 8~? ,2  .2"0@5 2"0 X 0`#1  ]l w幓P4@7 ""0pTP U-P 0 S00S" (-0@T00S00S" xv$ <Po ,Tf(0!R@T^Pp 0 S ,(0!0"(1\[;;`9;;;*g(;0444r;;;; -PLlPp`00@S 5@ ?00kmr -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5  - !LMOPp `0]'>  P  ||  30Sd20d20K# p ^'4 -0 5P=5U@LP7 P8`PpP0PP`PpPHP鳑Hr[Pbꭑ0r[8b!P  徐P0 2ǘ p, \, P 娐PR겘 $,꬘ ,;; ;@; -P?`LP@pDk 1T51T&*0T 0T p j @ p>@ s50530 R03T04Pp040T(0P\2i 1i i i i -? Rt00t05,ꘕ: -LM0`5P@ j7P: 7P4 ?? ㌏Pp  ,imj?"> {Pp tpO0\  p%@ %5;5+;;`;4$; -RLM`pP P$ ; 0 0\ PNj@$PP 0 !!$ !0``1` `jU! 3j@$$j$ R 1 0+10 ,`(` (00C(0 ( R R(0 Sl00l0h00h0( ` fi 7Pl00l0 <P  ,i $;4D; -LM@?PU`0p ;i5V;U5 VV t00t0嫖 *V h (K 0ȏ P(0St0p000t0p01S hbY `; 0-LP@ẏ 04 P*0S 0P:00SQ Q?Aq- $0A0 0!q "䤏e -LM 0S4 0 0P 009 -LMP`ᯗp@T"* H*ᷗ P@$ #?@#0S#@62/@3S0 K᳏P@000400 嵑4 2>6080@0<0 `Tk80se <0sb @0s_ bh,`K 0P@JH ) & tP1tp!51 !01o !4018  <0 !1p  0@I$ R "0"! PC0 2g ) g02z)4ÎP  0S 0S 0@T0S@0S80S0S<dR)WP\[;;h;p4;495;4X4\44d4444;;;; -@2LSPotP0$0!g2p0CS25@ %I1m02ig0 ニ -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`K忏2P0CS2껓 -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK咏2P0CS2ꎓ -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PKN2P0CS2J -LMP`B哏Tjfp0/y 0 5 T  7PE 7P = w} u m {HH0S D0SP5P@@05%+%^f  T P0 Pf'$< $;P4=; p-LMBPT p+ >$ 64`0@  ahTph\h'Q Q -LM┡2 S`( tp5 U  <5   (0S (0K )[ 0)KDRU@ P5<5  0 f0S ` 5X0p !1PZd Y0XP0Pa $P 0 S00S " 0@T00S$"00S"  4y"\[;;D;d;; 5X5 5( 5n(; -@L``p`00PS 5@ 00` Є`nQ Q0m -RLM`pP P$ ; 0 0 P`@PP 0 !!$ !0``1` `w`U! `@g$l`$ R 1 0+10 ,`(` τ$ @poPP ˠ( ` P*V< 41 5 1  55@;`;; p-0LM@PQ00 5@ R R00R``V p|20|2Ç0SU(ph|p"0 |bm; -0`@LQPp+k^0T 0T p 9^505-h0T  R\  @ p@ "mi i i 0-P@P0L HR 0t00t0 1S 0hm: -0 5P=5U@(LPP,P70PT`PpPLP@`PpP8PM8rSN@bGLrMNTb껄P 0XP002a V[ PꥄP ,BP0,2K x@E d:ꏄP (,P(R6 ,+0 %;;;; ;@; -@LP`]!1pR001SP1 P 0 Q1  ^]M 10 1S]7 -!L000p0 @`Pf]0S$ 9]^] 0R000Sp0p00p&]h0|0h0 |000]000000 0@@0 K] i ig -LM 0S4 0 0WP 009 -LMP`p@t h~ lP@@<#?@#0S #@3/@3S4 KP@400400 4 2>ᕃ080@0<0 `Tp80si <0sf @0sc \0`K .0P@K %  tP1tp!51 !01o !4018  <0 !1p;  0@s=$ R "04"]} P0 2E\ _  ;\024P  0S 0S 0@T}0S@0S80S0S<l 갉 T\[;;D;(5D;t&59(;5#5%50*5D+5@,5 (5t(5;;L;l; -@2LSPotPo0|}0y}\2p0CS2?5@ }=402[0  -LMP`P p 2S Q?0@0$0K20020FGD$K#0K@K!KK"`K KpK2@0CS2 0-LMBPT 0K K 0PP[ -L MB T0K @K@KP [0[ -LM 0K\ K  P -L M@B$\ K0K K @wP 0-LMBL^B$L K0K PK@KK 0[PPP -PLBpT㓯e.[o @Tڜl | 5R r 5 C h 7P5 z7P- g> j <H0S D0SP5P@@05%+%Z: pl0Z?@$  /$;.(5=; p-LMBPT pLD <` 00@  \T ph\.'Q Q -LM2`Sp`t5 X  <5  o$  DRU@ P  0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 ~P&4<H0 ~PO̠D0x  `^20CS2pHh (]`a p!5`;; -RLM`pP P$ ; 0 0pL PY@PP 0 !!$ !0``1` `YU! Y@t$yY$ R 1 0+10 ,`(`| i4~uP 0@S 0T00S@  04L0<\[;;;;\;;;(;Te; 3P3;;; p-LMD0@SP`` 0Rd00 vrp0``0FuDsHfvD` Q0- L@P Q 0`0Sd@ 0-LM0088P@NK@0 0KKPKK@K@K@K@KvP0 p-L MXP0\`uX`Pp \P88@0!0U 0K"0N0K KL4 `K`K0K@KKKqvpR RRX r Q00R0#S0Q0X0\0s  0Q0\0Q  -QL M!0#  KK0K 808Q0@C4@ K@KK0KKK-v -LMh0S @00K K0KK0aKA K0K0K 0Kv -L`MP P/pP,K 08@80!0 DD,0K'@K+K%pK*pK)pK&K(KuP@0 n0 p-L M(0(KC̠PC$C80K00K@K: K KK`  000K< S( S0 KP@0 \0s X0s Tpp0K S  S000 -LMd0PS=@0s D R9 h`V @(pK0D0 @$K&0K(K'`K%@K#@K"@K!@KzuP0 0%K$K#K"K!K&0K(K'`KjuP0 0 (K'`K&0K%K$K#K"K!KZuP fLcLH<@(D0 P#rP P5 0-dPLU@D0S0sPDIrPHfDPPz EJz ?,;T;d\HR RRDsf e 0S00 f0f0f0 0 0f0f0f0<`<0f00Re00Qf00 -LM 0S4 0 0uP 00D9 -L4M`Pz{p@p  d {0Q0S@0D L0 P0 |P@ y  0`00sPw 4 {sP@ y 4s0P80 T4P0s- L0s( @0s|# 3 #S0W T0 0X D <0 < <4 @0 <1(0 , 4 8 0 $` (0 p!1TK\ 4rP& 0S00SL  0@T00S@ 04L000S 0 4SP < 0\[;;;\;;(;;e 3P3;; p-LMD0@SP`\ 0R`00 op0`\0rDqHfD` Q0- L@P Q 0\0S`@D 0-LMW0PXS0 0P8@ 0800K@0DD0K 0K KK0KPKPKPKK@Ks0R RR W0SWX0SXQd @ 0-LM0088P@0@NK0K0K KKPKK0K@K@K@Ks0 -LM#1@R#R<K Qp 'Qp KQpp8'48`0'Ƞ'0K@0@'\N&K$0K0$K( K%PK#K `KK0K@K(pK"@K!@KesKQp Qp Q p  Qp K Q p Q p 0Q p 3p  -LM@h0  0-@@ LP  @@< S@  S@  S@(d@n0 -LM`0@S a@0s D0f S Z0LLH4@, D0 @oP Y5 0-`PLU@D0S0\qPDoPHfDPx  w  ,;T;`0SH0R RRDbqb a 0 b b0\<<b0Ra00Qb00 -LM 0S4 0 0|sP 00l9 -L4M`P5yp@`  T =y0@00`D L0 P0 zP@ w  0\00pPu 4 8qP@ w 4p080 T8P0s1 L0s, @0st' 0504QPT0 P1̠@ < @ 0` , (0 4 D 8 $P P@ Tw 0 m 0TKX> 4pP 0 S00SL  0@T00S@  04L000SP  @ 4\[;;;l;;(;;e; 3P3;; -D0@pSLP\p`X0S\p0 nmy0`X0>pDnHfnD` Q0- L@P Q 0X0S\@ 0-LM?0@/PK0 K0K0@K@K@K@K@KK0KqP@0v  0; 0-LM@ @0PK0@K@K@K@K@K@K0KKuqP@0v  0; p-L M@P %@0` K0@K@K@K@K 0KKKPKOqP@prv g p; -L M(`KP!0@ p@0C&PK$K#K"K!K'0K%K(K*qP$̠P $H00$PK#PK"PK!PK(K'0K&@K%KqPP;v 0  ;P0SQ55005PQ0SQ55005QQ5@05R RR 0-(@K QLP U >ʖQ: 1ʖQ- KQ 0     008#(< S SwP0 LP0 S  S08#(00KQ Q Q ʖ Q K Q Q $0Q   -LM\0@S@0s D0S V0pP `K0 aV0PEUU V0P fL]LH4@DD0d @mP @ X =,;d54; 0-\PLU@ 0D0S nPD:mPHfDPAu 6 ;u 0 ,;T; -LM\0@SHR RR#u  DhnS R 0XV0 0R0R00R0 S00S0S0 0S0S0<<S0h`;RR00QS00 -LM 0S4  0 0pP 009 -L4MpPXv@P D`v0<@00pLM L P wP@y0mPr 4 `nP@f4m0`80 T*<0s! P0s L0s 004@DT0 h1 @ (0 4 8 0p ,@ $P k0x0f   Hf <0+S`d L ! T0S4XT0 [gP0hPD 0hP\ 0) 0X T!0@ 4<0 0 S200S1+ $0@T!00P P P 0  &p0 a00S0 00Sp0   XD;\[;;d; d ''' '$;;; 5 8; -LŸ2 RP0p  0  0SXb0Ss=09( C=@0I:!@00CS0i 0S A ` 00C! 0Pa0 S AP?AP#xAP =d1 (acX bP00j j cX bP00j j ycP kbP00sj hhmj TbEi' ; '' ;@;;;;; -0LmMSp  !0`B!@%=?ZDP U@@T,0 @  e0    b*bP0 j0, L0;9''4;'' '5\; -LM?pH0 \`,0 H \(A0S Q00C!0]0 S1 @D]00P p0pᴠᶐ,0@0000@ }@  p @b CD0P@@FoEd '''' 5' -2LM 2Rp` l2R `2R ]0PH"=p 0 00@0Y2@ BŸ   @Gb- 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0ASd5p5x5555555555555 0P 0S0S? 2K"K,pKsD0 ,pK2K"KkTd ' 5'*D> < ( -L@M`83? Q@ (3\ 3Q d3QA  ] C0?p0P% W@-00 00 Rh2  mŸ ` pa 6l2P@ @    B%-( 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&4V?G K5K]PpPW 0"K0C "K SD5T5\5p5d5l5t5p5p5p5|50,`K2KT0000000S:T0,`K@KBKd T '5'p;(T > < -t0tPL @`T0 0 q @ ǻ40P 0(00C ` 0@ d ''' p-QLMd@ P L0L 0 S ``p0` \d ''' p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S pp=P 0Pd '''' p-LM 0@0 0`o_P Pt0"Pg0 2 ;=9; -0@LQP 9U` UUhw9g PUHp  80  `00CS0e ; -0P@ LR0` t9Tp TThE9f |T h@h 000T`00CS0e*1S   ; 0-t @P0LS0\0@ 0S @0q_P%7  =_P7  0 ; 0-x 0P@QL` 0@0 Q @0L_P%7  _P7  0 ; p-LMP L1PHA = (0 ]P`A1=$0 ]P400=,0d P^P0M@%͠   `%_Q^` 00CS0pe.f L#`'f 4#f ( أ5 5@;`;;Q Q Q Q0 ' -LM`0p 0 0S"R; RR0 R. R 1QA 0%͠  @^000]00CS0d,A$!000>_00CS0d e0  0K ^ R0 Q# Q 9CS񟗹T5d5p5|55555<K@8   5;;; 0-l0@LQR RR R@P 0 40  ^00CS00h8d - 80,?0 Q B$0  $'' 0-@]L\ # 0S 0  00 S:0 S B<0   0ht 000'-0 ,B$= ' 0-0@P00LU000' p-LMP@m7T` 0 S0  Qph77n0  '' -@LPM7mpPB00h70 d̨5 p-LM p0@P37`0SH  0000Sph6~0 d '= 0-(P@L00h/d = 0-L0 L@68P 0000S0h6Pd ' 0-L0 L@68P 0000S0h67d ' -LM, 0S00 0, o5g'' ;' 0-@L5L P0DCQ 0 S 0h50 ''' -L$M@H`#Ġ(p$\$H(K' K%K#K&0K!PK$K"@K,` 5 [ (KP T0 @`\[,0K @`9\[_5  -L M@Ƞ,Ƞ0@ P -L M@0" P@ -L M@`P(pK P#0[PUP SS dX0 -LdM|K`@P  P, p0@A$|0KV0y Kx@KvPKu0KzKw`K# V tK @ 0@@YP  ,0 S 4,VG4s0KtpKg`; -LM!03 2 -L8Mp0T`KP4  0 0 0T0KR K@SKQKP K00Qy'JKΠ y>P0*0K"Kp0 0 )0Kd0@) K&0K4 >07!0K$K#@K(@K'@K%@K, 0S  Ogn p; -LMh:@SP `Ktp t0 S K U0 0KP  [PPs -"L|M0PK ,0 Jϊ  0 P@0 2 ,0S ,阐Kl 3`2 Qh00KP2 K@K@K 0@ K K0K@K00K!*0 0K0+ KKK0KK@K7S@K S000K> m Kp`P4@'pW @P`y'Ky>d@ 0.K K0K-@K/@K l vP@  P@ HP@P  0PP@}  0P@s|  0P@i  0PP@`  50Pw@Xg@9;n * + -L9R 0 h:S "K 0-P t0Qp 0n 0S0h:0\[;;D;,el g5-=5d; -`L W0PU@0p WP 0 S00S<)0PUPP hX~һS1PC1  1.001@ W6WG`h*12 |1 pP&N*. *PU@ڗ?0@7 (`1!51 0!1 \031 8! >X0) iѪ@0@ |*@0 @000:00S8)| zu ;d:T n r edD=5,5,555D5H5z  0-l00@ PRL D P @9S Q0WWQ Q  0S00 R-L`pP P$ ; 0 0 P0@PP 0 !!$ !0``1` `/U /@l$/$ R 1 0+10 ,`(`PV0L@0~  VP@74 U0S70  7P6 0- ^!L p@`Vp X UP0 `UP10A7T . p-PLMU`@P0S 0`S 0SPU@pU` ` -LKMt`@h2, PX0p ,0S @,5A0AS R RR ~XU @A   @UT@ -V>K U01S  P 7D$0@@ 0@A D  TTSP,0 S ,0 0@@<7KKl  .4 0 <ǜl0$ .4 0 @0t 1  9  <070 71 6G & N>Y0ڄ1!51 0x!x1 0 ( pv/L1!1D1(188! X0ҥ@0!:; 1 1!1* :oiO  4RP 0 S00S)0Yh00S)   o\[;;X;|;;(58 56 P;D=D=6L5455d655d)  ; p-LMP0@-+`L 9S P9S :* OpQ wPQ sPVQ09 p-0LMP99`@hY2QP`Ll  PPp @ Vp X p ;; p-LM@`Pl PPUti@ZpQli -Lp `XyPP\ Z P0SS *@L} R@d) 101d)d9d$00d)01d9d) k*d9S. *PdIY$^*d)$0S 0d)1 01d;00d)(d,d9<0d)8 d)1 0Z`9`8  ggpg::;; -@\ `PLPpd9SdyP\i -LM@4P 5A0AS { 00 'R - 0PL@ 7Qd55555S $)\ BP > <7l41,1a0<7l<7l'K O0!#R00<1  S0C⠐81 ') @pPP `$ 1 01 (U  ) @ 0$0($ R 1 0+10 (,PP   PKKP@ 90/. 0b98,0 S 4,@@ <7KKl  .4 0 <ǚl0$ .4 00 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDP555 555$5$5$5$5$5$5$5$5$5$5,5840,($ D:L:T:\:d:l:t:|: p-LMPK 0@#![>  01[8#Y#h #͠##: 0P`/ʄ|:Zj0.  0)- <0p -L`@0@.#cTdTDP@p  @~TP w9: p-LM`PV@ V@@|0 L\R@ ZT@  8 , @ ph  0-L@PUT T 00CS 0h) -LMPc0@1 @T@0>S @"cTdT  "bP<@7l0<'~OlV.0 NH p@ 0?}@pm !0@T`pFP S 1 > 0 /EPU1 >0 %EPE4PX8fP@1. 4A\ 0 @F\ EP Q 5QN n   =5;5%@ %7 S  l  mM `bgM LDZ9"VS ;  D;d;(5D;;;; 0-@P Z5L=05U   t  P9S 9SV0htF EYoF EYEYD00 .0-0@L PN% W0CQ  T 00HSAQ B00HS0 0h= -LM`d? (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@KE D6 p-RLP΁%-M`  0 pht0 tP0P@> @@ lPɅTI 0 phK6 ;2 4 = -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 6 6`; sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W.P  ;;; p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@Q|; -QLM@8 0C?. B"0 ;D; - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h9L; 0-LMT P0@L \  0 @0  P=$8P 8$8P <8T @ $8P@40 v}T00T0 00h@T0 v0u0 T00T0 @势)X <#3  \0 + ;8#(0$8P 8T0@ \0  ,  R,,$8P0 6=t; 0-P(0L0T0@08T0$P0 4PL0 0h p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@.ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00^@ᆟh1, \00Q0S p-LMP`,0@0P 0P 0PPP[0Ud0`[PP`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00h黩T 0@ T d00<0H 00㫩T 0@ T d00<0H0 0㛩\0HT  0d0T 0+ ㌩\0T H 0d0T 0+ ~\0H( 0uH0& lX0H0& cX0H0# YX0~H0# PX0sH0"HiHP$Q- -LMT0@h0S 0 ?C5A0P 0S0Q  0-T0@ L08P0 $4P0P8$ 4T0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000- 000008P0 $4P0@8$ 4T0@@ \0 3P   006    0060000 0S  < 0060 006 0060@006 000 00608P0$ 48PP0$ 4 -LP 9 p-LM@P`  |(0tH0 L8 P`0 T0d  $8P4 00 X0pph9;x9 0-(0PL@ F 0ES 06P666 H0"S 00 H0"S1p H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 8'l0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4% 8P0 $4P0@8$ 4@ 000 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP 9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph9;9 0-(0PL@ 7 0ES 66h6 6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% `0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT!6 6 6 6!6 6 6 6 6 6 6 6!6 6 6 6!6 6 6 6!600600060000006006 -LM@8$P 08 -LP 9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph9;9 0-(0PL@ 7 0ES #6#6L#6$6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% "g0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008$P0 4  00000000000000066 -LP 9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph:9;9 0-(0PL@ 7 0ES &6&6t&6,'6 H0"S 00 H0"SSp H0"S 8P0 $408$;P 80% X0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4000  00000000000066 -LUP 89 p-LMPL`@F  02(0H0 28L0 0P@?>C2<0 S T Q P0$8 40 X>p8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\   $4P@8$0 88P0 $4 -0$8 P8$08P 8L089;,9 0-@L8P0 $408$9P 8P2$8P0 4 P }U0 p-LM(0@`PH 0BS ,60,6+6,6 H0"S prvp H0"Sp H0"S 8P0 $408$;P 80% 0 8P0$ 408$9P 82p p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<000006 -LM 0T@`P  @%#,00R0S ? ;Z p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pph;9 ; 0-(0L@P0  H0"S0ES06/6/6060%w{0"p0b0L; -LM@'8$P 1<8 0- 0@ L|PRP  0?.C5BBT@ 0ħ0S$ P9<; p-LM@P`(0S  ( |H 0LP`8000T0 $8P4 00 X0pphO9;9; -(0L@pPA H0 S?0BS26@2626360% ` V 080P$ 8 0$8P 88$P0 4  5Y; -$0Pp @0 `0 ,@L8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  0060 006 0060@006  0060 ̦P x ǦP8$P0X 4000000060008$P0 4 ;< -LP X9 p-LM PL5 3S@`* L5 3S?   (0H0 P`8 0L T0 $8P4 00 X0pph/\,0L0? 0L0 X9;L9@9 0-(0PL@ 7 0ES 76(766676 H0"S 00 H0"S;p H0"S 8P0 $408$;P 80% @0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 000 00000000 000066 -LM@8P0$ 408$0P 8 -L+P 9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pphF9;|9 0-0BPL@ S h:6:68:6:6 H0"S 0 H0"Scp H0"S0% w -LP 9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph9;9 0-(0PL@ 7 0ES <64<6;6<6 H0"S 0qu0 H0"Sp H0"S 8P0 $408$;P 80% B0 -LGP 9 p-LM@P`8  t$(0lH0 L8 P`0T0 $8P4 00 X0pphc9;9 0-(0PL@ 7 0ES >6$>6=6>6 H0"S 00 H0"S|p H0"S 8P0 $408$;P 80% 0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@N$8P 088$P 1<8 -LvP  9 p-LM@P`g  tS(0lH0 L8 P`0T0 $8P4 00 X0pph 9;9 0-(0PL@ 7 0ES HA6hA6A6A6 H0"S 0$(0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000@000066 -LP H9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pphH9;<9 0-(0PL@ 7 0ES \D6|D6(D6D6 H0"S 0_c0 H0"Sp H0"S 8P0 $408$;P 80% 00 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4 00000000 000066 p-LM 0`0@P 0?.AB"(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph$8P04\;4;`9P; 0-(0PL@ 7 0ES G6G6pG6(H6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% ^0 @5$ 3S? P @ -LMp`B(0H0 08 L0Pp02 0d T0` P0P•L\PBp 0L\,0R 0*Q0 H&WT0X0?  R;X0 X00 X0i`0p;l9ix -LM(0@p` RP2 *R  H0"S 5 `P2L` ,P`0d 0S`0T0``0T06R H0"S H0"S5 0T00pP2L0 ,0qQ* Q T00T0QL0P•Lp ,P•00Lp \0a6SP•L00 \P2Lh ,P•0L0h \P2Lp ,P• 88Lp \06S/ P2Lp ,P•C2<0( H 0L80P` 0d0T  $8P4 00 X0pph9;x9 0-(0PL@ 7 0ES S6S6xS60T6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% \0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP 9 p-LM`@P  (0H0 L8 0?>C2<0 PP @ 0 0d T0P0 $840  X X0 \0  php$8P04\9;9 -(0L@`pP RO GR' p 00R <0S S j@SV@0SS, W00R0S H0!S  5 8$P0 4`0d 0S`0`R H0"S H0"S 8P0 $408$;P 80% L 00SRY6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Y6@0$6S8 0P8$8 0P80$8P 800S`$8 0P8<$8P 8<0SO0$ 8 0P 8D -PP 0@, 00L8P0$p4P08 `$4,0 0,0P0$84 00300 000& 00000P0$8 4  P000 , P'  P 0000000P0 8$40 0S   <w000000060 P0060006 P  P006 P0060006 -LM@4L0<0PS<<$8 88P0 $4 X0T<C3 0;8P $8 $8P <8$8P <8 0-@L$8P 98P $8PP40  ~ 0U0: 0-$0@ LP<00C*S. a6,_6<_6a6<_6<_6<_6<_6<_6<_6$a6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_6<_60a6@0SSs )PbP0 P2 X R M   08P0$ 408$0P 80l272$8 ;P8 0$8P 82 $8P 08$8P 08$8P ;82$8P0 22dP0h! %;;  ; p-LMP`0PS@(ph !0$!8PP81S9 p-LMH`0PS@p!0$!8PP81S@9 -LM@P8$0 88P0$ 483$8P#8 8P$80 88P0$ 483$8P#8 8P$8 0 88P0$ 4848$#8P 8 p-LMH`0PS@p!0$!8PP81S`9 p-LMH`0PS@p!0$!8PP81Sx9 p-LMH`0PS@p!0$!8PP81S9 p-LMH`0PS@p!0$!8PP81S9 -LM<@Q 0$8 $80 P88P0 $489$0 P88P0$ 408$0P 8 L -LM@P8$D0 88P0$ 498$0P 8p -LP 9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph 9;9 0-0BPL@ S Tg6tg6$g6g6 H0"S 0 H0"S(p H0"S 8P0 $408$;P 80% -r -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000C 00000$8P0 4' 8P0 $4P0@8$ 4@ 0060  @006  006000600068$P0 4     -LP p9 p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'H' 0p9;d9 0-0BPL@ S \k6|k6,k6k6 H0"S 0 H0"S&p H0"S 8P0 $408$;P 80% +p -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 - LN5 Ó0 ?0 0 姘P 00@; p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pph3X;el;99 ; -1`LQPp@V(0Q 0GS n6o6n6o6 H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@}p H0"S0% .r je79l; -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 8P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000000066  e7h0;H;|;9l; -L P 9 p-LM`@P  (0$H008L0PP 0 d0T  40  X X0 \0  &L0p$8P04\9;9 -LMR`p@P? 7R  00R J, V00R0S H0!S  5 $8P0l 4P`0d 0S`0`PR H0"S H0"S 8P0 $408$;P 80% L0P0$8 400SEt6u6u6t6u6u6u6u6u6u6u6u6u6u6u6u6u6` 6S 0S0S $80P 8$88P $#R4$0 h0Ppb U' ! 0ESWW 8P0$ 480$:P 88P0$ 480$: `X8P0 $408$0P 8WW 8P0$ 480$:P 88P0 $480P$0 8P0$ 480$:8P0 $40P$8: 88P0 $408$US0K4 ,0K |0S. 00p ;000d ' 0@L0|@<|@0Х<g:إ<<68<`<<<IJ6<Ħ< -LM`-޳ ٳ|0XㅀS 00 A>000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@*Х<\[;IJ6(66 0-L@PB  ,0\R0h (0 ,, -LM`4 -@m4(0|0 S0  ;H#000d 43R,3R*$3R3R*3R3 R 0 405 2R2R*2Ro2R25f:0600"SS22`00<08 80pW P yP㬀80pO^W Pp0t@ 09 l%04 p5S A,0K0K4 @tp5S P p5S `p5S4 9pt 0@ R0 0$1R:1R1R1R 0R00R} 0000000c0R`:0R0Z0R 0R 0Pt0R0K|0R t0G`0R d0BХ<IJ6$$K$J$$!$.0,66Ц<6$$$o&$%'v&qqʄ -LMp -l '|0S 00"A>000d 0 506 0 040080*2 `0<0 2Py 2Pu 2Pr p0t `0FS5880`VP \ 080`O^V Pĕ\  ,0K A0K@4S `4S 0 $  @$P0#4 ``<4 Yp0t  @$P ?` 00 p0t  $  @$P0#4 ``<4 u<0P f:=@0CSb`Х<IJ6(6%$$6% -LMp0t@  2"r,`9r2 d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY pt0@ Q ! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>AeœeeŜe -LM8 P8p0@ tp0@tD p0tH , p0tT @ @$41 0@00 4 @98U48 < p,@!8,27, 2<O^< p4Qpt 0@ p@t 0D pt,0H p@t00T 8o~4! 0T0` D#@3 QQ 03Q (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q 2Q 2Q "2QQ{ 2Qx |2Qu t2Qr l2Qo d2Ql \2Qi T2Qf L2Qc D2Q` <2Q] 0,"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 {< R <X< @93<  0R0` C` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 [%&$!$J$K$$$$$$$o&'vȜe -  808 0 0 0 ŜeœeeeE-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Q긜eœeeŜe 0@-P@ 000 000 00Ŝeœeee -LM`4 -4|0 S0 1!00d 0 405 1Q^ _1QZ 0601p`0 080< t@ 8 8 80pWP & g0Pᬀ 80pO^W Ppt80@ 8  0l%孮4epŕ\ ,0K4 @0K@!@\8 8 pŕ4\ 0j0,0Q0Х<IJ6Att6Ц<6it -L MP`0p0t00 0H 40 p0tP 0p@0c,Ÿ2t@ ,  p,@ pWOYOpt0H p@t 0P  ! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0ح00g0fc:ac:\c: t< -LM4 .0`S,0#4080 408 "3R 440  0 p0@ p0 P <S  40S 3%P 2P }2Ps 匭0604E0|0 S0  60+S2 d000 00"040` <588Q80pW P8 P㬀80pO^W Pp0@ t g0 l%J804 p5S A,0K0K48 @p5S P p5S ep5S4 80p t 0@ 0S0 1P0?S 0}0y0S0P 0Pk0j0P 0Pa 0  p0@ p0 P =d1t0Х<IJ66Ц<6$<,<4 W 7 04 0 4S@,0K0K @A4S 0WP W @$PP  < 4P  0v$4╫ k< 000d 0 506 1!`0080l <. ,0R#480`ㅀVP \`  (0K80O^V P@,K@4S ``" 0$@  0$0@ PХ<\[;IJ6|666< -LMp`  ,05\R(0 0 1Pt@  0\idp0Pt p@t0 , 80 ,,pc: -LMp` 0,  Rd`?ڰ#0稃!01Qx@  |3\t7`#0 01Rx@  <\($#0 01R|@ 0 ,@0S 666466 ib 0iV   0S1 0  0PXU22002 *0#P P i! 0 $  $ 0 $ 0 $  0T |p0Pt p0t @Dqhp0Pt p@t <0JTp0Pt p@t0 #pc:Pܧ< $0 2 H$0 t( $ 0 @ P@w00 ,2R0Aq  0\fa0|0 S0 4 !A> 000d 0 506 1!<`0l 8 0(K P l; 0($ @PD1(`@ (Px U! !@18 3d1TP@ 0S 4S `U hp0Pt p@t 0KP000 P$013$0@ P⊡ X00P  PPX, 001  8   D04$pc:(000d @4@5 Ɵ RR VR vR R RR X6R P6R R R R R R~ <6RRx R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8`%\5QQe P5Qb H5Q_ @5Q\ 85QY 05QV @5@%<545  8p〆  WpPA` t 0pd@0t 80pW 4RR |4Rᐄ 80 \0 $0 T0 $0 T80pW P P#80pO^W P0h#d3QQ X3Q P3Q H3Q @3Q 83Q pt80P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 8 '$i 04 4S 0`"QQp $2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0K4B ,0K@4SI !1QQ% 1Q" 1Q |1Q t1Q l1Q P 0X!QQ' H1Q0# 8 4'8  0 0QQ 0Q 0Q 0Q 0Q 0Q >A/>:4 064@0K:r꜀0 L0P 6@060000:00GhMhbiMibuuRurХ<3M8M0MIJ627-e2e7e:eЦ<77P87 97:767 -LM`X0 t3RR^ h3R[ p,@PpWOYo! 0 T +  2 "   0P2 2  <\W  p !t` 0 P2P"008 $2$"0080 $p0tP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B0 T0 G  000S |0  00S 9 ! \00 0B0208M0MCe=e-e2e7e:ejn -(@qL` 0 T $0@U , 0P^h 0T   T  0S00 -LM0` ,8pWP @4!S PONU @;2 6\  0p 8V$< -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q 0! $8 C6P8  l0A  0T0@ $  hMhbiMibuuRurԪ< -03a`pM@ 0L P m0$0 10 T5 $044 \ -`pfL  P 0m0$@0 0< T 0\ -L4M@ pVwSD6Vxd 0,K P- 0,$4 0%Q] c5Q5Q:5Q5P 5 D p , (xx0S T40S NLP0K  0 PPNPP|,5 0x,00 0P PP4P 0 $4d  005 0$40060` <D4P 84P04P:(4P 4P l 04\0H ,00808 3ZH0#3L P0Dp4#P DӒ  03jx1ଐ 㜐l%|p RP|H 0 1cA8 4 0#< 0<0/8000 P 0`< PLV 00P P`@PD LV8  01ca 2 0 <0&.<000 P dD qP80U<0/L000 P@  30<@ ,@=P0<0@ \!0\ sA1` \080t!t1h l0Lh1P \1P T1T1P0,1` \0(1P 1=<@0CSQ 0D0 D 00Q 0Q:0Q00Q 0=C0CSpK7L7L7xK7xK7xK7L7060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00Х<\[;IJ6L7,P7 -L,M, "0 p0t@ 4 p0tD p0tH 08 p0tT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOpt40@ p@t 0D 0!Q pt80H pt0T <Q,o@0< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< p0, t00  0200 00   H0<0< 0  < u000ro:o: -80ZLP `@p0 $ 0S 80`ONVp @ e00S0 40 TԪ< -LMP `N2@_p0t$ Ps  $ 0@ P m|0S 00t!A>000d 00 506 P1P!p<0`0l 4p8p 0(K P ؍ 0($ @0(P@ (Px X   @183d1 T `@ 0S  H奍X 8堍 <Х<\[;IJ6(6(V7С<6< <\<;-|0| H t0t L0P D0d 0`0 XX0X T0T P0P L0  0|0 6а606T7PT7T7T7T7 - 0$L0 $ -LM@ Ġ00 T - 0$L2 $ -LM@ Ġ20 T -LM@ Ġ40 \ p-LMP0 `$x0@4 0$0 0 Rx0$ ph $  0S $$ 0 0 ph .<000d 0 506 0`  <08 -pP +\  (0K80pO^W PH@,K@@ĕ\ 0 pХ<\[;IJ6(66 -LMpt0`@ p0P t@8喈Q|0 S10 !00040 1d  6 `0<58aLp@0tP 80pWP \p $0K80O^W Pp0t@ ptP ,@(K@`Х<IJ6h76 -LMP`p0@ tpp0P tp0WT X t0 07 80 0, 40 ,A)^όpt 0@ p@P t 0pWT X 00t,0So! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`(-媇 e|0 S10 !000400d  `0<6 58v80pWP \ 080pO^W P6ĕ\  (0K P@,K@ĕ \ 0B`Х<IJ60l76 -LMPp0@t@ 0@ 8 p0tH p0tD 4 p0tT , ,p,` 0pWopt 0T p@t40D pt 0H p@t80@ ,\o0,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @ g:g: p-LM 0P$, (@0Ƞ,Ƞ\`p . `0^ phP0$SL0V \ p(0$S,0 So:727$9 -LM p$0P PY 8@4P,`K 00 `fP 0 0 `[P 00K P x>0$ X10  (PL  2 02< (1!Q 1Q  ? ]i 8 S 0 S Y $ $@ $P< $`0 $0 $0< ꀬ<Р<(!W9D<;B $o: -LMPυO8 wk0 Ask3 # 00 3#3/ @ +T,HL$X…PąÅPI("0BS񟗛s7s7ps7s7u7 0K c +2[ ""L22RD02z"02=?0?En ` 0Pg!`02>IN0 @ 0PR44]P@.P: Px3 ~O ZJ2`cN,1N=P5<2S 0(5 [0,4 0Z02S(e0 02>0X0u?P  P  `5@05%0+%;i0! 032 S0( 0 00Ȭ<  0-PL 0 SD0S6p77777777777777777 00/00@C00 06Sx0 h0 T T006S  0c 00 00t< -LdMSC 0S`h ` d t  0Sp 4  A 0x Ė ` P@  404x08#(00CQ(ŖTh \ Pl h x#\y$,0@00$ 2  tP !P@0U0Px l(0l \ (Ŗ(Ŗ\TM X"d00`0`00xĖ(0S40 p 40 t$dĖ(0S ^ 2^1! 0\2 S ` = R`h $0 ( $0 x (x0"00b0,0 \0K X| * d\0KpP0tP d  4T K4 0 00 0P|0U @PX :kh044$04x$7470488 - 2L@ 1\`! ,0᳠ X Up 42 0!X \(P"x U/P0 "@\^P \p3Q> 0P@ Amf88 0-LPㆿ@0hY -= RL B/+ 0B>>Q P 5%0bS 5 % -LM 2@l2\`d" , 2–@\P@"C.,U  2"rR  , 2"聟QR@  ,T 2!, 2@!,T 2!,P 2+, "@0+\ 2"R  $5\ 2"R  $5\ "$5 \ "$5 \ "0+\ 2 @,QΆ@0  88844(4 404 0- 2LP,,0@% 0 000 ,\0 -LM2 S, `0pZ ATP @ ˯K "Q0S5`<5V P GUT`@V*K 0)2S ,0S ,g 2,, 2@0,\_?   2,, 2@0,\ 2,,? @  2@0,\0 g< 0-@LP H00 R 5@E 0&e0hȽ Xe= p-LM 2P , 0`9 1 R pCN@-0S  2b3c!0#D=d P0 P00[0ph@20CS 2-, "6-\, Q 0 =d [<> 0-@Lgd0PAd5=50h 0-O 0PL$ ?2..0"0 $ l0,  $P0 / P,2 0CS020~< -LMُ p$ P^ χ0ҟOP @PPj2S"@ 0$ 0CS@@'T`5·0;N_ P@ P`P(+2tS* 0,K P@ ,$ P0, p (P Y~U~U P~N~ 0$ `d χ0O_P@ P`GP $긮<Ԯ<Р< |7\;D<;\[;< < 0-PQL@p3"3SS3SS 3SSS0H3L#P3T#X3\#, 0-LM_@S0 5$PJC 'PA(1Q20CS, 2*,).0?;C0C ?; 8c0 2].BS B-> 00 * 0 $30"bP0}0 Kb1[01K![R0V$Pꌠe( ,1+Q  3Ė  0Pp%4 AQ4 0Ė$(0SP$,0"@ $0  (4$㗪I47044704ggpg -L MaP 89PZ 6JlÕM. 00 0ą   P@  ?0pPdĕ 00   0 Pp@ `&0 W p0W `(Pp@0Wĕ(0S $0 ($ xx <4< -80LM@IP 00 -LM 2,0\ "˜@P4\8"1B/\^u "@0^Ę"F/2,P\ 2˜p\`!E/0\ 2"R. +0\2#6I4R@@ SC  S=  S7 X1"R2 @S "0,\ 2˜@\!0.\  ˜0@\ J/0C\ 2*, "<*\DH @DHDH "T4H \ 2 z?\w (((((,( -LM`QDP& 1p @Wp\ (0S T (0 S$ $P0S0 @ WP4S04w8044Ǧ$0(T$04 -L$MĐT(0$S@0 0@ 0 0Q00Sw 5@t Ĕ@ @( 01Rp`C0C D0 2\20o $0  (  $0  ((62S 0 0 0@ 0@0 0  0  0  00 - 2L 0\ -LQ   0 0\ -L M@K @ AK 0ZGP0 -LM00 @$0  0-0L0 P@$ 0 - L <$0  - L <$0  -LM0p0$`@ P0  p}0@S&K  2[:: 2KA-` ^0P@p00`0A  S R0 ApQN `000 000p0 -LM2S 2 , 2+,S^ Pm0@ l+0, `  2),R~ p`+0@ }0, p`*0@ U~0,p`*0@ U~0, p`*0@ V~0,p`\*0@ V~0, p`,*0@ W~0,p`)0@ W~0, p`)0@ Y~0, p`)0@ Z~0,p`l)0@ Z~0, p`<)0@ [~0,p` )0@ [~0, p`(0@ }0,p`(0@ }0, p`|(0@ ]~0,p`L(0@ ]~0, p`(0@ ^~0,p`'0@ ^~0, p`'0@ _~0,p`'0@ _~0, p`\'0@ |0,p`,'0@ |0, p`&0@ a~0,p`&0@ a~0, p`&0@ b~0,p`l&0@ b~0, p`<&0@ c~0,p` &0@ c~0, p`%0@ }0,p`%0@ }0, p`|%0@ e~0,p`L%0@ e~0, p`%0@ g~0, p`$0@ }0,p`$0@ }0, p`$0@ i~0,p`\$0@ i~0, p`,$0@ j~0,p`#0@ j~0, p`#0@ k~0,p`#0@ k~0, p`l#0@ }0,p`<#0@ }0, p` #0@ m~0,p`"0@ m^0, Pnn0@ "0,`˜ \t%0x D%4,400D&T00LŘ0%0 00l0\%l5  t  2!,S~p`!0@ }0,p`!0@ }0,p`p!0@ Y~0,p`@!0@ n^0, Pon0@  0,` @8@@@@@ @(@0@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@ 0-UP L@ WrS  Qr  KrW  Er  l?rc  X9re΄ 00.r (rR  "rS rY r%r%rZ rZ  r[ q[  xq_  dqaN@ P0hq`<<<<Ա<<<4 0A @>-: 0p01K![t <@8#X N[/q!y012 s=:CS77|7|77|7|7|777|7|7777777777777777|7|777|7|7|7|7|7|7|7777|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|777777|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7777|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|7|777777777777|7|7|7|7|7|7|7|7|7|7777|7|7|7|7|7|7|7|7|77|77777|7|7|7|777|7|77|7|7|7|7|7|7|7|7|7|7|77|77777|7|7|77777|7|7|7|7|7|7|7770S" S000 0CSH7H7H7H7T7T7T7`7l70\00`00d00\0h00000 0 0000 0 00 00000 -LM@Q01-0R/ 00R0* R( 0AS777777777777777777000 , 0 1 000R 0{(` -0LSPb 40S\ 0 0\0,0\ 0+\0 @, A0 , p R R! R R 0BSp7p7p787p787p7p7\7\7\7\7\7\7x7#* 00CS񟗅7777777777777777 ԯ0 ,0*0 \0 ,}㻯 0BSC R R, 0 0\0 , R R 0$#, 8"\<  Q0,, <4<,\0|", :P"\ @%PVP U0 ,0*0 \0 , 3 \H 3 1S ' 3 \<1&Pq0*0\0 0\ 0,, ` @ 0,\0,,@ } @`V  1 \,ڮ G%4'0 X N -0L SP1S 0-,0p", 5"\0", 5"\0s0CS"777 7d70-,0@+,B`uD BB0-\ 0-\0 ,0` ,0ee@0 \0B0 0+0CS0vǓ,0`-,@0S= SS r0 ,0e0 \0-,0@+,0BB`ED6u(8(9IM -LM0PS[ P` `@T TB@T) @T  Tp p`V*0T1R,,0\0` ,V@5:@0S TT T 40S T ]@`TT 0DSZ777770+,0$0+\04$,0*+(0#\0A.,0/  0A.\0#,0&0x#\0l#, 8488#\@T 0S =  #SSK0 , 8 \;?$0[,, 3[,\"@k0\", 848("\@VM@K 9 K52[[`0`S "Q:@7 01K[ K0 , 0 \@ 0,\0 ,㻬<@ 0,\0 ,堬 08 \0S=pp SS 0 ,0!0 \_(9(8:IM -LM0@S 0S S0K QP ![,0R 01K![^ P -LMP#P ( R Q0(0 Q$1S0(0 Q| i 0Scz0pS 00 ,2\0, <\0( 1\ <.\(0`0@\!0Z/\0@!\.0\1S  @<\8!Z/1\0@\<!.0@\< Z/50K Pp  1[02 \Q Q 0K Pp1[: (_  S00 (0X0`!h! -0L0CS@`n0 ,0PS^  P JPP&(0SH7777q0^/0\ 0 \0 ,pO0S 0 ,P P=0 ,P1U2U0000PDp@p0Sg`0$ ;\'  -LM0@ ,0S10@ +0 \^ P iP0 SS SS S S S 01 KV1[01K![00a-0 \ P -LM1PS ` P@ 宪0S 0,, <4<,\ 0S P@`K P@0 S Sg1[ :1K ![P@0S% X0PpS0XS00< S)   P@![ 0  WT W  ^P@;1K![W:*!K1[; P@1[01K![>P@}  P@v1[:1K![ -P@l![0*0Q!K1[: Q1[: 1[:1KP@Rk: 0-LM1@S[ 0S 08"PPK jP1[:1K![P0 , 5 \ LPP1[|01K![P` 9P1[D;1K![P( *P1[ 01K![PPKU P1[01K![U !K![P P1[ `0R1K R1[ 0 1[`01K1[ 0R1K1[01K![xPs Poj40R 0-LM1@S 0PK P;1[;1K![` !KQC 7,7 7,71[ 01K1[ 0R1K1[01K![@Pt0S P1[t p0R1K 1[<1K![,!K![%P0p P0R1[<1K![+!K![P 01[`01[@0 A -LM<@/0<,R/0< 0S<0< P  KcP1[<1K![P0S01P -LM0@SwP Q :PP -LM0P0CS!rP@  K3P@2[?02K"[`P@P@0SN 0SSD SB S: S2 0S) |P@ `pK @T @T 1[`08#h VP@P@ FP@P@ }P@ Q>Q.2KP@ 0-8LM 3Q01K@PA. 00, ?0 0A.\< KPU1[1[;;1K![0 -0LM 1K@P0A. 0, ?00A.\8 KVP0 1[;1K![00 -LM K@AP? 0SI  K 8P 1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K(0S7X7<7X71[;1K![P  0S ![ P1[;1K![+!K1[;K -L M0@(@ `,P" K[P@2^02[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0SS S &K P@ 2[:2K"[*"K"[(P@"[!P@0S5 BKP$pK @T }@Tx2[}0E8#X 0SSn P2[| e@T \^0EP@8V#X 0S S  ULP@2[ 02KR2[2[002K2[02K"[UP@  0P@2[p02K"[P@{ P@t2[;2K"[P@j00CS0S0S]P@ fP@SU&K P@G2[02K"[@ "K"[qP@H &K P@12[`02K"[^P2[@92K1꠆ 0-0@LTP+?@@@, 9:6+\0 ,0 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,(0S77770S0 \ 0-LM @0BS0SR 0SP R0S0PK +P %P1[   KP KP![  1[  |0S 0(0K KoP1[S(P; S ; S |0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST1ST| TP 0DS@ 6T 0^/,P' '0-,@0 3@1T0^/,P0 , @ 0^/\ @0 \@00S00 01^/\0 ,0A`0 \P` 7 S&pK 9P` 2P`{2[ A00CSv R0SORK 0S?IP`\1S (K* KsP`R2[S 1S~ 0,,0 0,\@ aT 1Sh 0 1,,0 0,\U*P` 0 \0 , 0 \0 0\ 0-,@pT0S01 -LM0@S?`p0F00 PU 0S 0S 0SP0S0S P0S "K ]P2[P  SP dR R2[@002[  0 ,?@d0 000 p-LMP-@`K %\ \0 1[ 0D8#Hp p順 -LM 0@6 \0 , hu -LM 0@6 \0 , h] -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , .P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm -LMh0!XS@`+d0S& Pp 0,0 `徢`V V 0( 0\ii\[ 0-h0SL@!Xd0S0h}P0@ , 0 \0h\[ -0LSP`= P5 0SS& S$ S p 5@pW0SW((**P@ V("(P@ 0 , p-QLM@`P.0S0(6 \@20 ,@?Tpp ; 0 p -0(SLP`"= P5 0SS& S$ S p 5@,pW0SW((**P@ V("(P@ 0 , p-(LMQ@"hP*0S0(B6 \@㇡0 ,@ Tpp 9280 p -LM0S@ P! px8`8V04 \I04 ,0p, -LM@08P `#x ?88PP04 \h0, -LPyP@ 0SuSh p P@_0 , 1` \0 ,0 SdР 0 \0 ,0 S.㹠0 S S jP@ 0S  0SZ@0,, <4<,\占 0 ,p0 ,0L@0 \0 ,De0@0 \0 ,' -LM@P  00CS0 80 8h 80 80 8:P  00CS KP1[91K![0P -LM 0PS` pK0., H0.\ 1[<1K![,!K![ hs1[ V < S@@ T0, 1 \`a p-LMT01K[ 0K a c? #P80S S p 0 , : \Rp麺' -LM8@(\p!X"h7 \'V00 eV0S0S$ 80S P80S  0@p 0_@ 0i 0i' (-"@TLP!x8`:P6 0WSQ   !T*0 "! 08#H+P T:T: -LM8p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,02x08#HTT x08#hV:  ("({  B("(t -L M0SP)K*K4s S 0S 0 ,%o 00 @J4@ 00pa0 \) KJ d%) [ X* Kd40 SPbT*0[@=#=*0K* [0P0T40 S'@* K*0[@0*0K* [P 4@00 @0 T000 '0d)0Kٗ) [ X d0#4*0K 00 00 0!,@0 ,` @⯗T:T < S  7 @\T:T0M0 ,` @⋗T:0,0\꠆< p-LM@K0 `Pd\0  [ ȠXP0![00 p p-LMP@`K0 C08P#H, [T 1[#4000C S /8/8\/8\/8\/8\/8/8\/8\/8/8@08#H T p0 ,00#0p - @L> pR0 RpPU `3)*0R1+@ 0\0 , 0S;@0 0\0 P,U` 5:1Spp -LMP, P Ppd W11@`2**0P1+@ 0\0 , 0S;@0 0\0@ , T`5:P` `@T*0P1R,,0\0@ ,T5:@ T*,` W0 *p@ T`:;1SJ0 S2838H38h38\0 1" 0 2" \  \00  12\ 0 3"\ 0 -LM 2R@PP0RqR,,, 0Rh 0RR,,0\0 , 0PE!R,, 0SR,,0\0 , 0S!R,,0 -`0P4L@8UDp:U)U' A0U!+@ 0\0 ,0!S +@ 0\0 ,81S -LM@PP` P 0P0V,,0\0 , 0pA!V,, 0S0V,,0\0 , 0S!V,,0\0 , -PPL`p P @0TP1V,,0\0@ ,T;!( 0r` p-LM0@Sp0,,0K PMQ![C (1RRQ!18 1K`P1^3 @R 888888\98\98\980!2200@S 98H9809898H9809898H980!22008#Q0!220!2200 (0![R 0p!F -LM0@0C S\:8\:8\:8\:8H:8H:8H:8H:8H:8:8:8:8:8 P <  P0S S  0,\0,, 000 0-0L S0S@ @ P08#Ƞ>10S (AR 0,\0 -LM0@0C S<8<8<8<8;8;8;8;8;8;8;8;8;8,&P 0S 0,\ 0-0L@ ,0PS:S%S  R 0S R  0 \0 0,' WU0SW 0-0L@ ,0PS:S$S  R 0S R  0 \0 0,& W0SWU -LM0@),0 x(,0 \(,0 @(,0 $(,0 (,0 ',0 ',0 ',0 ',0 |',0 `',0 D',0 (',0  ',0 &,0 S/ 0&,0 &,0 &,0 t&,0 X&,0 <&, 0,&,0 &,0 %,0 %,0 %,0 %,0 x%,0 \%,0 @%,0 $%,0 %,0 $,0 $,0 $,0 $,0 |$,0 `$,0 D$,0 ($,0 S/ 0 $,0 #,0 #,0 #,0 #,0 t#, 0d#,0 <#,0 S0#,0 ",0 ",0 ",0 ",0 ",0 S0h",0 @",0 $",0 S0A,,0 !,0 S 0!,0 !,0 |!,0 `!,0 D!,0 (!,0  !, d@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A -(QL0T  ,Q(P 0\X -(1LS   S\-0\01 *\=<0 <<L \01S \ 0<01 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ 0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CS L8 L84L84L84L84L84L84L84L84L84L84L84L8L8L8L8L8M800040,00 ,-0 R4 Q 9 S0 S00 ,00000 S0 00Q000 40,  K;P1[0?>C20 004 0 -0l@`L P0p  \0@  0\ -PLM8 PP 0Sp Sr S> SS 4K O$p@040C* K08Pd`#H2[Ġ0L8oS  0Q 1P8 T#X 000c8X ER 8004K $`@0* K08P#H2[0A 8}S XV`!TU0f8@!#X Y7#X,! 0AS008  * KP2[0SO8O8O8N8P8<08 0|<s0s00* KPn2[=3S񟗡TP8`P8lP8xP8P8202P0Pn0n00r:r:r:q: p-LM 0@SSP* SS S S p KLP1[    `K @P![9 S(800 2P1[x K*P1[ -LM @RR R R00R0SR 0 K P1[ 02  KP1[? -LM4`KP@ 4# 0S T0S4 X0S h( KP@L dP@4S-[P@* TP@3,MP@<"[DP@X ( KP@ 4P@t#-+P@&Kp @T#2[92K"[)"K"[08P@#X3,P@"[P@00*K, KP@2[S{6K8 K5P@u0S/ X\n3[1Sk&K  pKP@`bč  @08P@#&0[pWWd`X:K0X0i P@B 3[1S&Kp @T2[92K"[08P@#X00r:[/ N5 -LM@Q 0S0K gP1[L'S  R  rP lP p-LM @0BRS`Pp0 S S S  KPVI0 S S; S/ 1[01K![>P0S S p KP1[01K![(P p KP1[01K![P p0P0.\1[01K![P p<S/S S0 S S$ S 1[01K![P K\P1[01K![P0P0.\1[01K![P p0.,Pq K0Pl p p-LM0@ S`PpSi  KPV<0S/ 1[01K![P0S S p KP1[01K![P p KP1[01K![tP p0P0.\0S 1[01K![]P KP1[01K![NP0P0.\0.,P 0-LM0 S@!K S 0 KP 0 PPK P1[<1K![P P wP1[;1K![P![ p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 0@ T T 0 0 -(LM8" , 0 #Pp 1 R Z,`K)C 0b8#Z4 *@ 0  8#H T 0 0 !,0"+\08#Z:40S @4 T04'070 8#H T 0 0 !"+,0\0  @0 !8 "+,Z,  0  8#H T 0 080"+,0\0j0c 8(#" p-LMP0`0@0D 8#H T0a0@ 1!"+\0 ,08#HT:p -LM0@,, 0,\ -LM0@D ,0 S P RT[ p-L MH @0$H 0K KP!K!K`AK\ 0 pK\ K~\PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT p-LM\0PSp0 ,8S@ p`V P0P ,0@0 @,T p XT[0[ -LM P,P@ !$P@ P@`pK @T S@THN1[0S 0F8#h  P@ P@,P@׉ P@ P@`  C@T <@T4 1[0F8#h@BP -LM40 S@ 0, 0 \ 0-40LSP2N 00 ,0d w@T 0T 0-0L0CSP @0 ,0 [@T0T 0S 0NKa p-LM0@SdPg:SS |8p0 ,gg0D ,0 PUpU' 0-`0LS@00S( 3P 0 ,0 0l \0\ , 2PU 0U 0!P P[ -LM`0X S@0,0S  0 \P[ 0-0#SLP@ 0T00< ,0 @TTP[ -LM0H S@ 0, 0 \P[ -LQh 0 Q\ 7 0,00,@ T[ X -0LS:S< S 0,T[ 0-40LS@P1 S 0U[,?0Q[,\0 , 8 \0, ?00[,\40 0-0LS@dP 00,,0 0,\0,, PU0U -LM0,S@ 0, 0,\ -L M`K @ȠH 00 <4, 0 ႐P@" PP*Q0* K 0pS0  P@0[008#X U: -(L!x"h@mPP0S P*P0 S 0P0 :P -LM0P (@ p`0 8@#8 X  0 (@ 0` +t0VW  08#8 Xp 08#8 Xp -LM0` p( 008#8 PX0 (0@PU:0S -pBS00W0LMSP@`Q$ 5430:†fP@ -0( @ 0 0 X0  0\P@  0(0` S0 ,X00 X -BLM8Z`P#x@4bWQ$ 5430:aP@ 80(0 @ 00 X0  0\V0 0\X&P@ 0(0 S -L0KM@c 4P0[0 -LMp `P@P   @dT PcUdU@0 s0 -L M0@ (0P, L,:, 00 p W3`sPP ,0( 008#8 X00c#$ 0 4\PP  ,0Rp` WP0( XS*0  S800  - -PLMU`!p&**K@ 0]@PH$HU,0K RPUOPU ["[Pr08#x W: p-LM 0`S p0( ,@) P0 ,PLd(1UT 0 ,0L0 \0,,@ p0d ,X%X@ 0,,$@! qP,!A,< -LM@h }r: -LM`4p0!P,10; P) 0ΆN;0 @P @PP0S K% 0 R; $˖ 0@  ` (0SX;P@TD@@@@;̠eؠeL0 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S00"c1a  s: -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ ^1W< r$0<0  ?B3cS!3$0J0$008 bZ$0 p<~$U U080S=gfffs:gMb 0-LM0@(()0K[ S 0K )f(^ PU 00++ 0KKR$0 0(()KP[\0K  )P9( 0- @L aP,00 0dS0@00@00~ 0 T0 0@8 -0P2c1RL@,p ` (H>D 0,0T (0 0S0T00T0<8ؑ88 -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @0,P@000q~$0T0 0`0 S008 -L 0!0 0T  00 #(0 0 00   q0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<z$2Sh<;8|<8<<<;0@- @,PU @0T00\0#(# 0$ 0 T0PXP088 -LM `,Pp 0K NĠ@ KKPK000  0T08J p-LMP`!"a,@  \40T0p 0 0 00 T0}.? p88 -PL0 aR@,p `  490,00 0T0L(00T0鰷<8O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb 8in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811  R R 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- 6bs_notimpl_bs_mmap: args at 0x%08x - 6bs_notimpl_bs_r_1: args at 0x%08x - 6bs_notimpl_bs_r_2: args at 0x%08x - 6bs_notimpl_bs_r_4: args at 0x%08x - 6bs_notimpl_bs_r_8: args at 0x%08x - 6bs_notimpl_bs_w_1: args at 0x%08x - r6bs_notimpl_bs_w_2: args at 0x%08x - e6bs_notimpl_bs_w_4: args at 0x%08x - X6bs_notimpl_bs_w_8: args at 0x%08x - K6bs_notimpl_bs_rm_1: args at 0x%08x - >6bs_notimpl_bs_rm_2: args at 0x%08x - 16bs_notimpl_bs_rm_4: args at 0x%08x - $6bs_notimpl_bs_rm_8: args at 0x%08x - 6bs_notimpl_bs_wm_1: args at 0x%08x -  6bs_notimpl_bs_wm_2: args at 0x%08x - 5bs_notimpl_bs_wm_4: args at 0x%08x - 5bs_notimpl_bs_wm_8: args at 0x%08x - 5bs_notimpl_bs_rr_1: args at 0x%08x - 5bs_notimpl_bs_rr_2: args at 0x%08x - 5bs_notimpl_bs_rr_4: args at 0x%08x - 5bs_notimpl_bs_rr_8: args at 0x%08x - 5bs_notimpl_bs_wr_1: args at 0x%08x - 5bs_notimpl_bs_wr_2: args at 0x%08x - 5bs_notimpl_bs_wr_4: args at 0x%08x - 5bs_notimpl_bs_wr_8: args at 0x%08x - {5bs_notimpl_bs_sm_1: args at 0x%08x - n5bs_notimpl_bs_sm_2: args at 0x%08x - a5bs_notimpl_bs_sm_4: args at 0x%08x - T5bs_notimpl_bs_sm_8: args at 0x%08x - G5bs_notimpl_bs_sr_1: args at 0x%08x - :5bs_notimpl_bs_sr_2: args at 0x%08x - -5bs_notimpl_bs_sr_4: args at 0x%08x -  5bs_notimpl_bs_sr_8: args at 0x%08x - 5bs_notimpl_bs_c_1: args at 0x%08x - 5bs_notimpl_bs_c_2: args at 0x%08x - 4bs_notimpl_bs_c_4: args at 0x%08x - 4bs_notimpl_bs_c_8: args at 0x%08x Le2-@@Pr?0RW` p8L8X8d8` B`p Bp` B`RE0C`R9`888̱8ر8888` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `ꬲ8в8IJ88` B`p Bp` B`p RpPP2-B@P00O0RW` h8D8P8\8` B`p Bp` B`RE0C`R9`888ij8г8ܳ888` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `ꤴ8ȴ888` B`p Bp` B`p RpP2-D@P?O0RL` T808<8H8` B`p Bp` B`R:08`R/`88888ȵ8Ե88` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `d88|8p8` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480Le0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   Dt:` `! R0-P@ 0bR03 B00he``0 B`3`1`1c11c!0"b2c3c0acP@he_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q%2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z|:::Ć:܆:: :$:<:L: h: : : : :::::ć:ć:ć:ć::::::::::: :!:":#:$:%,:&,:',:0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-P:X:d:p::0:0:4:8:8:t̒:tؒ:x:!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik&''(())**++,,-*++,,--../-@@A@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 n;AvXaM ְdx ##### ##### #%#Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2007 OpenBSD. All rights reserved. http://www.OpenBSD.org  $:Tl;l:<::::@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U$($($(P%(%%(&(%'('('% ((d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@,D--D-D--H - -<-x--H-D- -D-H-D-D--------D-vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ 00\%pD;);tD;);D;);D;l: << D;<D;D; D;D;D;D;D;D;D;D;D;D;p D;D;p 0D;D;p `D;D;p pD;D;P D;D;P D;D;P @D;D;P PE;D; E; E;E; E;E;E;E;E;E;<D;< E;<(E;<0E;<8E;<  g;L;g;L;@E;DE;@HE;DE;PE;TE; XE;\E; XE;`E;/dE;;ohE;lE;0/D;;p pE; : a;xE; E;xE; @E;xE; `E;xE; t:xE; E;xE; E;xE; E;xE; E;E; 0E;E; @E;E; `E;E; E;xE; E;E; E;xE; E;E;E;E;E;E; E;E;0E;E;@E;E;PE;E;`E;E;pE;E;E;E;E;E;E;E;E;E;E;E;E;E;F;F;F;F; ,<F;0F;F;@F;F;P:F;`F;F;p F;F;$F;F;(F;F;,F;F;0F;F;4F;F;8F;F;;>0;>H;>`;>;?;?؇;?;?;?,;?H;?d;?;?;? Ĉ;? Ԉ;? ;? ;? ;?8;?X;?p;?;@;Aĉ;B;C;D ;E8;FT;Gl;G;G;GЊ;G;G,;GH;Hx;I;J;KЋ;K;K;K$;K4;KD;KX;Lt;N;P;PЌ;P;Q;Q ;RT;Sd;S;S;T;U؍;U;U;U(;U@;Ud;U;W;XЎ;Y;Z;Z(;ZL;Zl;[;[;[;[̏;\;\;\;]0;]X;];];];]$;]\;];]đ;];],;]d;];]Ē;];],;]\;] ;]!Г;]";]#@;]$x;]%;]&;]';](P;]);]*;]+;], ;]0\;]1;]2Ԗ;]3 ;]4D;]5|;]6;]7;]8$;]9X;]:;];Ș;]<;]@<;]Ap;]B;]Cؙ;]D ;]E@;]Fp;]G;]HК;]I;]J,;]K\;]L;]P;]Q;]R,;]S`;]T;]UȜ;]V;]W,;]X\;]Y;]Z;][;]\ ;]`X;]a;]bȞ;]c;]d0;]ed;]f;]gП;]h;]i0;]jd;]k;]lȠ;];^4;^L;^p;^;^;^A;^B;^C ;^E@;^G\;`;a;a;aĢ;bԢ;c;c;dD;d`;et;f;f;f̣;f;g(;g@;gp;g;g;g̤;g;g;g0;g H;g h;h;i;iȥ;i;j;k;k8;kT;lp;m;n;o̦;o ;oD;o;o;o;q ;rL;rd;r;r;r;r;s<;sP;st;s;s;sة;s;x;;;;;|U;;;|U;;(;<;@;L;|U;T;`;|U;h;l;|U;T;t;|U;T;;|U;|U;;|U;;;|U;;;|U;;Ȭ;|U;Ь;ج;;;;|U;h;;|U;; ; ;$;0;D;$;L;`;$;h;|;;|U;;;|U;;;|U;Э;ح;|U;;;|U;;;|U;;;|U;;;|U;,;4;|U;\;d;|U;;t;|U;;;|U;;;|U;;;|U;Į;̮;|U;خ; |U;|U;|U;|U;|U;|U;0;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;|U;p2q2 r28r2@r24r2888L8ئ88(88ȧ88888Ȧ8Ц88P8x888@8h88\88Į88,8`8ܨ88808$88̰8\;d; d; l;t;ABCDEFGHIJKLMNOPQRSTUVWXYZT83@3833;;;;;;;; ;(;0;@;L;X;`;p;x;;;;XBBp@m@m@m@ f(  pt""(4I@@@@1` #U4QFb '               >@0@@ Q@c@c@<W3W3x`3_3La3a3,d3c3uaudio_identify_acp`3ܡ3x3H33333L3333tD33844 4 4 4 4      L4H4p4444 4l4844abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` Ĺ9Rֻ9 z9]9Z9I9 9J9R$979 09 \9 l9 9Kj99@# 9999 99H@9 N69 _9P99\J9 9 9 9E09 9m9K9Ah9[9909 9.9j<99?09n9 9|$4$4$4<4 40#4"4$4D%4'4'4D/4/4<5464:4(:4P<4B4A4B4(  v      W 1 Q `  4H4@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   PH4  L+ L H4L2 D   O  {I4o  A AZPZPZPPN4DO4P4Q4fG---0000 0@0P010`0p0aLfLLLLi d8X4X4]4\4Dx_4_4l`4`4F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@n@0Df @  Q k k"k"k"k"k @^z BF |9 8k4Pl4,p4,q4 B  w W UP  <1b0 0{&"79=F@W wn a- <H444`4T44D44@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 04d4X442V{%1" `"'`~%ZPt\444 4$4444hF h4|44x5$5`5`5x5@@9WP P Q@url_int_miibus_readregurl_int_miibus_writeregD,5-5H7575P75:5x>5$>5G W WnPnPA  ! 4Xhp9{#{{{S&@'ah 33.U 1(Ex$ lE5E5tI5J50    hXQ5Q5T5U5   `pZ5Z5]5 ^5e  l!  P ` c feXe5@f5h5i5  BDn5n5s5@s5=K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- 555x6!A  !@@@@666;$60 6!6Q`;#6$66;2;3;0&6<'66;5;+6,6+6CP,;CPL;CPl;CP;CP;CP;CP ;CP ;CP! ;CP"<;CP X;CPt; ; ; ; ;|/6640616,366 |;Ð;66768666686;;:666` ;;6668;=6>6?6}T;}h;}|;@6A66;;;C6D669;,G666I6,M6Q64S6@T6`U6;;6;!;(;3;$;2<;W6[6H^6\;t;;;.; ;;4;T;t;4;;;5;P ;P4;T;6t; 22  ##   * #hh   1 @f6g66n`;@`;n`;n` ;;j6k66!;$;8;`n6 p66urlphy_attachurlphy_serviceurlphy_statusr6u6}6L;2;~666; ;!;!;.)g;:g;%h;2h;6h;rh;3i;ri;q$;q4;qL; q\;0ql;4q|;#r;;;;';;;3;5<E <UP<WP(<WQ0<WR<<YH<PYX<QYl<RY<`<`<U`<V`<`e<be<ce<de<ee<Fv<pw(<@<H<X<l<|<< <P<Q<U<V<X<Z <4<H<\<l<|<<<<<<<<< < <<<$<,< 4<==<<==D<==L<==T<==`<==h<==t<== <== t<<<<<<<<<$<P4<E@<H$<P<d<Q x<BX<<<<< <<< <0<@<P< <<$<3@ ,<3@`4<3@p<<%5D<ET<Id<Qp<a|<<<<!<#<1<3<5<A<C<c<s <u<!$<10<D<<GH<T<`< 3l<Rx<R<)R<7R<9R<CR<FR<GR<IR<KR<LR<MR<aR <cR,<R8<RD<RP<R\<QTh<UTt<WT<aT<q< < <<<<<x<x!<`8<xP<xU<Y <Y0<u`@<x`L<xaX<xpd<xqp<xr|<xs<xt<x<x<x<x<x<x<i<x< < <$ <4 <D <T <d <Pt <Q <_ < < < < < <P < < < <d <e <d, << <L <\ <p < < <\ < < < < < < < < < <$ <#4 <%@ <'L <2X <5h <.Bx <0B |<p><DA<PA<QA<RA<SA$<XA0<dA8<pAL<qA`<rAt<sA<BB<6C<7C<AC<BC<EC<GC<HC<IC<LC<MC<SC$<TC0<XC<<aCH<cCT<iCd<nCp<pC|<qC<rC<sC<tC<uC<vC<wC<xC<yC<zC<{C<C<C<C <C<C(<C4<CD<CP<CP<CP<CP<CP<C\<Ch<Ct<TE<BG<DG<IG<LG<MG<NG<OG<PG<QG<RG<SG<TG<UG<VG(<WG4<XG@<YGL<ZGX<fId<nIp<BL<DL<EL<FL<GL<IL<ML<NL<PL<QL<RL<SL<WL<YL(<ZL@<fLX<FMp<LM<DN<EN<JN<HN<PN<dN<hN<DP<FP(<RP4<DQ@<EQL<FQX<GQd<LQp<MQ<NQ<OQ<WQ<YQ<ZQ<^Q<lQ<ER<FR<GR<KR<LR(<HS4<KS@<LSL<MSX<NSd<FTp<LT<RT<`T<MU<mU<RV<SV<TV<UV<VV<0X(<1X8<2XH<3XX<5Xp<8X<@Y<AY<PY<QY<TY<UY<`Y<aY<bY<dY <tY<uY<4Z4<6Z@<7Z@<8Z4<9Z4<?Z@<AZ<BZ<aZ<bZ<`[L<b[X<c[l<d[x<p[<r[<s[<t[<a\<c\<D]<O]<o](<O^<<o^L<p`<pl< qx<Iq<q<q<q<q<q< <,<8<D<PGP<Ch< x<<<<<<<<<<<<<<0<0< <BH.<$\.<$%l.<$|.<$.<$.<$ .<$!.<$".3<W3<p3<3< <3<4<$4<048<@@8<@$><]$><$><$><$?<$><$?<$0?<$><$D?<$T?<$`?<$p?<$|?<$?<$?<$?<$?<$?<$?<$?<$?<$?<$?<$?<$@<$@<$$@<$@<$8@<$H@<$@<$\@<$l@<$@<$|@<%@<%@<0%@<1%@<2%@<3%@<4%@<5%@<6%@<@%@(0H]<P^<Q^<R^<S ^<T,^<U,^<V<^<W<^<YH^<ZX^<[X^<\d^<]t^<^^<`^<d^<e^<f^<g^<h^<j^<k^<l^<m^<n_<~_< _<0_<D_<T_<`_<p_<_<_<T_<_<_<_<_<_< `<`<(`<<`<L`<T`<d`<T_<p`<p`<|`<`<<`<T_<`<`<`<`<`<`<T_< a<a<0a<Da<`<Xa<la<|a<a<a<a<a<a<a<a<a<@a<Ab<Bb<Db<Fb<P$b<Q4b<R@b<SPb<a\b<elb<g|b<pb<qb<rb<tb<ub<vb<xb<yc<zc<{(c<|8c<Hc<\c<tc<c<c<c<c<c<c<c<d<d<d< d<,d<8d<Dd<Td<`d<pd<|d<d<d<d<d<d<d<d<d<d<d<d<d<d<d<e<e<@$e<A4e<BDe<PTe<Qhe<S|e<Xe<Ye<[e<`e<ae<be<ce<de<ee<fe<ge<he<ie<ke<lf<mf<nf<o$f<p4f<q@f<rLf<~\f<\f<|e<hf<|f<|f<|f<|f<|f<|f<|f<|f<\f<\f<\f<f<f<f<\f<\f<f<f<f<f<f<f<! g<"$g<$4g<&Hg<'Xg<(4g<)4g<+hg<,|g<-g<0g<1g<3g<Cg<Gg<Hg<` h<a h<b h<c h<d h<e h<f h<g h<hh<l$h<m$h<n0h<iԌ<?<f<g<h<i<j<k(<m4<n@<oL<X<d<p<|<<<<<<č<`Ѝ<a܍<<<<<<< < 8< @<H<P<X<`<h<p<x<< <<<<<̎<1؎<1<2<B<<Jz > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! ص62e7"ص60Ȼ6.Ȼ6vȻ6pȻ6qȻ64Ȼ6qȻ6ʄȻ6$Ȼ6!$Ȼ6J$Ȼ6K$Ȼ6$Ȼ6$Ȼ6$Ȼ6$Ȼ6$Ȼ6$Ȼ6$̿6$̿6%Ȼ6%̿6%̿6&Ȼ6o&Ȼ6S&̿6Q&̿6R&̿6'Ȼ6'̿6'̿6'̿6'̿6'̿6'̿6 (̿6!(̿6"(̿6$(̿6%(̿6)(̿6*(̿6&̿6 t6t6At6it6 6@H6C6F6H6I661656@616qp6qp6d1p6I16I266I367U76667h7)R78"78"78"78"78"73M)78M)70 )70M)7hM)7hb)7iM)7ib)7u)7uR)7ur)73X;73X;7q3X;7u3X;7v3X;7w3X;7s3X;7r3X;7=X;75X;7=X;75X;7w5X;7q5X;7u=X;7t5X;7p5X;7s=X;7Z7Z7Z7Z7 Z7J7J7J7J7J7@P7AP7BP7JP7KP7`7e`7`7`7`7S`75`7e`7n`7`7H`7``7666T6U666>6f6g6~66666\6]6^6_6P6Q6R6S6f7f7ICj7iCj7vCj7Cj7nC6yC6zC6 g:-"?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD4.1RAMDISK#81 @(#)OpenBSD 4.1 (RAMDISK) #81: Sat Mar 10 21:33:05 MST 2007 OpenBSD 4.1 (RAMDISK) #81: Sat Mar 10 21:33:05 MST 2007 deraadt@armish.openbsd.org:/usr/src/sys/arch/armish/compile/RAMDISK dackirqtargetlunsizewidthxintchanneldriveconsolemuxconfigurationvendorproductreleaseportnoreportidphydevfunctioncryptobiohotplugloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl tagged DT %s: target %d now using %s%s%d bit 80.0 MHz %d REQ/ACK offset xfers 40.020.013.310.06.675.0??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x %s: scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d %s: request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_saveoffset %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d IBSSLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) RTL8169RTL8110SRTL8169SRTL8169/8110SBRTL8169/8110SCRTL8168 1RTL8100E 1RTL8101ERTL8168 2RTL8100E 2RTL8139C+RTL8101RTL8100%s: PHY read failed %s: PHY write failed %s: bad phy register %x %s: reset never completed! : %s (0x%04x), %s, address %s %s: no PHY found! %s: can't create DMA map for RX %s: can't load rx list, error = %d %s: can't create rx list map, error = %d %s: can't map rx list, error = %d %s: can't allocate rx listnseg, error = %d %s: can't create DMA map for TX %s: can't load tx list, error = %d %s: can't create tx list map, error = %d %s: can't map tx list, error = %d %s: can't allocate tx listseg, error = %d : unknown ASIC (0x%04x)%s: tried to map busy RX descriptor %s: tried to map busy TX descriptor %s: can't map mbuf (error %d) %s: watchdog timeout %s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes %s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: WARNING: unable to establish power hook %s: WARNING: unable to establish shutdown hook %s: could not allocate Rx ring %s: could not allocate Beacon ring %s: could not allocate Prio ring %s: could not allocate ATIM ring %s: could not allocate Tx ring %s: could not create desc DMA map %s: could not allocate DMA memory %s: could not map desc DMA memory %s: could not load desc DMA map %s: could not create DMA map %s: could not allocate soft data %s: could not load rx buf DMA map%s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate beacon %s: sending data frame failed 0x%08x %s: sending mgt frame failed 0x%08x rt2560_decryption_intr%s: could not load old rx mbuf%s: could not map mbuf (error %d) rt2560_tx_mgtrt2560_tx_data%s: could not allocate protection frame %s: could not write to BBP %s: could not read from BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526unknownRT5222%s: timeout waiting for BBP %s: could not enable device ral%s: MAC/BBP RT%X, RF %s %s: could not allocate Mgt ring %s: could not allocate Tx ring %d %s: timeout waiting for NIC to initialize rt2661_rx_intrrt2661_tx_mgtrt2661_tx_dataRT5225RT5325 (MIMO XR)RT2527RT2529 (MIMO XR)ral-rt2561ral-rt2561s%s: could not load 8051 microcode %s: could not read microcode %s ral-rt2661timeout waiting for MCU to initialize %s: could not allocate beacon frame uhciuhci_allocm%s: host controller halted %s: host controller process error %s: host system error %s: interrupt while not operating ignored %s: controller did not reset startstop%s: cannot %s uhci_alloc_std_chain: maxp=0 uhci_abort_xfer: not in process contextuhciabuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval UHCI root hub version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci,, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return ehciehcidb%s: run timeout ehci_check_intr: sqtdstart=NULL %s: config timeout ehci_open: bad device speed %d%s: *** WARNING: opening low/full speed isochronous device, this does not work yet. ehcidiehci_root_ctrl_start%s: port reset timeout EHCI root hubehci_abort_xfer: not in process contextehciawehciabradioradio at %srd%drdattach: device name too long RAM diskfictitiousrd_idlebioioctlhotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocuvmexpvnodewatchescrashhaltpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanmiccdspeakerheadphonesaudioaudio: could not allocate play buffer audio: could not allocate record buffer audioattachrecordmonitorsourceauddetaudiodetach: %s didn't detach au_portofoplaudioprint: unknown type %d%s at %smpuaud_draud_hraud_rdaudio_silence_copyoutaud_wrau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfo/etc/firmware/%smidimid_rdmid_wrmid_clmid_dr: <%s> midi at %sunconfiguredarc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending not lockedmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlezombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensordevsensorssensors kthreadsigaplpauseissignal coredump%s.corehashinit: bad cntkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too longconfig_detach%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbose--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s -%s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passiveactive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: station %s power save queue overflow of size %d drops %d %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUNauto11a11bfhturbo0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMbshortlong protection enabledAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaearazbgbhbnbrbybzcacncocrczdkdodzegf2fifofrgrgthkhnhuidiliqisj1j2j3j4j5jmjojpk2kpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p uvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufrebooting... The operating system has halted. Please press any key to reboot. WARNING: powerdown failed! cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: Failed to align the kernel page directorykernelsize text %x total %x end %xesym %x physical_freestart %x end %x initarm: out of memoryunknown option `%c' can't init serial console @%lxwdsduse one of: reboot %s[a-p]parsediskrootconf: device name too longboot device: lookup '%s' failed. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: %s. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corrupted%sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplsctkplscsiunable to create scsi task threadslackingoutstanding scsi tasksgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target links%s: unable to register bio scsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260%s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcadrive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalSCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %diic"%s" at %s addr 0x%xlm75alm75lm77xeontempmax1617%s: addr 0x%x %02x=%02x: %smtp008it8712it8712f-aadm1026gl518smasb100f75375as99127fw83l785ts-lw83l785rw83l784rw83781dw83627hfw83782dw83791dw83783sw83791sdw83792dgl523smlm90lm89-1lm89lm86lm63max6642max6657max6646max6690g781-1g781adm1032adm1023adm1021adt7461adt7516lm81lm93lm96000lm85adm1033adm1022adm1028adm1024adm1025adm1031adm1030adt7467adt7460adm1027adt7475adt7476adt7470adm9240lm8747m192ds1780ne1619emc6d100sch5017emc6w201thmc50ricohrtc: RICOH RS5C372[AB] Real-time Clock %s: ricohrtc_reg_write: failed to write reg%d %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_clock_write: failed to write rtc fintek: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d pcaled: PCA9532 LED controller gpioi80321_io_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_mem_bs_free(): not implementediopaauiopiiciopmuiopwdogpcii80321intci80321_intr_establish: IRQ %d out of rangeclockstatWARNING: CHECK AND RESET THE DATE! WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: preposterous time in file system resettodr: failed to set time : I2C controller iopiiclk%s: unable to subregion registers, error = %d iopxs%s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersattempting reset PCI I/O memory spacePCI I/O port space--------------------------[%3d devices bogus] [%s]----------------------- device vendor product register space address size -------------------------------------------- PCIBIOS fixup stageSystem BIOS SettingWARNING: unknown PCI device header. NGOK [%s] %02xh %s 0x%08x 0x%08x mem No available resources. fixup failed fixup failed. (new address=%#lx) new address 0x%08lx pci_addr_fixup: Resource conflict. %03d:%02d:%d %04x:%04x Thecus Nx100I/O Data HDL-GCertance CP3100board id failed iq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) irq %d addr 0x%08lx intr %dobio_bs_alloc(): not implementedobio_bs_free(): not implementedcom_obio: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwsevent_readwskbdwskbd at %s: console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %swsmdetwsmouse_detach: %s didn't detach pre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04x%x.%02x, class %d/%d, rev /, addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: %s %s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d sel%d-uaudio_add_selectoruaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x, %d mixer controls%s: alt %d missing AS interface(s) %s: failed to get configuration descriptor ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_beuaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data volumemix%d-%suaudio_add_mixermixeroutdacphonelfeauxvideofmsynthuaudio_add_feature%s.%smutebassmidtrebleagc4 msdelaybassboostloudnessuaudio_add_processing_updownpro%d-modeuaudio_add_processingpro%d.%d-enableuaudio_add_extensionext%d-enableuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d %s: non sync-pipe endpoint but multiple endpoints %s: ignored output endpoint of type async %s: ignored input endpoint of type adaptive %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: no memory outputsinputsequalizationumidi %s: %s %s: out=%d, in=%d %s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) Fixed EndpointYamaha Specific((genuine USB-MIDI) ucom, %sucomlkucomopen%s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed %s: setting configuration %d failed ugen_do_readugenriugenrbugenwiugen_do_writeugenwbhid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ulpt%s: setting alternate interface failed bi%s: using %s-directional mode uni%s: could not find bulk out endpoint %s: couldn't get ep %d ulptop%s: offline %s: out of paper %s: output error ulptwrumassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cburio%s: setting config no failed %s: getting interface handle failed %s: missing endpoint uriorsuriowruvisorGeneric%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: device is neither visor nor palm %s: failed to get interface, err=%s %s: failed to set configuration, err=%s udsbr%s: request failed err=%d aue%s: EEPROM read timed out %s: MII read timed out %s: reset failed auemii%s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: no union descriptor %s: too many errors, disabling %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x no %s: data interface %d, has %sCM over data, has %sbreak %s: Could not find data bulk in %s: Could not find data bulk out %s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: no pointer to data interface %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdiuftdi_openuplcom%s: failed to get device descriptor %s: Could not find interrupt in %s: reset failed, %s %s: failed to get second interface, err=%s %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s umctuvscom%s: failed to set configuration, err=%s %s: uvscom_readstat: %s %s: uvscom_shutdown: %s %s: uvscom_set_line: %s %s: uvscom_set_line_coding: %s uvsop%s: cannot open interrupt pipe (addr %d) %s: uvscom_intr: abnormal status: %s ubsa%s: failed to get interface: %s %s: failed to set configuration: %s %s: ubsa_request: %s uipaq%s: no proper endpoints found (%d,%d) %s: unhandled set request: reg=%x onoff=%x umsm%s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor found for %d uscanner%s: bulk-in and/or bulk-out endpoint not found %s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthratuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extatu_send_mibatu_start_scanatu_initial_configatu_joinunknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atu_get_card_config %s: could not get card cfg! atu_rxeofatu_tx_startural%s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not read BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dcphy: internal PHY bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706C 10/100/1000baseT PHYBCM5708C 10/100/1000baseT PHYbgebnxamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYurlphy: RTL internal phy %s: %s: enter %s: %s: link %s rgephyRTL8169S/8110S PHYciphyCicada CS8201 10/100/1000TX PHY%s: unknown PHY speed %x nfe%s: unknown CICADA PHY model %x dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 35000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681AX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9500 ProRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP300 SATAIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 IDEIXP400 ISAIXP400 ModemIXP400 SATAIXP450 HD AudioIXP600 SATAIXP600 AC97IXP600 HD AudioIXP600 PCIIXP600 SMBusIXP600 USB2IXP600 USBIXP600 IDEIXP600 LPCIXP600 ModemMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon X800 (RV430)Radeon X800 (RV430) SecRadeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecRadeon X550 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRadeon X700 SERadeon X700 SE SecRS100 PCIRS200 PCIRadeon X1800Radeon Mobility X1300 M52-64Radeon X1300 ProRadeon X1300 Pro SecRadeon Mobility X1600Radeon X1600 PRORadeon X1600 PRO (Secondary)RS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5211AR5212AR2413AR5413AR5424AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLL1Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000PCI 2 SerialLP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5709BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5722BCM5705M AltBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787FBCM5787MBCM5782BCM5786BCM5787BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B0BCM5901BCM5901A2BCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4318BCM4319BCM4306BCM4322BCM4309BCM43XGSerialBCM440158015802580558205821582258235825BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3132 SATASiI3512 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IR82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2FirewirePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDGE-528TDGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iIPMI77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2133 PCIX-PCIXCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E KCS (Active Management)82573E AMTPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)ICH8 IFE GTICH8 IFE G82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGP5000 DMA EnginePRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH RASE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA82915G/P/GV Host82915G/P/GV PCIE82915G/P/GV Video82925X MCH Host82925X PCIEE7221 MCH HostE7221 PCIEE7221 Video82915GM/PM/GMS Host82915PM/GM PCIE82915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBDE8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI SATA6321ESB SATA RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945GP82945GP PCIE82945G Video82955X MCH82955X PCIEE7230 MCHE7230 PCIE82975X MCH82975X PCIE82915G Video82945GM MCH82945GM PCIE82945GM Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GR AHCI SATA82801GR SATA82801GBM SATA82801GBM AHCI SATA82801GHM SATA RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801H SATA82801H AHCI SATA82801H RAID82801HBM SATA82081HBM SATA82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82946GZ Host82946GZ PCIE82946GZ Graphics82946GZ HECI82946GZ PT_IDER82946GZ KT82965G1 Host82965G1 PCIE82965G1 Graphics82Q963 Host82Q963 PCIE82Q963 Graphics82Q963 HECI82Q963 PT IDER82Q963 KT82965 MCH82965 PCIE82965 Video82865 HECI82865 PT IDER82865 KTRCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP6321ESB PCIE-PCIX82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7520 MCHE7520 MCH ERRE7320 MCHE7525 MCH ERRE7520 MCH DMAMCH PCIEE7525 MCH ConfigurationE7525 MCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGPRO/Wireless 3965ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GIT8888F ISAJMB360 SATAJMB361 IDE/SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDE/SATAKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88EC033Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI511GPS170KSZ8841 10/100KSZ8842 dual-port 10/100 switchMN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBDP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 7800 GSGeForce 6800 GTQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4200 GoC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 USBMCP55 IDEMCP55 MemoryMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7600 GTGeForce 7600 GSGeForce 7300 GTGeForce 6100 nForce 430MCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMPC61 USBMCP61MCP61 SMUMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAMCP67 SMBusMCP67 LANMCP67 SATAMCP67 AHCIMCP67 HD AudioMCP67 IDEOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954Exsys EX-41092OXCB950Exsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00SAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 10778532 PCIEI/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP6312PWDOG185008580RT2460ART2560RT2561SRT2561RT2661802981298101E81388169SC81688169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C8435C852 xDRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4FDDISK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1901915597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA530 VGA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST2021TC9021 (alt ID)40XX4018ANE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCI1620 MiscACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostCN700 HostK8M890 HostVT3351 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATAPM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVT8237A PCI-PCIPM800 PMCK8T890 IOAPICK8M890 IOAPICVT3351 IOAPICVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneEquinoxAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyI4ArecaNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaOptionAttansic TechnologyJMicronASPEED TechnologyTekramHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle Beachc't MagazinDecision Computer IncQuancom InformationssystemeIntelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDmiscellaneousfloppyIPISASethernettoken ringWorldFipPCMIG Multi ComputingXGAtelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorACCESS.busSSAFiber ChannelSERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationssystemdockserial buswirelessI2Osatellite commDASPundefined"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write: broken match/attach! : couldn't map interrupt : invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: couldn't establish interrupt: unable to map device registers pciide%s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX650651652655658661730733735741745746748760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers : can't map mem or i/o space %s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: Media change is blocked due to SOL/IDER session. %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba is not mem space : cannot find i/o space : flash is not mem space : cannot find mem space %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: The EEPROM Checksum Is Not Valid %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive Length Errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't map i/o space %s: init failed, error=%d : can't map mem space %s: unable to establish powerhook : can't map memory space %s: pre-2.0 USB rev %s: timed out waiting for BIOS : could not map memory space : could not map interrupt : could not establish interruptpciide_machdep_compat_intr_establish called pciide_machdep_compat_intr_disestablish called atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed  id'(2` <:4u:"D>"I"I"d%"|"lI"I"I"LJ"d%"x"(")"*"*"d%"h5")")"+"+"X%"84"h%"%"P'"("X%"6"."P0"0"1"d%"3" @ @   ) 2:     s"h"Xn"["\"\"p\",y"`y"""̅"m""L"|"Ȅ"̅"m"܄""""̅"hk"@"t""""lk"Ѕ"""""Hl"""Ď""̅"" @ @   )8:@"""p""" " "T"б"Ա"<""ܱ""<""<"ر""8"""<""""p""(""""""(""""$"("<"," @ @ @   )@0"D"" ":H:" "L"Sgh:$p:&%T:,x%x:=|:"l:":":"<;":":"h;,":d":":"; #:":H"Ĥ:&#;<"̤:P"ظ:h"Ԥ:|"\;"ܤ:":d:":H"L;H":"d;4##;<(#;<(#:"\G;":":p&#:&# :#d;#(:D#);D#4:d#<:#D:#L:|"T:"v:$p:&%\:P=d:`=l:"t:,#|:"̥:""4""d"l"t"xx^g^gP=ip:=##x:=##:|=##:t=##:x=##:L=##8=Xog2:а;:::а;@3#3#6#6#:u#u#t#Lu##X#t#<:gg̟#<#X#Ƞ#PX<#Ը#TF#T#PN`#RR#CE #ST#NM@#м#CLp#0PLp#0REȽ#@RR#CE #ST#SL#RR#CE #ST#ER#CE #ST#4=|'@5= #l5=%5=%5=#5=#6=#H6=$#t6=#6=#6=%6=#$7=#|7='7=%7=%8=#@8=%l8=%8=%8=#8=4# 9=<#L9='x9=б#9= #9=L#9=d#(:=p#;=#T:=#5=#:=#:=%(;='̍g=4='6=#H6=$#t6=#x9=б#9= #9=L#9=d#T:=#5=#ȍg =4='6=#H6=$#t6=#x9=б#9= #9=L#9=d#T:=#5=#(;='ЍgX!=@$<"=4#<"=native12"=@8# 1$X8l8native12"=j$ 1X8l8@:L:X:$m$v$ % % i'X3$hr$$dv'x'$@h'f' t'' '$/ $ $̣$X'_'$$$$$ & `&l& <& Թ& &z'~''$b'$$$$0($%h$X%$ $T$$|$$$$$ %,*%\'lw' }' ^$<'h'$$$$=|?= =P!=!=@=S==. .. 4=|'@5=(l5=p((5=x*(5=*(5=*(6=+(H6=8,(t6= /(6=1(6=4(6=;($7=;(7=;(7=<(8=|<(@8=<(l8=C(8=G(8=H(8=H( 9=Q(L9='x9='9='9=Q(9=(Q((:=TQ(;=Q(T:=) dXG=G=G=G=G=}E#(D<8Q @X,H=H=H=H=E=E=E=E=H=dH=H=hH=lH=pH=tH=xH=|H=H=H=H=H=H=H=2(@AAA==(A* dd%(i @@@@@@@@@J=I=HhazEzEzE2:!zEzEzEŽazEzEzEn [!zEzEzEz|azEzEzE`0Ҫ!zEzEzEBG8azEzEzE&A!zEr zEr zE1]oazEr zEr zE4^L!zEr zEr zEClazEr zEr zEw!zEr zEr zE@azEr zEr zEJy;!zEr zEr zE:azEr zEr zE׍E!zEr zEr zEazEr zEr zEf!zEr zEr zE`UazEr zEr zE b!zEr zEr zE H5azEr zEr zE X˅!zEr zEr zE oazE( zE( zE wOP!zE( zE( zE E)azE( zE( zE !zE( zE( zE \azE( zE( zE Zv*!zE( zE( zE +azE( zE( zEJ!zE( zE( zE'JazE( zE( zE8!zE( zE( zEazE( zE( zEUA!zE( zE( zE:azE( zE( zE ,!zE( zE( zEC$azE( zE( zE !zE( zE( zE,>azEI zEI zEx!zEI zEI zE~azEI zEI zE8C!zEI zEI zE{azEI zEI zEE/=!zEI zEI zEjazEI zEI zE¸Q!zEI zEI zEBazEI zEI zEN-Bt!zEI zEI zE>azEI zEI zEɄ!zEI zEI zEW\azEI zEI zE !zEI zEI zEvazEI zEI zEdl!zEI zEI zEj\azEj@ zEj@ zEOi!zEj@ zEj@ zEazEj@ zEj@ zEw!zEj@ zEj@ zEz4azEj@ zEj@ zE[P!zEj@ zEj@ zE9azEj@ zEj@ zEA!zEj@ zEj@ zEZ5azEj@ zEj@ zE|BN!zEj@ zEj@ zEL+azEj@ zEj@ zEz !zEj@ zEj@ zE(kazEj@ zEj@ zEզ/!zEj@ zEj@ zE1`%/azEj@ zEj@ zE6!zE zE zEq9azE zE zE!zE zE zET qazE zE zE~ ,!zE zE zEs9azE zE zEcj!zE zE zE;razE zE zE?!zE zE zE9k0azE zE zE7 !zE zE zEEazE zE zEB,F!zE zE zExz1azE zE zE `5M!zE zE zEM `azEȬt zEȬt zEM }2E!zEȬt zEȬt zEM $EazEȬt zEȬt zEM !zEȬt zEȬt zEM nazEȬt zEȬt zEM $!zEȬt zEȬt zEM |KazEȬt zEȬt zEM ڼ !zEȬt zEȬt zEM 4A)azEȬt zEȬt zEMo!zEȬt zEȬt zEMjazEȬt zEȬt zEM!zEȬt zEȬt zEM*F!zEȬt zEȬt zE@| 2 Bu!zEȬt zEȬt zEPް ô&BuazE zE zEM6[ń!zE zE zEMyazE zE zEM!zE zE zEMeu!zE zE zE ?w!zE zE zE ?d7azE zE zEMH!zE zE zEMazE zE zEMw!zE zE zEM]azE zE zEM|!zE zE zEMW3azE zE zEM !zE zE zEM-!zE zE zE <m!zE zE zE ( !zE zE zE (g!!zE zE zE (M!zE zE zE (Yb!zE zE zE (S#!zE zE zE =xqr!zE zE zE "!zE zE zE "\;zE$zEEPzEEPl:uzEЇzEU#zEU#` h p x P")zE0%zE0%zE0%3CzEHw'zEHw'zEHw'XyzEX(zEX(zEX(/tmp/disktab.shadowMzEh)zEh)zEh)/tmp/fstab.shadowB3G_zEx=)+zEx=)+zEx=)+/tmp/resolv.conf.shadow#"i zE],zE],zE],/tmp/hostsT zE-$zE}R $zE}R 0k$zE"U#$zEȅ#%%zEq 8$zE&$zEmZ)$zEmZ)uRn$zE(+$zEH/,$zEH/,oy$zE`.$zE.1%zEq kQ$zEy2$zE9%zEq   ]p$zEHj;%zExL=%zExL= 9eUsn /Da02zo6`n6eg,+,M= m+-9О "RԫN']XI=$%uh5dZ 4]/s}dWs4,/{ iKQ6U5$~דq3w aig)2`D8זCBgDH j, 2󴙃S_iPD7zE=Itz;(Xl]5e3]|gL= StD.pXR,`Y<Uysͩ rnMB 1b ,`%C:`qk[JZ8Ʌ O)o{-v=Z>Ԅ۾@-6/WEl*S4;=8=.õE#K`)JjέCav.}ryNT A i;:=.52HK: `IU=;ɭneԑ1]tƖ}u+LyQGp׫CI2:0 RaK8uϡ118N^gd )ƤllQ?pu ~;# x4m:fɚ]ڣl~[ &|rTI(P1m|e)"#k'y/8|W>&J :(Jq"OՔ#(9 &"{̿,fכWu s 3*)a Mq_@eت4lB,m]32uV6?FFACK༔4LJtrljJF_[s̈́*HRR^.‘a=es.uc{P=_~<-: ]?P> m,QT'#]25lAܧ/5\F/BD(TEU!cnQ~3o-eG;.qPmiɕQ 4nm!N {wGW[1 2JA_fи^l+uP T.ԪEj!bƂD&zFDyy4vn`Է)Ċ|x#&w67EA-y\M<6`#N~h`eɐ'^{[SFJWIiE# " c3@ yK(%7*\#,?Sw_6"\ܙ+)FRUDH\C>7@~ ^ۍtYmp]i;/S=REp{?*pȳ%MAsݓ}oN}d7IޓD6^#BcN>iH6¿#8DN gL"s׶_Oߖ5ǏKm,AO_J6iEopH% ra^2oh_Jwz B$t`:lN >v,k(aV$YDa2# Uk%iiBcձ+@H# @ g;|v+Yo 0qո8*ӿzs5bRwH02#V,XݛeB?>']  . .. catchmodchgrp cp dd df edexprhostname8 ksh sh ln lsmkdir mteject mv pax tarcpio rmsttysyncsleepip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmwaregroup8spwd.db protocols8գservices8դ disktab fstab+ resolv.confL hosts+ ... ... ... ... . .. bin dev etc mnt mnt2IY sbinIY tmp usrvarinstbin.profile8ի install.mdլupgradeinstall install.subt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ... . .. binmdecIYsbinIYshareY . .. ftpgrepfgrepegrepgzipgunzipgzcatlessmore sedP disknames8 . .. . .. . ..miscIYkeymaps . ..termcap ... . .. tmp db runemptyY ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall tuner0 R radio0 audio0 uk0 random lkm tty00 tty01 tty02 tty03 apm R crypto pf systrace wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 R std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _hoststated:*:89: dialer:*:117: nogroup:*:32766: nobody:*:32767:  . ..MAKEDEVconsole tty memkmemnullzero stdin!stdout"stderr#ksyms$drum%klog&bpf0'wd0a(rwd0a)wd0b*rwd0b+wd0c,rwd0c-wd0d.rwd0d/wd0e0rwd0e1wd0f2rwd0f3wd0g4rwd0g5wd0h6rwd0h7wd0i8rwd0i9wd0j:rwd0j;wd0k<rwd0k=wd0l>rwd0l?wd0m@rwd0mAwd0nBrwd0nCwd0oDrwd0oEwd0pFrwd0pGwd1aHrwd1aIwd1bJrwd1bKwd1cLrwd1cMwd1dNrwd1dOwd1ePrwd1eQwd1fRrwd1fSwd1gTrwd1gUwd1hVrwd1hWwd1iXrwd1iYwd1jZrwd1j[wd1k\rwd1k]wd1l^rwd1l_wd1m`rwd1mawd1nbrwd1ncwd1odrwd1oewd1pfrwd1pgsd0ahrsd0aisd0bjrsd0bksd0clrsd0cmsd0dnrsd0dosd0eprsd0eqsd0frrsd0fssd0gtrsd0gusd0hvrsd0hwsd0ixrsd0iysd0jzrsd0j{sd0k|rsd0k}sd0l~rsd0lsd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0ptty00cua00rd0arrd0ard0crrd0cwsmousewskbd st0rst0nst0nrst0est0erst0enst0enrst0ttyC0randomsrandomurandomprandomarandomwskbd0 apmapmctl . ..chowndhclient8 disklabel8dmesgfdiskfsck fsck_ext2fsfsck_ffs8ifconfig8initmknodmount mount_cd9660, mount_ext2fs, mount_ffs8 mount_msdos mount_nfs8newfs newfs_msdospingping6reboothaltroutertsol$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 ARCH=armish md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ELFa(t4 4 (jjpppx_x_$$   p 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 xF/ P000`P`0 R ^ *0 0 Q P:00p 0S SX 00-SL@  @1S@DQ@Dt @Dt0 -LM$@0S0S -< L04S0 00 h|t  0S00x -LM`pQ 0S5/jp@PPPQ  P Q088 8Q  |$< p-PLM@@P` ph 0-@L ~PP \[yE7 0OSP8  (0i0SP[|D<,` -䢟䒟<LMP000ȂS09 pP=v ~@T` 8K0  \ Xn TŸ8 M$ R<Ÿ8 0a 08 Z0000S0A  10S000 B Z 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU ?00SRU!?0p @0S 0S  0< @0S 0Sp ?8p,P94 4(< l̎Ѝ؋0 -LZ 008p -LO0 -LG P00 -L<0鬫 -0L0004808 -0L004p0p -Lp0 -Lh0X -L)?X 0-LMK PYp@81 0D  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S ", 0 $>0 >0,p p-LM KP qr1 zD PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 ([>0 V>p,p 0-x0LP h0   aAq 0A0q08@0P 0R0 : 08p0 R0 8p - L >눪 - L >눪 - L  >눪 - L >눪 -LMd!\!TP00s D@00Cs0 00Cs0cܪ0X -8rLP,20  %P ,10S0q QP1000 A0! 1$P0 1!$0P00 tXCLQPa` \10S 0@F/P4 $A0P 08/P 01/P/C0  Rp: P 0 0; S0`@%,"@0h0Q XH=Phh8xIp4Ќ 0-LM@KWFP tB0: S\4 KP7 P0000 0pq0S0000鈪m @ 0-L1 R 1 0Su*Q  1Q   z3A }P 0!0  tB l؉0 0L8ˉ0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 B0 0 00(0048p -0LM 0RE0RQ0R_ x00 l@ R R*T bQ 200,00S hЍ̎4p -`1LMP``p@Q RXP@  . 0S@ A0/T0V000 0T0 0 0 0S00V 0pd  t;P@0 fR `!* 00 0Rb00 00p0 0 -pLuM0d yK,0 #g 1b1 P a!  B=9! = 1 o . P@h 0 ^r/ p` Pno JP PoOK 0!dPPA p2 R  x1 RtVOKd0`!A ]2  R ,1,R@Kd0!w?KAI2v?K!00/C#b10  70 L됀K p`0d wKP뉁%2 @v?K %00 ,0SD,.A?PxMb -LM@N@ -LGw  -0L0{P0 `@%,"0p7q / 30p`0-  噦P 0 pWp@0P`p 0S0C0X:T00  Z <  @08X4 -L Mȡ00 `@%,"0<pbq`C 2[ 8c8d0 K00 , PQ4 `0pSI 0SF 4PQ4"`0 K03K,` p  @0 pR' 0S$ V0`PP  l4@@0 pR<0 0S@0p R 0Spm -GMLM2 `@P d "qep?@E 0P8ܞԞ````F-K0 B BJ0 @bTQ7A~K pGpG@lP 4 04 04 =K 0C 0CD $ $d >P0-S D9 8?0$(?Ǧ 0DP -L06 㴦\ -LM`PTP( @(K,pK 0  (0@S+V? -L M0@p00 0Si PP 0S nSZ =P0`0@Q 8P QLQJ  0V0P 1 0* Y0  0000V 0`0,00 ,K, ?R0S@p @0"Sl 0,9Y000 LPH00D 0oSP 9aď -霣圃LxMP@`p#,dpA P0@$S3ģУأ`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpK1P`,r 0Sp j P g `P? pKP-PX0: S SK APB1 R 0 5 DP) `j_0SV pW P@3/Wp@Tj_ W p0 R  6VR   D RR?P!P=`LRy<#8,,,,,,08Xx -LMp Kt0@T` P ZP@ Tj_ 00T 0-x0L0PS0@Q  P 0S(0 R00 R0鼭 P-L` 0S7nS 0@ ,P@s)l0PP@p` ,Pp@0oS` \=Đ -蠟L0S 0 R0 R / X @ Pp`0DS 0 PUjOvP D0\j/T0 ,joj@,, p-L M `K P@0s  元p郃pԐ -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 V2  B 0R00 0`p @T Tb* O*4 Tv TtW* D*Te TcL*0I*,4  0! Q ZP@Ex0 Z/  p l1 R/ @pTg' hZ`PbT0  { P@0  PTo D  @ `P@0Ԃx 4 P@X)0 ) ) 4 { 5Y@Aܐ,, \ -0LMPpP`)0 R @;$0 !- 0 @厂0 R W@ $0@Tj_\z K$K,@@@,$00 ,,(P,\l -1L4M`, P!10 00 @,0P 1PITBp< AH0`JZ/ 0@K 0,@`T9 T7 N) ;)T) T' C)@)T T 8)5) 0@K,0<T00 Zj !)0 ) ) 0YP@U0   p 0PKY@,ȑP -`L@PP pJ0S p7;Ppx鈪 -LM`@P0p P@ H~0S T {0 $$P7~$ -0L ?Ap4 -qLMʠ`0 P6 \P0d .40( 8%P<(@dl %@ed, 0C0  $H0QZ T) Z )D 9 TDYp -HL M, 0 [PnP #1RL0S @D@030((Pp g@(B`@(v#,Pc P 00 0b0  0 0$ D0QZ T),Z )D (SDYt -AMLX6 M L6L@P p`84 , 0&_ps ?0@8Sz    $ L `xĶ 5` YPp0S JP44 R@ 8$ 9P41Ppl4 < @bTQ {T YY oP`) OP JPP 0SP*0 P9P<40<4 *P<$0R0X0S >P  TTPP B.K B B8rP@ 4P}p|0S e9BK@@,P XP@0DP@Tj_0T@2 R 808P0"8$ 84P084 1 RcBKHHۀP] {P5 0P0 , 0  P %P`| 04D000$ 04~ 04T 0 00TP` !3P` rP kP fP P`|2 p8p0l-|-خ-Ȏ ,HēȓtD -PLMP ~P` @ pK) 80S@@~ 00S00$a 0-P@ 0LSP  0S0S0 ܮ -LM Mß'}KpG` pG , P@ Pq #T@U *p`P 0S 2$PP @KA <0A؉ 3) 0QqA9  ~9@X NI$G$2 ,0S ,吟~9@TCNp@R P. -$+$KAA l~P9#42 R uOKF;PP 6; L aMK@D0 @D!9@.}z0Sx ~0Sz0S  H~@~##uK;P-]KZ P[K  P@S0 RuIKA 0}P?`:0StPP@' 0i7Tf7DDY6-L\,-dp|̔Ȏt -L4M⠘在T `D0, } 0DSpH  TTX' R  08S08pW $} @TP 0S T 7p DW7' 0}0WSPBO0gWpW' 7` t}P h7Qp`' 47W0 e}  p 7 W$'Z} @ 6pW'O}  6pW&D}  p6Wx&9}0S   R P6pWHx0p&)}0S$ $  R 6pW804&}0S( (  R 5pW0% }0S, , R 5pW0%|0S0 0 R P5pWHx0%|0S4 4 R 5pW80D%|0S8 8 R 4pW0%|0S $pWH0$|L |P |T |4W| ,0S ,宝0SG p4Wt$=0P% pW )HPTKPK&p3PTxWC@#0$Pz|P)0BOSl "l Rp^ ,3pWß 0#P^|0Stt3P p2Wl#0dM|pT_PT0BOSl Ml RJp^ p2pWŸd0"P/|0St t 2R $2pW0"|x0 1pW"|x0 1pW\"|x0 1pW4"{x0H pl1lW"T?pPBOl0 $1pW!{l0 0pW!{l0 p0W!|P0BOS 0 p0Wt@!t0{40H@KLKL0 寥000K{  p{-ܮ| EDDYē $,4<HPX`lt|ĕx`Еؕx`n$,4<DLT\hȎ -LM` K'PUp@ kPP TcP UjO 0 0-x0L0PS0@Q  P 0S(0 R00 R0خ, P-L` 0S.nS 0@ ,P@~ l0PP@p` ,Pp@0oS` g4Đ,خ -PLM`p 0S>P \%@Y%@@F PP 0 p>4t -LM@p`PC Tp KʖzP  0S -SH0=1@ !@!P 0@0@a| -L M$$@$$$ $0@@B뀖Ė( p-LM@PPP'PP |PpuPxpP` `jPLeP @ 0Hpp$Hpē8p<d p-GML`1 M Xa T!P0@4 8! Yp ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 @{P# $04 04 =K 0C2PvPx Pl v0$L--P@ 4[3㗚40t4HxD -L0. i ず묘 -LM`P!P( @(K,pK 0  (0@S^#3 -L M0@p00 0Si zyPP 0S nSZ =}P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0u00 ,K, ?R0S@p @u0"Sl 0,Y000 LPH00D 0oSP ,aď -Lu -ML M .0~`P,0 -Wp B0@3SPPPPP`PPPPPPPPPPPPPPPPPPP@PhPPP (PXt= <>LP P<P  ,< = =XLP d x=,L #P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C p p   InK`F`F4P@ $`x1Y0S 4: S < ,FMKHHș@ ( 1"Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l3+ X00R00S7 P 0@ P 10135:3P c X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A Д0AP,   6X@JP dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY0 <U U%1 ATE Uc ccXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx) <%!q0`J  0  5 SP L S3 p0# U Ugg Ug gg X 0H,଄  <Ja ` 0 %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 D4R 00UV `Pu4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,啖0\-<L<- =$<P$-`(-u,-0-l|4--8-<-P@-D-d-H-L-h-0P-Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$z]$ 0b> 40Q,V>d8U U Uʠ 5& V:%V#@AU8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5  P  p$ e /Pa4: S ܤEnK`F `F @P0   %=&`\d4S: 8j\d4S0: T([44 嬄 D D ~gF -LM@(KxP`5  ǻPpp0W0* R00S 0rS`Fv (P@ 㮻P@Z`F (00T <P 7P (0vj?(0 +(0 T0% -PL`p@PDP @T:T @2 %눱 -LPgM/, `CtPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  b%00Y00S ,0S 0S 0S $0S5MK  fpI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,[0 {$, u (l oX gP@ <4q0edA@A`XwPl -LMpqQ5Q/qQ&  q,Q0S h@4 0pp`8|@|PPphp<Q@pLpDp<p4p̞  (,4@HP Q-0L $ Q*  ~$Xl -LM`@pYm $K7?PRm0S0S 0 `$$0 UR#U| p-LM`PU@ T<PP UTUpTꈟ- 0\ \8 0000ӑS^ 0 ^0 Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T 0D 04 0$ 0 0 0 0 0 0 0 0 0 0 0t0l 㚐П$DdtР0Ph -LM00`Kq@ 00 pPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K ɽP@ 40 R0 0(@= =P0 0( dxP 0L=< 0p.PP<DLآ P-L ""p 0-LMt@ 0Pd*oQ l@l 80ho0(0 o 0SЪ -LM0:(0 P0( 0S(0 0 (K  nPP) 0S& =P`u 00,pK $Q0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 PP,00 0oSP P,0(0P,0 0 0P,00 0iSP0 TP,0$0XP,00 00.(0p } -LM `P0p-S000P(K 0(P ,P@  0S 0 Q (u<{p<v pL D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@奵ok0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@s&k0 0 -LM0@S  h= 0 << 0 -LM@R00$08  0 0(0-K 00 $ 0g@+$\m긫 -LjhRmȈ -LM K00""P&t - LP&nt ̫ - LP&ot ث -A0 LR`P p-PJ RDA R p P3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p  $ -LMx \, P`p 0LSE0 l@j@&jT 1  lW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,宋KgKggKga0S @K00!d 0Sqi S  SetplhrI k: Hhj<cj0 _j$ (8XخdЭ(tP(T`lH(8XhĭȬجtЯ | ,|Ȱ԰ 0-0P@0LS 0@0:00t-x- 0-|PL0@S d0di0y0 0HS@i4i$i0000t-x-, -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 l-<,H -LTM\ X3XSp`| , xp p <R|0g |0@0T #|rHpa@ P(000p0| `Kx| Pxt KEPJ4K|x <P}W x|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,6x Pi xV'Pl"WPP|0 |(1  0P ݰ@ff0l0  rP|0|0(7.t  i~pA|@Px :p7 PO"H t@ht@gt(4@H`0l -0L kmp| -qLpM@P`!GpF@9 -PRhp||`1`00 00Q @` 0T Q" T 1@K᥇P0: S 0`S  0`ST 8  (!-L|--- t P)-P -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R -iP1P h$0 S $d0SPP BNK@D0 P P`1:od?00 thIKAPP0 R4: SXd00--|5 |--T\- -0L 0WYpd -hLMP`0 4 L%sFp ?0@8S񟗅                 <    X                      (00S0$00, 0S 4 0S 0S#00 #000#0S 3000 t#hCl0P 0 R 0040 s4#0# m$#0S #0S0Pa0Ua 2 R 2 0 Rڅ @娂ŸQ 0@Pp [0p"0CSP|hUe P  qUX P 00 UM P@ 1\ ` 400ESx tp@PP .P:0 o  0 R, K=P#0ESU 2 ^@e/v P C 00Sd 0 R__P,8UU0uPuU4TuU,T8TU mdX p-LM@P`\0Se/ <0U $000 0 ph5p l -3L M0 P` B4414.4,4200 2 R  R- 0S 0S (0s& 0S! dBdeXD 00CS0X0ӤX0r Ppp $B00CS00Ӥ0b PpyWYWmp0SE 1 R20S 0 S,   , KpPI  Q( K@@"X _P 0 Z50P 01-*_+ 00TK 0Pbe  8Pa0S a0S *qn`0 Rt  P`0TU4WEVu,T`0u4TmdXfdgd -LM@a00CS#$$$$$$$$$$$$$$ $$$$$$0hC3$ e8` p-L M 0@'QP,: P*`@ 0@@d_ 2 0R @ ^ 0S  R@d0V@    PR@p42ppPf-U\ -\2LM Rm D2p R 0S 0S <s2 RJ  0Qq *Ӄ P1 "1\R' 2!Q0yM,@0W0 |1R PU`20S8SHl g420S8S] /;0@@`\P$`0`.d0 R0 R P  P xP  PldPXu,T4TUuWEV0TUU8TrdAedA,sd @ -LM( R,@:( 0e/2eT *0 SR:T -LM0pS`B0S0% g R2!t( p, l0 h4 d8 |`< l\4S X("UPB4S  <M0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ 1ia  0@0p 0 X 0S S@!18 0 0S S (   0   @ ޽t@ ؽ\@0 ѽM0 l̽EDYX(08DP\h -LM@VTp`U(OXP@H0 iB0JP@ S7,,---p-------1X0 e8@p%T`P0 W `Pt l /\ XT ( P@ p`A>P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / CP80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o=2,ݼ0 8Q ,  ,Ҽ008 P,,00* C R +, 000 08@ $ @,峼0 08P,,00* C R , 000R,10R,1 ,x刼 L,T80a ,<wgpXDY -LMZ0, x#00 00pӑ YX3T3` H DL R030!,C0 >0 9Y ( 3, /0 +8 '4 #<  m/ P@>PtB Z 0| Y  0 Y/ P@*P[B Z 00 $ Y (2"8@Too0, 8@T$׻$ӻ$ϻP ˻T ǻ x0@ \0 BS@TZ@TP@\ 0屻PU@ N/T0 壻 垻0 X0 00CS00  ä0T 0P 0mu ,<Pd|x,@Pd -LM@0p8(0 pP RP@| 0 0+!0&B|PD P@\ o_Ke/  P P`D e/ \ [PP3 DA@V`X`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUma(0 S (6MJT[apf]4SaT `<` U0 0-LM$PK@x,@  p1P h (K`1pH (00 /P@\ 0#Sf`(0,0 ,0S0 (,PKs _p , 0"S O\0S K\0 S4_`0$^\& -LM@]0S@ -LM@@\000S 00\0S -lL M@p` \ |0 0  Rp P00 0 ̯`` -AML ; MBK@$ I:I8 , 00 8$٩P P cP00 PP :P` @ 00`2P1Vj 在:P`JK0C 0C00 H '-<P"V4 P 0S44X0P`P44 0 44 PV 0S@40@4 ,P+VpPz 0Sw BNK@D@D 0<04SP  4 44!\0PpP^ W00R00ST,B~KpG pG @P 8V`P .<PPBNK@D@D0 044 S;;S(  0(,@40@4 ePBNK@D@D0 044 S,  0y,@@ JPBNK@D@D0 044 S8  0P^,@$ @$ @/P BNK@D@D0 044 S0P BNK@D@D0 044 S4 P BNK@D@D0 {044 S<tP BNK@D@D0&i044 Sptv,P BNK@D@D0%V044 Spt~P BNK@D@D0l%C044 SptP BNK@D@D0 %0044 Spt=TP BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S Z+044 0< 0<$ @T6 TV* P `D4<$P V wPD4` <$4 <4V fH"D4x<$P++V QPD4` a<4P V BD4 T<$4 <4P  D4G4 <$0aC1 0 *@@ ]*@$ @$ h,0 @qS h,} X*@40@4 /,*@40@4 *) BNK@D@D0 044 STI440CSpבxʑ-*@ @ ($ $<<`@ThpDYPXwv$4@TXt, -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph ( PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 *PU**)< ) )8))x)l)`)T)w)<L\p(X8L -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S a|` -d1L(M\@@K @ Dq04Q@K`@@ 0< 0C 02 0H 02 00.  ӵ ϵ ˵c ǵ õ5 0pB 0`XX 嵵{lDYL4p 0h82P *0P ": -MLM N~KpG ) e/9 , Q   P PpoP L) KA  BA .K B B)   JP@j(K0PS44S W(K0S0( K0@4@44 @@ @\4*S:\4 X4(KS:X4 0mKS(K00P We/뎎KH4: , $*P 00CS00  ä0k)(K00q P@ P 0@pSGN`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`XQ`X`X`X`XQ`X`X`X`X`X`X`X`XQ`X`X`X`X`X`X`X`X`X`XDR`X`X`X`X`X`X`X`XxR(S|SST`XDTQ`X`X`X`XTT`X,U`UVV`XXW`XW(V`XlXU` _OKe/e/  P7  # I|eZe/B Y0 P8 PP 0S0WK,@ +p 7WP@ 7 0$W2 33ZƟ6 R@@R@gYOKe/e/Z    0) e/P Z  P  e/cOKe/]e/Y e/POKe/He/D hOKe/:e/6Z  f c 0) nOKe/#e/XOKe/e/(8PZOKe/e/Z  2 / 0) {Z  $  !   .v7 4_ZUH0 @M3 RPZ )9B \3 R< C#PP  R0000ӑ yS0 R000ӑnSU P#00ӑyP 2 ,0S ,zy  iP@ &e/e/PU UU P@  00X $$@PP0S e/PZ  POKe/Ce/?e/; Z h |81 RZ  )9 $  P 5&0e/JKe/ e/  ~ ,'$P9Tl0ADYrdAU,ij(4 $u|\ U H\p -ML M R, p0 @ S a`BV00?V ڰp D,0 S ,x0S 0S8 V08ǡ00000PSV4 00 0 ; 0  P@` :0Sg  @1^:0^0n005:0 S0S  0 P<0S9 P@ a#W440 P @0 P1 R 0S 00b01@ Q  Pq n P 00f PT P 0SS` 0V0R00S`V@ P@? a`B0S 0S|VBp drpVp0( KBNKa@D\0 (K@D . 0<F(4$4@l p-RLM0@`+ a@ R\0"(\` ph4 ^0S  0 SS S0d0T!\ phI (<<dP0, 0 ph<h| -SLMp 8Ka`N‡PV(VT` P 0S0Sy  PK 0 SSZ, [RW R08 0R 0E @T0 4 0 S?0S< 0S DS408   P`1 R 0SS 0J(U` h8  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ P A 0h ((PU2UP 0S S R000(U 88/P0( $4 4pT -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`s0S@0 4$4 -RLM0`pl a@QgJ(T` iVR 唀R 0T  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i *0 `0T< 0Sh. 80iT (@@AP0h$4 4d p-LMKP@ [PTPT`0 R*0R*0@  [Pp 4$40 P0:00 -a0L0p@TP  S ႞P cP0 S R @000?S T S 0?S h`+㿸 QX0 ` BR X0  äX0 #/0DY -AML M4 8 , - MK 3(K 8 BnK`Fs< `F S   RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D OBK0A0AP@O0"S 04 Rf<4SZ0 MK 8+\ 8-Q `@  00* <\' qZP@/48`iV%0 U/ Z~P V  @0aS@ lZ  R ,0 S ,s 9 5P@<l40 jiO000@D0 [MK4h <0㩻gbSe4@D( b<$ 00]??A|,H0Y@0@D0R( O --K0P kS gS844(< @DmS/4$(4( Q 0a#5<4 44800(K RK O( K0?S X0  BR X0`  äX0h 8_" -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\1 ,0S ,sy 0g g0C B#b"Baa  X8 < QLL!LQH 0h0 0bY BKJJX@8<$Q;K  ,CsP 0(K;K, S QQa B RR24  o4 mL00CS0X0  äX0 !x, -$LkM0Ke/ ,0 4dQ0!PP P@ P' @T`t\oQX 0@@fQ T8@ 4T00CS00  ä0 i!T`@ QPP  P,#3P P@t x3x t,@0\#\3P Py@t 3  t0@8 # 3P Pc@t 2 t8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dRx0b00S@<@P!1P P@t T1T$ tFDh!h1P P@t 0 tTD.0 ,0S ,q0  e/0 a00M h0h@ H0uXx|< EXw`4$4`v,8 -8@TLPp60S S 0 (S"H\T& P`$ 8@T0S S 0R8#H\T@<0 P @u hP9p -LXM|`K@X p PP 0rSPrL |0@Sb00C8SMMOa嘁@O T@ p1GT0\0CS0<0  0DD PP 0/P* @)P" @TO 07@O T@ 0 T00CS0  @00T ᅴPx0K @1SlX8 E< -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 m 40@$4p -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 P!H0@ 0R!705@20  0 43$40@-@000<0\0. 0S?00  0@N Q 0  <0R 8\ *0 SSP(0\1R:0\<0S00 4,T$4A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q$4 4 -0LD0C6S[((((((((((((((((((((((((((((((((((( (܀HhcK@<840,($  ?K=K;K9K7K5K3K1K/K-K+K)K'K%K#K!KKKKKKK@pt`DdP 4h@t (Lt,T -L`pPAT 1SPUGA@@fP  炲=P9 p-LM`P@PQ@TpP Q }P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,?n 㯖P0rSJ /OP@ PrU B>K0C0C4 000 !P@0@@ I5 堙PP 4S JnKⴀ`F10 "\a0@|$奧Tʄ1SBKAA  0еd|Dl -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :W<, 8 4$4H -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S  P V 0 SS Px0`000< 0S40H. 8 0x $4(  4 -2LMpP0 0|0`` `f@t P0P tT @(@I  v 4  -2LMPQ  0  @ +@t 0& t 0T:`pW; 0 \l< X0R @ ,^0 0B` u    -2LM`px \p0@PP@ @| <0< | P T  -2LMP 0 Rp`0 0` `@t 0 t 0 @ 0xpx!t>P` @ᶔP @T<$K 0 0T @      Q-Lp`( P% P# P! P !@R PP @T! 0 /\ PMP P A4 $0x\ d $ P9P0S  0 S ѯ -LpMpK`P0sep @T X |0S@ 0@0qPM rdAedA,P9 -LP\p@` 0B0C3SOhHhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHhhhhhhhhhhhhhhhhT <0( ,0P<0( ,048  1hW <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o   L # 0 P 0Z<0 0Q>2 -L M0U@pC 55 u  % 5P@@T$4@  $Pp 4Q 0SDP Ppd~P(D0: S  S  S0 0p{ 00 R000Sg RꐒTT\T?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?r2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qE0S0||D K1Ps1 @_ 00 ~E!0!@P 00 oxE0!@g0*nE0d!@T P!P00p 0Q  SE0!u@0 0T P=E0 _@0P 0<0  H0꠹v4dvuu0vvvuv,vvm @8l -LMc0Ss0S 3 R S0S3 Rt3 R hCPEP,K ;H0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP帢?@2`DBH P(@ 0S 0+0 垢a$000+P !1aA0 @@AP|x @ 0XX$1 v@e0APR0: SN8 @TI0H@D0 R㬀 00CS00  ä00 =( 808 $0頹v4wuu8vwHvPw܈(v؈4tuv| -?MLMt0t` R   0S P PhDp0S?KK@D0P@D?+fPꤹ p- LMP|Ut`0   pY@0T PࠡC >ꤹ -\0L RL H0 @R0,0, 0>0>ꤹdv vPw 0-QLP) 0S-hhhĜh0  $fP@ڸ0 T ;;S0@0T@|0 tS>0VC\ 0T w>00  eP@0 0鬹vudvLp -b0LP@@xr cPP PX"000SQ8ПППlUڅ;;SNU8U0011 U00R@@T U 1 Q ZP=B!0|!>l1 h=\=,B0S B0S B0ES U0P0 0X R0Q/PUB0 S B0S B0S B0S00PX=00 000鬹u8L$\ -1LM R*ʔa0S& !00CSYxx0Sp1  0SK꜡00S0 0  0SO=L=[0ȌlȠ@$ K$ @ {P@0 HP U0S \p0 @0T@_0 0@TP 0Q00000u4uumu -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0mQA@ <000Pꬹu -L M䁟P@P!0S444UT<0000U$ha 0+ RQ R 0 QA!< 1 R wA T:P0U$`0 [0 njlȠ( `0P@( Kd$@ PMA$0H o<<TꬹL|vm -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 IPAb0 0?PV?KK(@D@D?+cP`G?+cP;@@ H$P+X@ HP00[0 P ,0 S ,1e@0 ;;@ ;@ @p  @` @ ?+VcP}ꬹmLX -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ cP, K;0h 7+P9T +P8(w wDwvHvwvv -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S , `0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 h002,P\0` Xp@0 W-P+P8  wvwHtPw( -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S _ w88  -%ML,M%K0(J⒍K JE(H,0 (H %`b}K(pG P`$pG; S/R P58,0 S 4,R_ KH%0R/S /00H5 0H5` %,K( B:KBP]:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH KLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V D*A e%K(JPJuP@ "   {90P! 5t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X 90l 44w Xx(w wwHvvvvwwHv -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4_4P 1@ X40$P$ 0S U0 R @4P 9 @0| ,0K8P P/0ST 000 08P8hv4<dv -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @Thv48 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0W3 83̹<~DY -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T MP T $`P ᆚ00T 0$`00  pXPl0(&PC3dAd@d@y000XRPعй<~DY -LpPP 0S ,0SP!&0aV 0S GP0S$0 0@0S# V P00 0$ 0 T %P(@`PP0I000ܹ=̹ -LpzPP 0S ,0SP %0aV 0S P0S$0 0@0S# V ⿙"P00 0$ 0  %P(@'`P P0000й -LM@(娙aMP@ 0S <" -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 {d0 KX0P  0 !@0 0 0S U0\<" 8H" 0A0- SPL@ 0]0S8  R0S+ 0+T"|" -a- `L0Q!0p@[ P20P d 0p QL e+4 $\+ PP """0 KS- L(}0P 0# -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞$d$$a=0A 0bPP2 HD 0 P,2 0 P 2  x*$0 S $S1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv A0#q8#h# (,$p##0 mS- L{0P 0#0 mS- L{0P 0#0 yDw -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#RDw (,H8$0 |0  Dw -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CSxxxa=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,Q2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P 0Dwq# #$$(,$0$\$qQ-H0 4S Q 0 S  qtv -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0ytv (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS   HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 y&S(0 S (O0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0$$$ (,$$ % -0` LK$KP P0`P| Pg*d 0QpL0L {P0, {% v(,0% 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0*\ 00h7%40 |000 0 Hwv <@8D%(, p-LKtM @`KP=P   \L0  Fp$p)0 00$l%%- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$Pv% -LtMpPK@P1 R* 0R5 0: S, .P# P v) 0Q` P X 0x @$XY)0L {$+P 0R @$vv% & & -MLP4M H4p , t * $00C S,         3卑P3 RIKII 4S+P) )#0@P \ `3 RT3T P00#$3 ,0S ,DM3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02LP P0SBB0S1 R  ;IKAAP!0S$\1  #v(4t!#11  BnKP`F`FU!B4: S>p@ PpH( 0h#00 ,  %x '#B  X Pw؈@wv(,D&\&Hwv<@8܈h&&0&& p-LtM`KPUP 0@T0: S ,Pp'L 0#pPVp' pv ' ' -LtM0@/SP @//!`@pKT/ `0S0S ĵx0\0S0S! Fx Hw -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HPm'00 "f' 0"<@@'l' -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00H4P2'00 T"+' 0M"<@@'l' -LM@V0Sl`0儏P '0S '04 ,"$0 RPԈPw'v -LM@ 0Sl`0WP &0S &04 !$0 RPԈPw'v -LM@0Sl`0.P &0S &04 !$0 RPԈPw'v -LM!@P& 0h!' -*0LM"*@:P& 0h!' -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T vP`W,0c6& 0 X!pWP  0p\!x/0㭽Q`& 0 XwTw'''( p-RLM`0 Pp鎽@0T<  &P% 0ph !% '<( 0-0@SLP 4 0R0a 0h2v8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  ZHP p R0 RPa- 0S0S 0  0 ,0S ,IK(A4A P a=(K0Q p0| 0QX0Ph%4 0@  `% 0$ `T(l(t((l -0 0R00000L R0000 R0@00x0 Rl h0P PP0 R P$ @wxvLw&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  :TP 0 0:S l R1 0 LP0~?0C0 hv0v** p-LM0@P/N&|P00l00SP`ph8<0Sph00phPw؈܈Ԉ -LTMptp % p 00@JS񟗈*+++++++++++++++++*+4+@+++++++++++++++++++, ,,,++++++*8,l,x,+,++,+,,+,,,+-----..+.p(4qDTR0S`0@0w,0S 3wCHPv  4 uk4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS"P----p------------1` 0S{1P1P1P1P1 87t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p R<1P@x   0 P@ P}UH@ 05 0' + w0v<+d+w\ |+Lw@wv5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0S5577YpP. Ym 80I`0< 80 VL ፅPD;P< PpX|P(L4 RYPW 3 , RC0S 0S iP 0S\30 lP@ @P P 2 P 2Pp()P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<P0B LP dP}P1 RY0  ]i}QlP@ NYPP 1 K/PP 000B"P奄P `P`P@  P*/P|$z `0S vD,,0v+T,`,l,x,,, vLw,@wP0: SU/00 0D 00SP  6 -4L$LM4$䄟P4 $4p $p 60@DSp=H>H>H>H>H>H>H>H>H>H>===H>=?H>h>?H>H> ?H>H>?H>H>H>\<H>H>H>H>H>H>D?H>H>H>H>H>H>=\<P?X?H>d?H>H>l?H>\<t?|?H>??H>?\<???H>H>H>?3x3x#000d3+ X3hfH3@c@!kP@ P =3 R )  #b尒ŸH0pK  p <2P@l  2` @ pp`yVH@ L2PH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS@@P@P@@ R|PP R0S,1 $\P t0 R { R 0 PPg Hwvwv4v@v$-vT8v0 v,,PBH-`-,@w[vww,(wHvĹ0|-4w, p-0LM` |@PJx4d0 P0R4BDL S00CS00  0p phPw-,-兂 P00L -L0L R0 R  xL-- P-L 0SmP1 0PS$ p,(Pp`="P@ P  ppP0VPPS0  U  0S(  -PL, . p-LM KPm qd R0\4P0 0b0CS#DEEEEEEEExEEEEEEEEEEEEE`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPhP @"#  0 S R PP   B0 0 C 0 0 v -L 0=$. -L0,=40 -p@LM? 0\4 0LݬD 0<جA 0,Ӭ0$< ά<81x111<2 -MLML0P`(0  0S ,(0 S (= @Rpx 0\S@ S  R R lPP`  DPI000S  \R 0R 0S oP 00@0@0S PS" GS0000S 00P 00PPPH]0 0gS pS00BNK@D@D ;2D 0-Cz(v |222,0223 -@TpL 0S `PUP P@@0`S 0 p`PPP PH3`3$( 0-\0P@LT 0 @T0U$ uP$3  -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00 0 QkPp  R/00`j @0/S`0 0@4n R/00p$ww33 p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpdPT @`H0@PpUP00$ww p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQw@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00<0& 2<0C<`0S.000SlS 0/S 000 00C0D ,(w 3 -ML M\\1 `P$ ^KPE840,0S/a~0S0 S0 K0S( .S @ Wp )~ P;0W$0 S x$$:d0 K@TTH~Pw44h444 44 5 85D5l5 p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0M|5 -LcMZK MpKK K(@DKK( @DN*K", 8}KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,H9T *0S 0TP*0S0T0* K\ 0 1(K R K(r0(K RK*K:K(}ZKX:KZK(8r0S  KP KZK(8TKQ :K(0, T\55555 -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV C@\S R0P -LMp㖲1PU|PP 0S`Q P@ 0 S/R< 4aP2 T,/00 1  zbPP 0SZZZZZ|00 R0 hh@T0 0S/S @ ,P$w660w8w4wv6D6l6X0X P -88L(0 R7vw66v p-L,M(@KP P P Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 宿PV ᨿPF ᢿP6 ᜿P& ᖿP0  40 县P ㈿PpPX!sp@0S vP@0S lP@0S bP@0S XP@P OP 0K   0K  w 0K  k 0K  _6P,wv[6 -x0LM @R`0 R P0 RP PaPTXL p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S P}P P0! 0px  ` 0#S@ kP,P  T/>367=<7X0X P#3!"c1 0c!R 0S R(/>3T p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S PP P0! 0px  ` 0#S@ P,vP  X/>3p77=7X0X P#3!"c1 0c!R 0S R,/>3X -PpL`@ 0Sd /PPp0 S 00C S0u 0S㗺P@j U 0SE00k0S1W 0S !0 0P!10@ @@P000 RH 0 ᚺ, } ᓺx P 00000 0S MS CS000 0S 0S cS mS00dv,QW0p0@ .QT@}  (9 7LP8,8H88888@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R LH -LMPӾ0pS@ q 20  00S| 0SV<T`q @ᶾP_0 1 !.B=R pGV0G SRhhhh\hhhhhhg 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Y@p010!.CDR Pk?C@.PT @} 0-LPL@DT  0鵯0S0 = \ 9 -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00墸0h韸0\$qv -dpL0S ` AT@0`V01P@P倸~U\ p-LMP@T0 pî0Sx`t 0 h0hлzX0P0B00 d 04 `G0w`98w9x9 -ML0M (R04 ,0  2 ,0S ,34! K!8 0AT ~KpGR0pG8 @TٷP@, Q0 另0Q  'P D! T4a=  8,1008 A  `0`PS 0S0m10S  [PT 4a=0 S0ń8  $ `9Gx99 :0:H: 0-LPL@DT  00S0 z d`: -8L@T`i !0pAT vPP! @T 3P@ bP bP 0! 0AWUh: T  vP G aP % d::: -@L0`SpP` M0AT vP @T `vP:0G0d 0-LPL@DT  0Z0S0  h=; -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q ㌶P@ 0`0 10 Ah/>34; -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S 7P 00 0 0   EB0, PhPP 0p p00  ` WPP 0X0@ P 00  h|T;; 0-LPL@DT  0t0S0  l=; p-LML`0S P0AT  0V@TPOUpl -LM䀟pPP, / 0"c12f1`cAT 0S @T㛵P@ `P pP ,000! 0A(o0ST l/>3< 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00刵ᆵ0l/>3 0-TPL@ T0 04 @0090S00S0pv4< -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@_BP 00(00 徠 000 ,0S `,w0T CP 0 p d<tv|<< -`L0S$ PPUJp0"S@0S ? 0RH Q BPUZ000ptv<@ p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p x -P 0S\ \P00S0 BS(}<}D}|00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR}~~}00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  W0S @T0   0+v -LMP@ OsPpJsP \ 00CSP0 @ ($ 0<<4v<<,= -LMP, P, 4#, N,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  TwXw -3LCM |3 B, Rԃ ̆؆ 83 R  3 ,0S , .BP0SPdU <"KA d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0h@>`> -LP0P0 -LwP0P0  Q0-LPp0 \` 0S }U0S @vT 0Y+ -LMPP`@% *5%4 @R&0K0CS d4 |   a o4a-Jυx4@R/,@ PJ?B(@PP$4b͉b@@0LP񟗜@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@$$ll@@@@@@@@@@@@@@@@@@@@"0:022P Ÿp2 |2) T"0 :4P<8  <2** R @ @$ 1 01 /Q1) L 00~ X @<0S@P ``) l 0@Q KP0  @P0l ~0%t w0f 0d@@ˉ 0 @ V/ 0 N/0@0`$Y H80(,Tw Xw -5LM  0 S( m SSa S_ "pPP  2}/bK⹴ U 00KX5 /00 "K0e;0 d% B00C S K| 05LKDaPcK  ZKA TT "?Klp 0JP d0S X B0 S  8 04P6 KTt 0)P s0Sh 2 0S B   0P "3Kd 0P  Ba=K 0PP P3 L m(0 S ((*2/KB [2?KJ Q}K0bK 0PK}P  $P8" B0S SXp@9pj1 $R R30K40,K0A0B B?KR0 0PK 88 #0P/K| 0#?K| 06$1 OK R20K10,K0A0B 2d+ 0K|0 p  R70,K00LK0B0D a=0@<P`0S@p?K| 0sP 0 B K  +;(vv>,vv> ?@?L?0T?t??dQ Q0e SeCR/R0 0S/S0SlQ00Q0S p-LM`\ P  mP@@E"}00p0j@ 0-LP@Po0Sp0 h \0P 0e80 0S(  6 ? (w? --LM$@0S  rÛꀼ p-@ALMTPH0 \pS`0S  `\mP`p鄼 --0P|0  QLl@ 0S \0\ Xc Hq@ 40儛$ 00vwwPw?H -0-0P L0  \P@ 0Sx0x tb dqTbT Hb@ m080O$ f00vwwPw?H -5LaMO?(PK5@(K, p@ tA LP L ťp0 !(5! e ! %p| D0@3S````d``4`````Xd``````````````Й```\$`0``Ĝ`ht D1 [KXTl!R0 0; 0,4 P(@K P 0 0SK sOP 0<P X+ 0 },Cˌ0 [KWl! R00@0+P000Pdb 딒/ P@P!#. P/ P / P00yP a 0:~PA1 [KfWl! R0d00g0`!00 00\00Y,AL1 [KP @EWl!P1R 0B@ˌ0 [_KP0Wl!O?(KR0,0<-|@1 [_KPWl!0R 0pSA?{Gz?ԏ@@0@@@A,ADA\AtAAxPyAlyx@yA4yApyB0BļBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A iPdC000 (3>K UPVXCX_K#^?K@|A 口PHx!1RS@$05P0;CS040@4Q0S|  `KdlA !r 10C1 =At0\ T0 02ᨪP@㦾T00< KcK0 ! 尳`VKe/K:1  < K eKڭ R x0S:Ც A % 0S g5  1 刡 5 00Ì bK 0Pʱ 0<~D$&r464\&=K@哫PpOd&Y?KP0C P八P Y?KP0C PwPwTgVF]?K b0(PK0@00  O? K ^ 300 0p1  000+]?K< W ]?K2 7 ]?K( ~vP@ 00 nOOK,Ai@@H 0-LP:0^  x0\*-P0\@ PL0@ D@P@4Λ $hyx`y0S jP^ 0 qPV 0 UP@ x0SJ GP @0S? <4I 0S tLDM$PMȼ\MMMM̼M8M N$N8Nx``NxNNN -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3 -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,2E.K B B0h$ !1`$ (@K  d 8 X \ @&? hBNK@D@D 0 P h F0D_0 ᣌp` "p4NX -LM r`p& PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S7P@N &御,0SA&峡@00,0S0 00 㠡0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0K0 (0XмN$NN -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  %0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QPX -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X, 0@89P @" Q 70$ :  0mPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9XpOxOOO -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 ᪉ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S , 4 0 |00S00YX   D0TPDHNPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:086|0W^ @P0088  <  +tX0OxOOOO  -0LM PU@p$`@` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" ꤆XOP$P$&P,QL 0-(0@ LRP 0 ,7, 00 0-(0P@LT ,XP  T00T0S 0 T @04 0-LM@0T0 T00S0 T0P7@HϺ0S|tp0 Rd T0K0  8 (Q4Q Q$Q$0Q0(!S 10`00!0`00 0@TQ ?P :0 R T@D\  0;T@Dl&zX T0 R 넆0(xQ0ЄQ̼Q$EFQԆ p-L@M P`K?0S 0S   pQ -LM`t`ğ QS, @ Dd^ 0S 0S p P0S 3 ,0S , 0ṢģL0SD PD먓0S 0S: 0\CS 0S ?0S 0S , @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎX0, -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD K 0 0P 0  Ta D0S Y U`4&B ?iPPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᘕPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S  J0@$00 Pq p2l2    1㤓P x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 @0 ,N0S 0Su P 00M(< FP0S &X^ P D Ȗ6C tt됆XTPT$,|yyTT8 TUU4ULUdUtUU DY -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*㼒P (@ R00  0R 0S R0R0S P 0 R TP` _X0 S00Dō<<<똆 Yy|UUU$Ug|yU DY -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  Xy -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00y| Y -ML M0,0   BR    xt P d$PTDT$E>K0C4  L44 r$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:W$3 ,0S <,  0S 0 S s S # P"   00C0 " P  000 00C0  LR0S-@<2VḒ@Y P  2(KWKK@$ (@ⷔ0\4  X$ kEQ& B0O0  0l{ 6`X!0SV Eo0 $5@"%$1 R0 P P& Pd P <0:90|sxVV(0T VVVVVXDV$MM DYV(VMU@V\V -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKO0((K0Q 0@^^>KMK ~ P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dX X (,0 S <, 00 00CS񟗳PP$0S&&L0S6 `03  00C SKX`hpx 0S 00C S' H(H0H8H@HP00&[ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R B$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00p PS L0S|3(K4!  `0A?( K A?(K KK N$\0 0 Q0hNK0ᴀ$00$03  0`0C0 ̓@@Q @T; Q 0S+ 0 SP $00$0P "00C0"l>KMK { PH"\D000.S "P 2P00L Rm `0j 0Sg 4\@P^>KMK @d@$00$0@1  0`0C0 W崀=@?PNP( w50.SR 00Ph L0S# `0 0S 0<0P$0 WXPV4 W0W8WDWPW`WW$WWWWWVWXDX\XXXXX ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000(0 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.\\ 0QP 0S P0  00̍dHK HKlHK4 00  F뜆8 4MYYX -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00qTꘆ -LuM膟0,0 ' p! "1PW1 1 1  6 \ᔦP  (` ,6&=Pz !,6"! 0&1& ȑ&đ rK f?K^4 Z(@1^*P P ?> P  RN/ 0`F<0^:6^  ^Lş 0P<,5% \ ?>1/1L.QAN 0 40\1弤 01 0S  1, 0 S  0l` K_KL$1O,6 1R rK P0S$1O& |Pl0SV1#O&mP<6 P90S 0S ) d1 0S HrKr P o mß,0 S ,C1! 0 000S  ReKL P !&巏001&P hTeK+ P & ᖏ!00! &Pq 1{ ve,6KQ01,&K `,6|AQ000L0SD1 S@D0S!1 S*0\!5 2! 5:? >PN0ׇ? >0N0CS101 ,6 0x ,6!q pX@0 H;X$Y`YYYYZ,Z84Z@ZHZTZ\Z -PULp`:4@$@TPZ ʵU:|ZZ 0 ᨽ0ᨽ0ᬽ --L ;Om p-PLM@P`l0l R fT D0 Rp80 ㍵ 0  F밽?pZ --L  --L  -LM@G@ hJ --L  p-LtM/P@TK P0: S p0`rSɏ ֍ 0-/L@PU+D0 00(J/00(+ @+@00yZ -LUMpPKPhP@lK8a0S(0: S  SU UP U@P P@0 R000K@=P h1: SD c$^ꬽ6ZZZ P-L >P <[ -QLM@ P T +_[ -L 5P  [ -kMLM7 6@, @6K0A䆟 A 6 PP6: S 1PK }&P0S| |6 Rq 0 S i\b0Sa L6L&@HfHv@@ @@@@̉0 0ȉ0S P5P(0%<00PC0S0S X5 ,0S ,-L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6DP, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@3PL x3PTChG T3P= P03$- 6SR ,@!0@T00 "2 jB00d0"S P x2F|lPP\Hd,(PPO@hT J/ ms1  LPP>, ym&R0S%"0!S$ pu}PL~= ,= 뚙?A4 0[U,$0P[88\[[[[[[ \0\L\t\\X4\\\ ]0](0$T]x]]]]h^,^4^@^P^X^l^ DY -L M, Zß ?Vs3弃 ;^P c+ 囋#x3R,p / pW,P  0bW@k0EOa.6 0@Ɔ& 6F@VY3 ( &$6Rr 0(& 0DX00 SB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +RP 0 R,w6P@kU*0 Q@tPU:aA ,0 ,8XS^^84^^_D_\_@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% X -PLM@ 00 R$hk)$_? -LMp@F`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! lc.7`fP%UP0FOa.U&pn  0 6 & p@ۇb0PV6@҇ $8P_<_ -0LM@H HwP0T E};! }edA_`-L0(&S  d0 P0S\P P1 Pa S\Q 60QX -L: S  S  S H0 R4V S S  S S\` -1LM `ReTEP@@ 5T|1 RRp1 RNd0ST D1 R < 0QXp([s00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT YT00yTP p P00XGp@4(T$U0 (p`0|``` -0 @LM̀@@0 ` @@``نPUPTp p +@(P00TQ  p0WD0@@W؆܆XxX` 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0XX܆؆` p-l0LM@Ɠ0\S` @088 000 0 `PpX ܆, p-LM0@S` PU 0 :0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T ꔆDY,`8`8X  0-L0P LR @  (Q$P 0̮ $`Ua -LM8pP(2G 2 R b  ? @_zoTo 1 RP a@T T rPPNUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1o 1 !@Pቅ0 c@C@0P P  ?o@0@ 0P PPUgHz ,84$XxXa܆؆0aPaha8a -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, CrQd4 ,W4 P[ 0@0K,02rQM@4 8@ <H4P8pT54 ,9 R0,# @K@_@K0 r 0`Q 00Vs# @0P 88 x 4@0pW 㮭8@̄0@80 0ꔆaaaaa -PLM, 00 ]@_l!@K0/a,@@K,< qQG 0 Q0PP< ,@`K 0qQ.f0pZ o] 6@ 0R  @@K0 `@0PK_tp q e,\@0 Z<,S00 ,K锆aaaap@-t@00CP`P``?>!@\1 00CPp010  p褆 -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH AT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f f؅9`` Ѕ/00f V:TPU L0L X0 0 TP z U \K6u -L u 0-LMMpPANK@D0@D` 0 mE I80 "t 0S i0$bԆXb -LM0@ tt@ -LM0@S GGGG00S lh0 R \P0008n3c눪$dblbxb -L`P[똡嘁q@!pb@1 PdHHHpHHHHHHHHHHHHHHHHHH@@1@@@0 600%@0 0QQ0 R|0 R 0 R|0 RP0 R XukP L.H0JDYbpb -0`P0@LpP |@PlP 00UCk0S8(PP$1 0 xI0̷  -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rp0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rªp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl 450@" eX`j@0b -0p`0P@LP g?P@ 000T0S CuP@ 0 xI0̷ -LpM` 0Rp䠟%  qp@ PP  PP p @T㆓Pl0ld0 KPL, P 3kP$Lt -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?QRRRRRRRRRRRQRRRRRRRRRRRRRRRRRRRQRRRRRQRRRRRQ0,0  `  L4H4 0`00 / p0SV PEU@# l>P PEU@ȃc0S r>PPE@ $0S33 |3 00S UD30 0 %Y U Z U  ,  $>U "0p0t0 ڴ.>PPUU|>P\PUSPb0S >P 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q dzPE@< 000PEU@ 00S1Q! 00S  =0 noP 501S00S00S @ =|0 UoPp2밉nXgTLmbnnnX>HnPn 0-TPL0@S s<0Ñ  0P@0000` p-1LM0`@PP oPUP  nPPp nPx0l nP`P0X00 DnP< 000pTԏi zi ni D o~i  -L,MD0P`K@p,0 ($ ) < np u0S q0S m0S%@PsP<   np2<@TU  @00PEU00Sp<U},0 S,i$o(oo p-L,M`0P@@K0 +$ ρ }<`0` Sn0sHD p,8m i 0S npi$8oHo`o -L8M0@(0 LKPp`$ ᙁ G<U0 @ PK'P @Rp0h-S`@dF<P8@ D0D np0 (0S ($tooi$oo -PL` M0 p o'P`  0 Sr200000S0p,K%P dj,PU V 0 Sr,200000S ;P m M Ph0 r1000P^ 00S .   AR #    tAR # d; ; 00S ZP2  p,Z  ;P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,&V|W<<( 1ooȉL\Xgo -L0 ,>;(0( mp Lzi o -4L ,(;(0( lp Lyi o p-L M$@K DQ]8 lp$ ${P`  $0 0 ` lpr 0$ PS 0@UU0  CR 0 R00h 0PU@H00CS00  ä0 ٥v{pxi p$pLp -P0LMH@D0  \ (0$0  PH -0L0  -0L0  -<0<L00, Ul0Sh3Li hp -80L4000 0?l0ShLDYi hp -L, 0000 0PH -0LM0@S/ h00S00S P00  U~,0T, @00 0 0 0HPaxp -$$ 0L00   -L(Mp0@PK` @ 0 d k0S 93[x DT 0 T KkP@\ 0S, Li ni pp Qd0d0A00d0mm -L M Kp0,` #%$P@\  0[4+t0p00dS XO90SHD p@h 9$ P0t@l0@Bpmpm p-0LM0`0S )P ~P!K_#P܍@T 00S i9P 0S 00S` @TV80$pp<po q -PLM`@Kp| `$#91 @`$@0 DP 00 ,χ(0j0SLi HqXq -PLM`@Kp| `$81 @`i$@0 DP 00 ,(0j0SLi hqtq p-L,M`0@PK@$ 0 ~ 80S J~ P0r00000Sp  ,K8PX PeH0~jp8  0S(pqi$qqq p-L,M`0@PK@$ 0 } ~80S ~ P0r00000Sp  ,Kh8PX P H09jp8ی 0S(]pqi$ rDrTr -LM@0Pp`P  R0@r1000xSY@Qg W 8PY r10000D0S  rt10000D0SX0UYDDEY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S 7P@00 `hV f }`|dr|rr p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  php8@mT$@gTp|r@rJ 0-L0MPQ! @0K  <K|0@0  ; K@ P \@@0[X <0K@7H0H <0K0iP0 0S 90Li rr 0-L MP0Q 0 @!K  |0Sp R K7{0@KL  7@0@ hp0 0S 0rirr -LM䁟0\pK@8 P`K$0 3|@ /|0tL0 H0 0L0 Q aP L0H K2lpK1p`K01@Tژ2 fp*QtPP@1@SPTUpPl rp200000S 0:SP P8l hPPU t@T0, CR 0 R00꽟p0K1Sb*U@ Tڴ1S0Sp\X1PT![ L0D XfP 1S  0 CR 0R00ꀟl000CS00  ä0 \p00S),0 S,VLi i8iiiisssti|tCBt t(ts8tMLDM1圑0 ,   >KK(@DD@D d`y` 4P eP` 0S;,H8>{KL@K(pG $pG>[Ey Ay 8P 4p 3 eP@ <0S& <0TP( 0 0CS00ä0<0@T|PZP ,0S<,oi ti|ttttt -x0L`! @ T @ 0 CR 0R00ꨞx0  yytSpRW` LDLSTP@{UPSU$U _ed0S aB0S 0BX 0 CR 0R00a505P d 0 CR 0R00Jx07< htttuuCBu$u0u4uu 0-0L0MP0@@K( 0 Yx 3|0| dP0SX{0 P0 H00<$  0S(06i(uuu 0-t0tP0Lh@h  \0\00 002@08 dP$A0L5i u p-LM@`00X`PD 8^@P$NP^Ppv(vTv -Lqd0d0`pTB0@#nPp@@Np0 2 0vv -LM@KD004 ( 00vv -LM@-D004 ( 00wHw -L M0p$0  @pp`0h\ր$KP`@$0@@S ƀtwww40S 0S0Sg|-L0S 00  S\0S h| 0-@PL0 Np0 ダ0 h| 0-@PL0 9p0 n0d| -LpPP`@ld0p0`@0 @O8Zi@T( 0 CR 0R00pphfp,4 Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00@ ` R"R000ӑ0 CR 0P R  U 00# R0 S0 S0S| p-L$M08@K`  Ql` g0/STR `Q0.SK R pG E< 0H܇<dԈ0 ᔒ\ -L(Mlq0@PKda @ 0 ޅH MPD3[1 ,,!0zP"P  0 S & 00 0 x 0x 3KLP8T 0ꖲ8 0\i  0DT`i  -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LSY0S 0' ; 0P$P 0x 00P 00靰8H 0ꓰ$ x[`|x -!LWM0,0  p᥃PUaKJ/ ^d T JP=WoK0PS @W 0]KS  @P U00R00Sm0 ,0S , \\ K.0 Z0 O \ %]D0D <T 0$ 3Ji(؊ -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ KQZl`K@ X0 0p P ,0S X, W@᫯ 0 ` h -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' 嵑p2 H0@/S(8\ht,@Td@P\|$0Ɵ:;;@00S lVA0C2SE0<00S|090;0:0;0:080gş80:( 8 07eFKL L4EG.Kx t :  B0p l 3P 0 .[5 09K@ e0:;8꘮ TNKA s@ 卮0S 0 R 4%RQ #NKA <4P|ß0 R 4 R Xh 0@0pP00<0uY,0, "NKA 23 R 4 R0 S  "NKAQ*l2`P0S2 4 R.". ]3P" :肟@60 ;y/ ;9T 2P00(10 \FpP 2 T =pPp!NKA P L0 R 4 Rk (`rۭXDD a080 00V00NKA b1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.A(0LxЌ''@A\x܍4ԏ ,@Ll  Ďēȓ<DLlЏ̳Գ'u܏ D`lx<ؐ40HAp1 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  tY2'<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D SPJ$0S p0 00 )VP"0  NNKH2@D@DP)`' 0T `VPP2)( 0`VPxn Mp X 0S Q0S33 0 $.0% >5 LUP$  #0 5@T @@T p\T`$0 00000000@~V@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 ^Vpr FKNK@D0D% R44:0  4 $: 0 ;VPO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@UP86'0@UP&@)$ 0 @UP6)% 0@UPE(@C @ծ  Ϯ 50C5 | @ >qvFsF,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @]P> H804 =KL0Cˠ 4 $5 4 HP5 D 4 {P L%$  R 0SLPڴ0   O0S T0S  @Pr8E@:0=KEK0CL0C 0 0(Up: Rh[f خ; ծ/g P|D0 S \N>K0Cɠ@ 0Ct* @T <|05 }PP ;@<\0+0@0 )<5. TPh0s )|; TP0s ); TP@P 0)3 TP%6\P$O.K B BgPH gPJF4%4 0 @% 0) 30  @0FP@ V @ThOnK`F`F 0P@5@ 0S> FP@TK,3nF4]R@=PH) P04 X=@O>K0C)0C& D TP 'KNK@D W-D)+ 0 SpDOKI) 0Sp$,.N>K0C 0C@ SkPT.00 1lA{$x>x 埪P  1 PPj1 hJiE  0 V$ RE,%0`/PP0  P$ 000P ēȓ -LM8P |0 R 0 l00 7L P8>5P 00 @4 @ @ @ ZD K S@@$L"<00    0  -3L$M R 0SS@@@@@@@@@pp3  kS\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p -0P0?@ P`2 X00P 8 {,ʬ@K<@@<4 Ġ̌(<"4!Č ̌$0P -ML,M"0"KiK0(J, KŸJ@(pK(I @I" R5 * !딂0" + * tr0p" ! * 0SP `Va (" * *Q 1 R O  tK0\ ,0 S ,68W*P@0 0|p`0 00 P@e/0 L/+K0L $1$ yK0pG@!0P P  * *P@*0 &/T 7/0 L0 0 t   *vY@DDlEx`0,4$<x -LMf@0 @ 0 PRx()<)h)***************************************************************************************************************************)**** *(*0*8*@***d,Q(((((\" 0S < 0ͣ$  048<("#0S S娣0S S 垣 048<("d`厣SPLH兣@<840,($ PPK⸠ .0JP g .0JP ]. r. rM0dpCI 04SM+D,L,T,\,d<`2  _  R$ R <W 0PPK .0QJP 0 DRWPPK .0>JP pU 1MK @D K@D @ @ 0Xt Ptpnlhd`\X  04S,,,,,ڢ0   Q1qܔ(TFTF|,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_p $(,\|4 p-LM@JP `p -LM;@T00.0`0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;U8d -L0MԂԢ 0Pp(0 PTPK 2b20S @@PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K]np (0S4(< p-LMP`0,@KHP 0  G 0Sp̛ -LM@P  00R0R  00Sh $ -LM@P he00Sh# 0-LP@P $00S0h# 0 -L M K=5P@![A[R0 ʐP /x0td P00TT0@LP 400 PP00ht@؛ -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 -pP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*?040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0X  -pLM@ 00s)0@@-`@? 0"00\ 0S0S000\ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$ -x0LM@ 4 BN@Ap@0t hz 00Np 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0(00S00B>0 @-(0A> 0$Đ6I  -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc5=?0/9P6 0S000 p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0f+pqph(pМ -LM'3Px 404@0  0000 0 00 0 0 00  0?\00 -LMX@ 0S 00 0< @0S0 04h -LM@0 *pq @ -LM̀p`(P@TC@!2A>B.A 0 0$D4 dD P  40 40 4sto\ 0-tP@0L 4@ 4@O 40 04T<0@0h0\00 pD0 00000Sp00000S p0 000  -p000L00 0S0  Pt tP@ qL0 0000 0S8 0(0$  x(0 $ 00 0   -L 00 0 p-LMP%f@$`$@000_@000pW@ -`Lp00S 0P@F@x 0 0S %;@0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2?0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U u?0 @0b?TU,0@ 00c0m^ -PL0`0pS @? 0 R ? 0 0CR00S 000$?000 p-LM|` x0RR@t?`0`P0 0R00C0h?00`00S c0Sp 0-p@LPQ?`0P0I?D P:00@P*0P0 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00 00 0-L@dPjjlitii|ijjTjxjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&,||{D~zxD~{z}<~؁~p~Dh||DzP{TTD܂ }l\4\x}t DDwH 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ TPP  -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7  -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 00  -LMp`pP@uV iE 0S<00S,00S 0 0S00C4P'I꬟ P000P -P0Q0L00 00 000 - L00 00C0 p-LMP`(!@0  000p P0-L@P@ 0T(0h(0\0PP0PP -LM@0S00 p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@h | 8< -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x  h<| 8 p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`php -L0SH hp0 s 0 0  Bhğ -LMp`pP@u P |00Sh0 tW V P@(0 f K!t$ -L M@Kq O p-LM`pP@ux<pP@uPph UT0 ph$@$ p-LM`P@P  P pyjP@$00S/ pht -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@\t -hL-` 0S 0 0S<0040   0+0 造Ȼ|q -p嬀0L`S%PPጠ K%@T0 C%0P08  c)  b)P@`L0 0DS@0 80 40 00 ,0 00 0 @ -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 n)$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(L@hp p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 騻@P $4,$0 000@P xp$0 000 p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp -@LM80 00 B0 @00`0餻 -T0LM0@SJ@000S P @TZ餻 -0L`PȻ -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000H -0LM00@0T0p` Pcڴ10U 010`@#P`  TJ1U RZT010Pe0 DPPE0 0U00騻@D -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c 鼻  P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P%0 @@0@0@0TP 0 PX 000P 0 yP  000H 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000鼻 @P00S 00<0< 80Q0(000000᰻Dx`0 0 ᰻ p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000p -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pfm"(0PE0@W0000@-p@T* R  :P0b0D 6@0@@0@0 0̻< @-P 0S 00Q ̻ -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 ̻0 -L^ 0 餠L -LMH@0S dR 00 000P0048 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   L̻84L -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 ̻ -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S \GECU, @0`XP 7LPp% 0S" 0S@PP` !@!@@?P 0` U0SPH 0  0{Y L W40 , ox`?x0 400S APa0@S<0 -A @L2$0R20<ܿԠ -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(<ğ\ -LP 0-LM@ PKT 00000\ -L M@K0,sώ0s 00@3L\ -L M^@K |0^0s 0s\0000 H00 0400 S P \$ -LZP ,0, 0S \@-, (02 S@04RPL 0-PLMP0K K@XP# 0S00R0S$ 00  0錷P P-L0 x huP6 0-PLM@Y P 0P[0=0C:SG                                                      lPhPdP`P\PXP@8P0v040K 0(10 e0dPPP0HPPP= -@LMTd ThL0 !@<840,h}8d@dء -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK Kk@h0@1` 0`V@KZ0@V `PKO@LP0@`0P KHP  $0S4$@DDa,HP\l -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 et -l0LM@QT T@ hN$0  h`d0 R00 -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<,,,,,,,,,,$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4xPxxx W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHPX -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  8dQ PP -LMA@0 k -LP0 0S00 -LP  0   0P -LM0K0 =錣 -0L0h -`LPp@x`0PSE 0$S T; P80 0C$S'DPPPPPPPPPPPPPPPPPPPPPPDPPPDPPPPPPPPD00@f A 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`騣 -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R\xPl\0S R 0 R000000ӑS$0S\A0@Sa @0R0-P00 p-LM@P` ័X0@0P SP000000STm0Sp  -LMK -LMpm`@@@# 0P`頭 -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS 00CS $,84@T U7`KPP0DS { 0@p p-LMD`DP0@S 00P@P0  Ppd 0-@ L08PS@00 0R+0@00 -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 40 P@0@@hp`0Z-00hH  ,0 S , -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH  ,0 S , p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Spgfff 0-LM@P0$@K 0 O 0S o0 0-L M@P0@K 0 }7 0S W0 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hd 0-L@Psj 0 0 p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >pdpT00C p p000C 000C?0010@-H 0\8001000\0 0100@-<00 CR,0010 BR0 0000@-8 0R (0P@0100 R0 p-L MP` 0@R$K0S ]0 &00$0s 0s 0 01$ Kp0@-P 0S0S0X@0^! 00S 0SN00^0 0AP<00 r0s  P@-p@0\`0 0r0s 00000\0  0P PPB@ -LM\X@TLD@0 840 ,{(0hP p-LM@@`P8 0S BPl   <0  ptt -0LMK0K00K 0-L M8P0@K 0 . 0S @0 0-L M8P0@K 0 N 0S *0Ĭ 0-LM8P0(@K 0 n 0S 0Ьu -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓x 4<t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\Pt \̷L p-LMB@6P 8 8 8 8 8 8 8 8 d 8 8 8 0 8 8 8  8 8 8 8 8 8 8 8 8 8 8 8 8 $DP8 , 8 8 8 8 8 H  8 8  8 8   8 8 8  pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-p \t`H 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf\ t t t t t t t t t t t t t t t t t \ t \ t t t t t t t \ t t t \ 0B0C2S=L h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h D h h h h h h h T h h < h h h h h h l 0 00 0 PE000$ -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:gtDY0 -D0L<080`00 ,0b A0 d(0$0 0b0c0A} -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00|\00SH00S800SSS00S0S r0000000S0S000  $00S00S -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVpx -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CVhp -LU0S, ,h0S000hVxج -PlpL† @090SX L0SdC@0Sw0P -LM@PMC0  p-LMP `@ (0K l0 0"T\^PP (0 00 p 0-DPLP @&T000  00|@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q@hphx@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@ @ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 T, -LM@K=0s0s n0 c -Lr 0 0S0 hhx -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u $ -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THLh -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P جhx,($ -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0|p@-`^@P  \\ 0S 0\ 0SP@Up^p 000 000 000 -@LMTP oDl< gdah]&&' -81LMXH @@ K}sC@`a:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   i&LL< -LM0$ KK 0 0 P$ - L P00? -LML0K Ap@T0[S00KT[ -GMLM7GnK, 7ǟ`F `F@0pxX D D d'TBp 20@FS++1111111111111111\*1111+11\*111\*1@,1,,11111111111,, --11$-1|-11-11-11/0 011l00$6 R6 6 R0%<0UK1 Ly4S 30(8UK1 Lf4S d <%tT5  n@5k$UK0 LK4S 08:$000S000;ꬤK0 L-4P@S =04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L脲4S >0$000QK1 Ln4S (0,0dQK1 L[4S d0 0QK1L H4S000 1 bXq$B^KPEPE@bP  3P $0;P H^0-S [| U'|  00TlTЯDē -L4M0 4 00[ ,0 nZP@K0@\P@P 0L0iP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 8#8L0 T3 M 00CS0|S0 000P@7@< 000<0SC0S #0P ]00ܻ0 9/㴁L< C444 00 0hBD@0px_ꈻd2 R  4@ 0SZ ,K00D ;PPJ <D080 ` 1B< @K0 00!P@$ P 1 xᅺ.q@ R x{d.`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @Q`VP$@Z -@L MX O&>gopn00~X$`pZ p-LM&> @`@Y NP PU$@p4 -LM@_d0q,' !PQ YP@  $ (x,` Uv  V  iU0 0 -LM4@_d0q,' PQ "PP    wp00P0S@,0  ,  ,0P @;t  T @V U0 0Q  J(@sd -GMLM 0`p,0 MK@D@D 0P]0 )K oO~@0  pX `V@$p,0 S ,6yH -LMkU뜐0,0 so P 0  @lP@X,0\ E0[S ,0  X,00ZP`p,0  'Td8 - 0 S[R䄱X -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@0 o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Tp -L 2QU -`q00 L 0p0S2 @ᯛ PǸP#Uw 11>p S11>.QQ$ DS<P pS HPh 0-LM OP R|@|K  0S@ #pX /Q@0TD  <Q+ ,0 p-MLM`@0 0 Pᅡp* AK@@+0YP! T*AKAA 0r00000S  r\00000S 0S@\:0 S0tpl-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0d X- 0@0PP0P0p p-LM 0@Pxû 0`0X0S 00 0 0Q@P @f p鈪 -0 SL0S S h0 hrR -0LS S hʞ h> -LM0@S S 4  )h -0L sp -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPP0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@)P 0, 00 0!0 0 000DYPKL 0-LPcP ᰶ@Te?0hU 0-LMdPCP@ 0 SEKP0@   T0  -9L Mɟ 000`fS eS gS )))000P@00GS񟗳uuuuuuuuuu@y@y@y@y@y@y@y4v4vv@y ww8w\wy@y@ydw@y@y@yxw@yww@yww@y@y@y@y@y@y@y@y@y@yyww@ywx@y,x@x@y@y`x@yxx@yxwx@yDyxxx@x@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@y@yx@yDy0yT u6 0 00 R5 5 5R95 ! 0 B 5E ,K帞0, R( P00R0S p AW\5 \EPD%00@%6 ,K⛞0, R P00R0Sp44u44  44 4 G$4 4=$$000ktt0 0 0( X4]TT 0ʪ@4S<4Q4APE3#0000E3 3<3   83 33/3)3 t3$3"3 333$C|P03\޴P D״P 0w(3 L3P0@S@# 2 .pp5D2P2U0`c MTPV00 S'V00 S`F1p0S "@0003@2 0T$223 0 h10QS0  00CP !X1 P 1!<tl!00@T410SPLV00S0  VQP0P p `Fvp ?`FvpWop 0,$ p4 HH<Xtx( -LM@PpK# p P0Sʄ0 Q T p`4p  00 0 $c -LM@zhT@- 0@R:T 0 S* 0R S R  :0 0b0000 00 0+ -@L0P00   T00 0D S0<PP4 0 0PS0h8 4R00C0 R0  -LM@T- -LP p-0LM0Q 0R0SP  x0P` 3S S SҨ 0TPn1P@J0S `p, H -PLM`bPP20S|N P `20S7DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0VM SMP0SXJ@X00 R00SJX 0S0S0SL 0Y0 R00S <00SD(M   p0$t -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 07CP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR I0 0R00Rh0 : -00C0(lp\ -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Q| -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S XP0@ NP00C004 4   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, -P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S| -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y:Np50O00O4S  0 0 Sr400000S00S_S   P0S r@400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr300000S>00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -L5P5 t -LP+ `0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0-\0Q 0\ a p-1LM0`S@P+P10S U t0 CR 0R0 S 0@00e,JIP$10S U 0 CR 0R0 S 0@0H0,IPU 0 CR 0R0 S 0@0T.L@0 00CS0 ph0  0p,H\ -LM@PE`p!'pF@K 0PD@8L\l` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$00@<8 4ē p-LMKP @P`J011QhTZ ϑP@Tj_EZpD]P TP`6 -LKM MCNK@D0@D,0 pgIKKPPPM.KAAygP@4: S  S \RH,0 S <,imK`F`F P@ PP  sP@h 2 R_2 R B{PO \P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K dKKNN( 0<K @/wP`! #04 1D MNK !0P 0 0@xNH{p G@}P p @RD@0 0Pd :jP $$  pR:0P 0 2P T]] (P@T Ph5mK`F`F P8ē4@<hN̞\ -LMp(KLPP3 @T `W@ W Tjo(T%PZ ( D +(00(PZ ( D (00TG鴓 0-x0L0PS0@Q  UP 0S(0 R00 R0 0 P-L` 0SwnS 0@ ,㦫P@%l0PP@p` ,㔫Pp@0oS` Đ0  p-PLM@ PPpP .mP 00P @Q T`P. XP 00P 0Sp8 -L 0KM#+ -L 0f4P -OML M\3PJK@@| ,  u0c(# %ph 90@?S_긠(((((((((((((((((((((((((((((((((((((((((((((Ġ((((ؠ(((((((004004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQFPB 0 4 04 $ 0* ) T XQKAdp* Z5<4 Y584 X5;;44 J>K 0CPBP P| BN0$\'-PPL 0<1 f0t4 x8D -LM@P T  Q q0@0  R\  @ -LM@ P T  Q q0@0  R\ X 0-LM0P00CSK @ 0$ ϓ0 R  00@1l0 -L0Q e -LM`P<P( @(K,pK 0  (0@Sy> -L M0@p00 0Si DPP 0S nSZ =ᘩP0`0@Q  P QLQJ  0V0P 1 0* Y0  0000V 0`0A00 ,Kᯒ, ?R0S@p @A0"Sl 0Y000 LPH00D 0oSP aď -L$M<@K`P6PD  P40KPsC圃 -0,0K * K#"pr ?0L:Sl긩pPpdp0000S  @@KXp| @ ?@h剋2000,K +K.0Se D 00|!0`VQF `Fv  PPp   0z`Fv P@ p~P yP tP P@D0S  Dp\0l 0 aC#40K`XLD0Ȏ $[ -LM0@S\ *PH %P8PP Ȏ -ML M0ß0`@( ,0 @3P`d088 B~KpGpGP"04 0X ѫ048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0B08@Tn ip@` P- UR4PX@ 1 ,0S ,cKAA BP<8#4P ^  \P0C0|0S  cY  CCBBU448t3B08@TBbTk 8pLTDY|, 0-`0L@PT  ㈋P @T(0 R00 R0L 0-D0L@PT  jP @T 00DDY p-LM:`ѦPP 0h 0@T  KP @T0 ph  JpyDX -`LPp@0   0@ -PLM  0SlSnS `0 @KTsA0S@ @ 0oS0  ĐaDYL 0-PLM@0P L\ y TU0Kpt[ -L M0 40 (KP`* +A2pP@0H U0S -Sl01=P APA"P@0P0$`P00`40a| -0L ˛app 0 00 --L a p-PLM@P`l0l R T D0 Rp80@  0  @a?pZ --L  --L  -LM@S=勛 hJ --L [a p-LtM/PC@TK _P0: S p0`rS   0-/L@BPU+D0 00l/00(+P+L00DZ -LUMpPKP_P@lK8_0S(0: S  SU P U@P P@0 R000K@_P h1: SD @c$^X=6ZZZ P-L P [ -QLM@ P T o[ -LNP a [ -LM0 $40  8 <Pp  P@=  PP a`.W X X0SV  0o b88 0SV  04 P8 W h ?W X0 8ßR030#00 00`QX0 ,K pz Ÿ@T 0S @T T ,  "4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P   0,<P趙p  0 >, 8 R" 0PU 0S  0圙U  0P卙PU8g84P00`XKc9LL %T\PdxܛDY Ex`$D -LP)@P : q00  R.@P*`p@T  P0 R @Tj@0 0 000< @0@000eP`*T 0-T0LPU @N> @T ,H>@T APU0T -LPp @`T DP @T@74 100 00 @@mM  p-LM @`P 0PP ,0 R p 000p -`LMP@($1$Pp` !0s ?S mS 0gPp) y0 PbQ VU UWtV fi^0 pR0`0sXDYp0 -LM0@0cSZ bSZ4 `K   0pR R 3   0 P `V | $40"WĂ,(0 ("4S @ NP  (Dd p-LM@PP`pOP$0S`=ꈪ -PLM808 4 $@, ՗ ї]p -L(MP4`K8pK4  00 PP%p 8uP@ 0 PPp 80( (,K ,@ $ 0 ]x` P-L 0 ,0, (剗$9 0n]pP -Pp@LP;`"pT@6 "P/ 1`14 11111a Q@b*911 RQ q|10sM P [ @+P9XXXpP00]p\00 00,,($(ԏ -43L$M `R@P#TTP0-S  @P񟗩  ( 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:b1LP0S   RR 1 R001 o pP%|1 R\!0S0 T D~;0S0C00I s;8I"&<d;80 R U;P` 0  @@pPD0l ^ \L X@($ ,, t8\ -LMA%QC<|@xx0  Q d\0S P 0R 0000᷂$@ 0 -@6L M P0R@`,P 0 4P { 0gS 5@DT%U0-S 50 , K zP5 R実P |||%:00@DTd5d%0Q4  S4  040 5 s 54 PppRp@700 SPP 703S 70S4 R0S ,Q  0S ,0@ o0gS 644` R4@4P<$ 4004:0SU V V$:U7V   :U00T00S 3 R3 :0@S (3 R 0k`9\<7 b0 0, K4 [0@-SB`hp$4DLXDlt0 0@2 z|@T , KO4 0 @T  B@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T `cyyph0$ @T {|YDY\(T,t4L|XЃ|xdtD0 -PLM@0!P@- 0-S ,@Pd|||||||||||Llt||080h0000 -P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S T\ 0-LM@0 S  0S 0S0S0SP 00 S 0 S |}Y00 K 0 (0 $0 0 PDPU <zP , 000k>T -L$M(şPpP5 d E0@00R2\P4X @ (PU U  ğ 000U000DS񟗿<<<<<<<<<<<<<<,<<<<HHKLK`l 0D@ H @ <` 8` 4` 0` ,` hP7L R/0S ,L R R H0S U 00S S0S 1#$0$0 0 00Sh QP 0H` hP Z00U @ P BP Z0 1`V@ 0 P P 0 ( "# v%P P41 R 8  $00fW U 0Su0S q0 <000l\`\@TLT4Xn| \0X$ -LMP~@00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000Rh60 R \-0R \ $0 S0 S 0-,@LP0S P@0l 0-LBMQ0 0C @S$@ZR 1x  0S dR0 L f 4F/K< l| -0`PL@ p 00B S0B a0BSWBA0BS7BR@P(D$P8``` `Q:0e0b``` -L@LM "00]P 0;0T -L M0 K@ 0R -L`,MDKHKP@  0D @ ,@ <` 8P 4 0` ``IPpmHP `Pd   0pp4PYH0pJ.V V@ *UL0T 0SQ 0@T:`0U0U@@T P  0@ 8 DP < 0@ 4@ @@p) HPV .V@*0S 0AT:x<P` 0  @@pH0p8-P-0*S  r  -PL$M6 P- P$ P0 P0   @0@y00 R0 R00x0 R"`0 R"LLL@ H,0D@U008@HLP\@-@T<0 1  0B0R \ p-LDMa0L@0  PRJ 0S ~ X KX@PT9 0S0N j0TS0@  b$H D/(AQ   /$0  B LR 00,K/00CS00  ä0 0S Pp d0R PDP0 R0080 R0"0̷  0-LM@0PS3 @K fH0XS  cD0TS  YPQL 0  }0D0 R " ,0 R " 0000@ S)$$$$$$$$$$$$$ $$$$$$$$$$$,<0S88A/,0(0$000  ,DPT` p-QLMP@" 0S S Ul0 R \0ph/0 @`/p0ph / "48<#hht p-LM@ `P.T=  0K0ES0 0000(08.00CS. R| Rttph.lhd`\XTP(D@.\  0-L\P@ "10Q0S cT0 R 0h.0 0h.0h{.U R R  00S S "48<#800000S  p-L,M` 0@@KR0 P !KT*00 R ^:007. 0S 9Op p-L$MXŸXb0 S @0z Rr 0S$<DDDDDDDDDDDDDDDDDDDDt0 S Np"R 0||!lh \ 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K q0 [R R/0[0S S Q"[-K"48<#8 0 .K/0[0St,`奒dP0uP 00z.㎒P ,ᑒp(h 0-PLM @ @T T ,|vt0d0 RK 9PP .ZP@  uP@ -T0 ML\@4 <@P ,  p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U -!P`V , pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HPە$<< (PԕP`0<LX -p2LKM@PHK ,@ `Upp 0@CT@V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!pk1 ,0S ,qM ]0 S- ʀS S `V0 00S SpppS SpS Spppp`ht -LM0@0CS@Hhh0 h!h#0@-d Q00XB.P@0L#"\ 00  P0S:00A0  -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!奔,@K 9P qZA <4(<"4(< p@勔*4@8 <#8  倔 Pp p+[*[)@[(P['`[,0[p P@ P`i00S W*00SW:x2 -0LS00S< 0S S hKh0 5-^𝔰1S00CS                  0 `R$0SDHLPTX, p-PLMP@a@A 8嬅00!S 0 夅0!S0 奅P0 唅 0 p@0S P 0S0Sx0 { R 0S l`P 4嫏 @0 <0 p8,x|T0P0   -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8L,HP@`   h0 00V<H 00N<X 00F<p - 0 L0 8,9P0 - 0 L0 8, P0 - 0 Lք0 8,@P0 -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1妄$0Ps5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0e $0$0QR  0$0Taht8,P0\ % + -CML M% P` , \ EK@A@%z3P`4 5>5 T`4 |5 t5 1d d`50S y R<5 t 050Sp `44Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S = 040S 4$4Q T30Sc0 0S30S S0@04P0@00` !3P@~d43@\4XT30SD30S `43P 20S`4 `4 20S o 2@`4"2Q\20S@Xb0 0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0PX4S`4MHTUH 0SE 10S< `43P6 p10S T10S  <14!41Q ^@10S@p0 #0S00S `0@0_3P0@00P 0SEK@\4XLd@0  ,0 Sh,,I8,P0,%(8+,+T0| % +\ 4+ 0  - 0 @ 0^ 0  -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2}44H3PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAFV P44("/K0 P 44J3p 4SP44  RQ  0|@h0 X0 ,0S@,/Hth8,P0T0| % +8DL -L^7@00CS00  ä0 F0S t00S h@h0hP`0Xp0 2P@`p`p0$0B8,(4+ ,%%8+ -ML M" P4 , 0 ʂK@ A@"0P 48 2z2 48K t2@ l2@@@(PP, Hc8 @p R 2 k 20Sg KAA&3P1 K[481PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S w ,10S  Q10 S`0 pp0S00S @PpV1P0P0004 _0P@880@ ,0 Sd,(GTd8,P0,%(|8+T0| % + D4+,+0 SdP -LMHCD\ <<3|8#0 ,姀 嬀30S$0S 2 唀噀q$2r20 \0}2 vŸŸ"2m2x2`l2P`2@ L0W<242@ 0 K2 D21@{ 0810S !1/410S !1"'1`X1@T10 |p1pqHh \1AT1T \|00<0S(0@T Q 0@TP0 (%8,,DY,+h+0 8 \ p90 %  \ % T0`0$ %D<0(` +p<,! H%(+8%  + 4lP0 p-PLM@P`0S00P xanP00 \YnP L0 DpV 0 vpdP8,@X -0L 0`%P0 - 0L0 0  lP0+ -0L 0 P0 0-PLM@ !0S000.P 1 2mP mP0 K1 t\0 0  |0 0T0 HPH@DX 0S40 8~0 8,dP(+P0\ -0L ? 0 P0 -0L 3 08%P0 -0L ' 0(H%P0 -0L  08 P0 0-PLM@P\1 T~ NP@!0S000!P mmP  hmP0 T>t0PQ @,ˈ0@0 @0S 00S 0Sh0{~00`0@0 P\04@_~0 00 08,LhdP +|08P0 -0L 0 P0 -0L 0 P0 0-PLM@(1 *~%lP1  # lP K1 s\ 0 ~0 00 0S000hPt 0@S00000.,0 D0}0( S00008,d PP0%  -PL M   KK-P 0S0 0}0 0P|@0}S t00S\0h}0\P H0R@0 P,0  <P8,P0l t&0+ -MLMp0P 0 00P0P 0 }}`K.P0 Pp# ANK @D@D$P X0 \]}P]# 80 VO 0S( C8,P08 -PLMd   KKk,P 0@S 8080 +}(0 0Jt8,P0 -PL M0 , ,K0K0!F,P 00  1 }1 00 1 0 4 呹$ R0  0S 00O-0S 0S0@0S 0P0;-P0P000 E,P0`@4ȹ@Td8,P0,%(8+4+   -PLM   KK+P 0| SKK+P 0\S T0T0 |D0 00S$0  (8,0P0P -P0LM0P01@0P1 n|Ȇp 0\``P /-P0 PᰆP 00|S -P ,Pp0  X0,0徴P.U h)̷8,XP0 -PL$M0 , ,K0K!K+P ,0S ,K0K!B+P00 1|, 001 4  4@ WP 400|S 4K,P 4\P,PP1 00@ <1 41 ݸ< $r1p0S. ,00CW*Ww0a050K00`!50K4n0pS0@0S 0P000,P0P00h00S ,00CW<㣸4@0 P,0 Th8,̷P0,%(8+4+  -ML Mq0$0 倸`|PP@P@@.Tnk|PP 0S`Q/#P@Lq@BnK-0 K@`F4!0▅ 嫅P+0 K0 10S AK{ ƳX00  /!0  *ABK@P`Pt00P!@ $0S<$ZA0 8,<%P0 -L`Mq Px t `tKxKh!"*t0x 0CSP1 HzD1C<P.t0S$Kx0t00t0 x0Pt0S@zpPKL PjP  P`x0 Pt00t0 x0 `P \0|z Vt0Sx0T  P0 0S< @8,P0$,8@0LT(%h 0-L@0LDP0P 0000}S$0}zP0 dP0h8, 0-LMMlPANK@D0@D0 !P DD @0TzV  0S$0 @08,P0 -PLM   KKj)P 0S |0|0 *zl0 0IPH00}S <0<0S 0z0$88,P0   -PLM   KK1)P 0S |0|0 yl0 0PH00}S <0<0S 0y0$(8,P0 0\ -PLMX   KK (P<800 y(0  'd|8,P0DY -PLMX   KK (P<800 y(0  |8,P0 -LMM(BNK@D0@DP+(0 U)H0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 砃*`P00V00SBKA0A@)0KnPP (0S(? -PLM   KK_(P 0d SKKV(P 0DS <0<0 y,0 0598,P0 0-0@0P 0 0RL P0  0-0@0P 0 0RL P0   0-0@0P 0 0RLP0 (0 -LM4@0S 0S>(% 0-T@L0LPSH P㶭40,0P 00(% 98,+  P- L<80 x,0  h@8,P0XL -L.800SZ (0( 0S00R,+(%0  -PL M0 , ,K0K!'P00 1Tx=00."p4 tAtRxаd14  40SDAL 4  0S$A0>x弰ȴP+` 4  0S 0PU @%x声0 PP@ d ,040@ L0 P0R  Td8,xP0 @(%00 -0L 6 0T0P0 -0L * 0`0P0 -`VLt Pl@lph000w000H000V ,00h %P08,<0(@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00(<0 0-PLM  1A00`w P KK&P 0S 0 0Dw 0 00 P0 s0@0S 0 S  @g@00D0HD 0 S , ,08, +P0<%,+<,! p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(upp<,!8,, -$0L \00'0  HP0 -0L  0X\P0 -0L  0h %P0 -TL P D00}S8080S00u( P 0  xP0 8,0+ 0-0LMS0 lKkP@tPu @0 \ ,0yu0lu0008, 8 -L MTr0$ S( D P8"$K(K$P $0S (0 2Eu 2 10S1Cu(0a w0S1 0 11u1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0h@t0 S@  1 0U UP 00PUP00CS00@Ӥ0H@ T tt 00CS09 P0 R0@0t @p|8,P0 l 0 0-PLM   KK#P 0S t0t0 td0 00%pP@0<u   Pt0@0I8, P04 -PLM   KKʫ#P 0Sp0p0 kt 0%0sK0  AF( 0   Xt 0 I8, @P0 0Rn HP -LM00 @P  0 0h5tX8, -PLM0 ,  !,K0KY#P ,0S00 0t0 8 $P0 sP  0S 4Kp `0 p吀@ 00 h04dP_400080SܾI 8,P0   D -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 obP@ 0X30X 4 3s3 NKI I tt#}1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 f}4@iQ4 Z% P 4("  f}}4 `000SP0S0q0100p`1%s1`CP 0S 10SX1sP1 1h10S ,A0s 0@0P,0 B xQ  |A "  BhBt͟P  PB $B `Q  XtaPp D laP@p  caP"Pp"rU`/|P` 0ST PV 0ST  2St1 Ϳt t1S t10ST\  B0T00* gx x1S( x aPx1p x aPx1pW 0S /FT|P 0S00bU Y| |1sx  |}K5p<o/K<00t@T|P8;01  t((+; 1S0 1 ~P;P@; 0! pǏ$ 㕼P EL;b  !p` P 10`S1 :0S, :0S(*0S!0S::# 0C\0\00h:p0 pÏR0S*P:|*!6P :0S3 90S/ɟP*0S'90/P0S*9#0 CR 0R00|9 00CS00ä0P9өAT #(90S 9 Fq: B 0[S ]P 0:SSPp :P0@080S 8t 0`q^K  7T0~Kl1 0h1 7  0mGp70X L@K p'P05 0\GP E <oLQ0U|1 G SOK <_P,{`70SX7 p| |1sƟ $ | P0S |1@nh 0@|1  L@K0@)PPU]|1S^|咩XF$ 0SL6"pxQU 0S$6"}pş%0$80%$:zP fP@X+ %zPP$<%0U$$0X zP0$$4$$$50S5 $Q p /K$P  !R B00S S S R B0! 0!R0 0S S S 30Sl4 "p HzP` NK` 3FzK0 e2SPKPP P 3  R  lŦdغ|3$/KZP  !R[ 00S S S  B0! 0!R0M 0S S S 1SF \20S2"o ^P"N0`0K  `e2S2 g2S D ^P\2B0 `SL2 o$RU ኤ|1s|8xwu "  Qt yP101  t!峯 1Stt*01 P 1S& S"<O@1P@<1 0! pǏ!= P0 1 J;3<0\̷0j ,Hԏd (@XtL?(<jL H%(+x%0% 8,$@":$H  b0@PP  p` P PU00S, 00S( 0S!0S:0# 0C\0\00,1$0 pÏR0S*D1.1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R002 00CS00ä0021SX- dp0s 1S"0S 0R 20S 2Sn20S2Kn?P R  ;t7$\ 2|1s|xP#,0 S`,e4 -LM$@#n哦嬪8,H0 -LM$@#n偦嚪8,`0 -ML M60H ,0 0L P$ D4 {P@ 60SD4Ԫ Ѫx5PX  0SX T+P\  0 S \$ D4H`D SpD4L$:wPi D4LT Xc P `   \P   \P5\P$   |\P @gX$R P$ p/+@/w:Pw@pwPW3 W1*P0#03U0S* TD @@w`@ wPVV*4 T4S 0S Y 0SD4L$ttT.T +T :vw/`rwVP P`3V U  R0305`1:` :]wPT 0S U ppU 0S /PpP30S t3tT$ 0PP l30S;@3 0V@4 10S 1U! 0lV BNK@D@D0!zx1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 MD4`$0RD4 D4HSD0`$0Sr` ,0 S,2*(%x 8,p  |0+ DY(\D P0Q< P-L`7 ޻ͶP@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @Z0SX  |Z0S<  uZ0S$ &>0P 0H -LMP0  呔 -PL 0 K  -P- L0  "z0 -$LYM0@,0 4p@` [KѺ ͺp4Kl  0h d `A ApP4"0L@KuP |uP $LK 0ruP#LK P0MyL0[S LK 0qAPU u  S }3 p1Q,,d\/upAP#P3T N p10S S_K <]P,u2 jP`آ* ᕾPP 0S U 0S S_K <2P`,tT PY <P`@TV 1 p WcQ 0pt1 @W]/KpA <P}J0S x ^?K 其PmhxA00pb0dQS PP H10S 08 0LjPPMP I| _?K,PP00S4p0\0 0 ,0S,n0+3<<L,HT\P0,8,ԏxd1l 2 9  B -LMd@ 0 0CS00ä0Gq((0 0 S 8,1 --p1pq0LS00`& TATiH XP8 4 XPi x00CS00  ä0 /P@T%0  !㘦 @cxi0 |sP0PSTz 8, 9P0 {,d8 -LAM M8B>K0C0C0 +,  %@$ S p< 8 4 BK J4`J U0@S񟗾~~8~8~DP 0tDPp 0P'i审u04S440S (D(i圡$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 hX30 CR 0R0 S 0P0/Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4AI PP210SS5V4Vڐ10StA0 CR 0R0 S 0P04$RB>K 0C c R+#$r8Q 00 S Y44044 1V 0  <7 0 YR( 00S <$`0RR0F<,0 S x,k.< 0  {P0 90 8,8 0, 2 5d| -LM00 (@(0 gw吤8,(2 -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$gTU< g<@T $i t< p<RM`<` D D D D 4 /P`# <<0S $$<0SLP@004S~4S y4St;m04 h04 qPL; 4 R`T0|S S$0@D4 @  4S$ I B *0S:`4 2Y 4S  2 +(d:IK4 4AAQP4: S 0:$pgHE>K0C 0C)00P 4S 4 S9T 9Pz 儣PpI 0SG >qP 9qP=D9`0S 0CS0X` 4@90Epq `v  4S8P@80<HP 4TSd8P- 84 $R P& 㑣㎣4DS7@$P 〣}4TS7P u4S 4  4S  bd7 0S k0CShBppS7/4 lPp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00vK.K 6 B B Ɵ0O4Sʸ4S 4S5办BNK4@D@D+*P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00%4 00CS00ä04CV W0 S |4 VOh4#0 CR 0R00(4K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00<3P@ 0 CR 0R0 S 0`02P@  p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00n2 00CS00ä0c1匝40@  40@ 0 S 1 34$St1 4wޡۡ4S2  ա.ѡΡ4DS0@ ơ10S$1 "@Pt004SG4 S0  4S4T 0S0S ,0 S,*(+ %0%%H%8,,+  2d ̷0 8 P0 &  -LM00 (@(0 gd8,( 4 -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` nPH H0S > 0RS ,0S X,00-S X>, PdQ<>@  d4>0S H0S , .0 80 R@0  D0 H0 S  L 剠P! =0S =0SNP00@0S@٠<0S<Ԡ(= p (=p.Hʠ@0@0 Š< X,nPS ,00|SO ,㵼P@/,b @0S 0 S , @㡠<㞠< T00,0Tx  T,l ㎼T/0p0WL<0S m0 S,P<0S `0 S ;0S ,t , ,0S HQ;0S  ; ;RV<;PH PH0S X 0S D fP 0S  $ ] YP@ 4 40S pW%,mP:00 h:p) ,00|S D ,0 00S,x  *0S:`: ,T0 00S@:, N80 00K!P0S;0 Y0 SIܭ堭P0`0 `.0: S )0S009 H9@T 0DS0 0S 0005QppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7ݚ4077 &P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00w`6 00CS00ä0l46啚V0 S 5 W W,`V 0S 0 _UPPU 0p P@0S@0 LUP,80pS,5p05 080 VP00P0  V[5#0 CR 0R00494XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 T P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 4p`P0S CP Ba|Had30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00sP2 00CS00ä0h$2呙400@ 0 Sp1 000@ ,780 S1p 1p080@<D0SD ۝4m@ RH0S R0S10S 8 d1Rp \00 0,K0 ^p{K.<3 0$, `D0S`0d0D 㗝l00S70 @ 卝<㊝(+H%L%0% %D 8,,+`0 4dH ̷86P %  &  t X`pP00%P4 0@P@ @80S 00S08040S4Kl 0S0SR@6<3 -LM0 S 01 `0, 1 a 0 S00SS  0S( p͟|` XP L B帾00$= =0 >K P 0S S5 Q<0S) |0S%̟L0P 0 < <P?B1cSQ < ! _1SA l< 0R0P<X _\H 1  < \iP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 吮!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p㓼 PaV00 0Sd >KکP@0S S >K  ȩP >K ) 廩PPC P430 >K 天PxXC0r/K1 @P@S\PyQ ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PΥP 0eP R d2 0S82  @2H:] QA Q^ ^ 8 0@\@>)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  P X@~0P00  ,0 S,#1 3ԏ%( +@ P0gfff8,H pH$d}~3d8%(AlLTd| -0L,MP؀0p0U$0 D @KD K `崫@Ti00?[\H0K @H iP<QL $0S $" 1 -LM!4 0S@0SD@0% -L 000 -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,9fBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 e e e e0+11b0eb+e +e+e ၘ0S00 `,+(%,312 9  d\ % %T0<0( +<,! -LM`@00CS00  ä0 ד, 0$00008,21( -DL$M0D ,0 H 00 @ eP4@ 3#3Q040 3@T 30S 30S@@S0S6P 3[t30S \3d[T3 0S44P(兗PP7c0@H ,0 P@ ,ڗ㫦00000 4D P`B000YU,㼗82`D H0PZ㯗4"0@0eP 20S @dP10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K+PS00S0  ?00S" 0,0S@0  4D % `\0 8,(% P00 1t&8 ,+d2'2 0-h0LM0 0PK!K0  @T0(0 T02P0 -/L`PPU1 1UU/0p0W 0Y@+dᝩ.0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW 6P88,P  -LBMAq0 S P 10S1  RAnK `F`F0X!Pg0 0URP0|, tY10U B>K 0C0$  0 K(4 0BK @@ 4Pʰ\00S0  HU 0K0 +PP@00S 0S8  9x 2P00 2'  -BMLM07,',70 $'$7$ H , y'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@MP@ 0S 2d"_X2VB 2  L22 2S)P@벾P@T 2 0aQ1 [QxPK!PB =AP  [P00x0[SR 2S jP@2S寴 |^P@ 2pSX墴 PQ@TWQ $GP V00S&`0P  O[0 00` 0@P0 PS[P@P 0T(0 St(6P0L%!0 d<8,hx0$8XL,+0d0D% (%l0 -`LMpPᒠ0@T0P0 P 00@dP @P w@T0P S00@@0 800P0008,0D%d0 -AML83M4ß@0T,0 p0 3 0S 3@ SP w@0S 0S 00@T@0S從P@ 0SB 00SP/S  0 S R?fPDiBnK`F`F+|Z00S/S/00P+erZ]P*P߮1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DA00\0SX000O |P ?P@Є@ YP0@0x0 ,0Sh,( 66   ,+̟P0Q 5 08,X -MLMpp0 S( P`L Tq0SHHA0 @O BK@@$!d?P9 1$K R01000ӑa0CS'0t0UO 0 \0EOKO(0 S4( %8,0| 0-0L0M0@PKS@,  0 s0S\@0S 00DPɭ  0  -LMp0 SԀ0@0P`P "YP (KD(0`P R rp000000S`P T 0S8@,N f   58, -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p M=P \1\N000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 + pP X0S 0h LN00P X 0SH@8HN u0  P0  58,Xx -MLMBNK0@D+p$0 aXB`tXP ^KPEP@t0 K0/S ҝ@ <P0S/S$0 S$;P 0-LMH@0Ps:0 Kp 0SPP0wt@ -LM@P00s@H% -LMH H0q,0 F6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ 蓃@T@dTd@K0 %[50PCUڔ5 ra9@ 6ş@ş`g0%[p `P`Pp%5VF%T5UWPT  @ 5@` \ B0%@Po[0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 wP@@w/ }0 |%KHP;%.Kz3/C0ur ᰜ@ ᭜@`0#[ ᤜ@ ᡜ@`t# [%KzT3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ sPڄŸ0 S 0S* f@ c@" <2S [@ X@d"`ZN !P!1P@%K [}0 V}%K '|Az1Po0uv 1@ .@`0!Z %@ "@`x!Zd1OK0uf2g2crE0@8!?` 2cc,! GqZOKQ 0JH~#HP 00CS00  ä0 m嗄(,0 S,U.AH%%0%0QDY P ų <    8,  -x3LMp 0@@,0 K(H3H0b0P a  B=9 = 0 svP@ov/ |0 b{K\ KP@/ rP @K |េQP0吠KS0SLŸ HŸH2@K00 0Y~/ ~/ T{"ŸP@Y00 d!pY\P 0SL0SI@K]/ {rPBڜ R>1 P@@PR50S1:PP@ K /|0 @K)| zy 1@o0ef2f2c BDP 0Ϡ#PE0l 2lADd`0 @_Y@K0 S005<@,0 Sh,[.A>P? 0%DYD%\X%ų8, -LM0`V *0線0`YV@: H1 ?PUP@'`VA0S,0 :p0AT0J 0S :000CS00  ä0#  ~ P@| 0 @0 C\0\00 T,0p0S,0 `V08, -L MmD00 K4@囆p( P0 1[SP00\@8,ht@0 -0L M@K 0 K  詖 -@4L$~ <toꝧP@ Q " n@X  W@U" b@ ꌭ랶P@@ḗx :oIl Kp9xDY0t (8X|h -000 (P$0L0I!9phDY p-GML`1 M Xa T!P0@4 8!1p ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 eP# $04 04 =K 0CᰦPPx Pl H0$Lš-P@ 4倧40px4xD -L0+ ~ -LM`PF>P( @(K,pK 0  (0@SდH -L M0@p00 0Si PP 0S nSZ =RP0`0@Q *7P QLQJ  0V0P 1 0* Y0  0000V 0`000 ,K;, ?R0S@p @ 0"Sl 0Y000 LPH00D 0oSP aď Q-0N. S$PP 0B00RQ  Q 0B00R -MLMⴂ0$0 C`2^KPE+5 p@0S T0T0S0 0CS񟗆8(2 05R|@{PvPd 0K @88 ֕`^KPE(1 PZq0@T ( P@TTC00S3 >K0C( P$0 05R++P&00S" 0V0 05R01Sd0 05R X H00QDp    $0S($G HH$H ( -4L M@P  = ='P# H4 D4 @4 ,4 04$4 2$pc@30@cTQ%TcP b#P sP  PPX0S0t0p#cpd Y\3  TC PLRB 83 0000C<0PZP8 @ WF 20SXFT ~~0"0Z ڀpDFT$237 &0S,. 00F, p 2p S  PPPPF 0KⷄpA ,0/0,1" Lp@0 ᱤ( !0Qx`   `1pX PpH DJp<  ᰓp$ (p  p uL0ߓ@0 00Gp0G8H@HL4(H\lHG H L?$ H< X  `   6   @ -,0LM$@ zEEy p   p-LMP 0S 000` ph `@x,0PP0080 04 ,0 $00800<`phHG(H -t@LM0 \D0,000 0000 04 $0 0080hIHG(H -Lq0P@T Ut` ,`s 0SP0 VV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h#H !G(H Mp-L$MHb@R  0K @, D0R|0SS S St,K0 0K@P  `0 R0@P100 0` 0S100 0;S<000@2S0?00 0@ 2S  0/"/0B1 00 0000 0S100 0000 0S100 00 00  0S1 0 0S$^ pH!! |G0! 0-HALM0< 0, 0@0P P  !1P00,0Q 0SO0K0PQE0P0 0000Y00 0 0 L0 0D cH 000h H8!@!H!P!X!`! dGh! 0-PL0 D0,000AT 000@<0 04000 (0080 000hHG(H M-L$M̂r  8K$ Ց`,D"2PPP\0S4K8Q \X0;0S 80;01 S+l 0S0@T 0S P P_ @T(8K`vP@Y1|qS000000|<0,0h}P1 T1P 40PP^`  ՒP0000@00S 000SP00 0S@  0S 0S@0 0bS`V ʶ p_dXXT $0SD$ H!!!(H!!!G!!! M-LM B  @K, p^PPi!&4@!0 S0 P`E X@la0 P01S 100l0S A*P@$# @ l̐$ 0@0$ P@$$N$@1S 1000S P@( 3p-H0 ✐( 00,0 S(,r4!H"D"\""" Mp-LM`@  0K xP, D0R!0SS S S,K0l0d0S  00< 00 0S+pH"" " -d2LM\bXT24 0bXPm0S$20S B <0S0P<0<0S0!P0 <00<80<zPUA# P`80S|1 10 0 8ԍ800Hq80P Ta80 SڢO0 Í@@8@80S0 1080@0 0804 0 S0l080X8#8#$0$ ࣸ$0P$#寍0  488<#8`X0H [080<mH(HG "#HH# H p-LM$B0 P@0S 0SCAa0 0S4 0  00,0p0QkP0  S000 0`b|0P0x008r9? Q0 00 0 0S 0S0 R0 0 00 00 00 R UPR\@D|0QT 00T0T 0H000phH@#GX#t#`! |#d##(H  -LMHHc0 (0 0Q@ 00y@80S1 20 F1 08m800801P 180QڣO30 8\@@8@t10S d1 80 0S0`0808K 㒏0SS 1 0R0040 070K080K C<3K0S0PP0S3 W08#8#$0$$43[4#DHL+0$H 0X 0@8 ,0N (0SD(HG(H ##X! X H#$ 0-PPL0#DHL40$H 0 $0 0hHH($ H -LM~KMapGP@+!@K 威-@ !0Kx6 K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S p 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \zpH(H$H p-LMP$P(P@`40S8`V@Zph p-LMPP @/Pfv/|`0 @T @T0PRv0 s0ph鷲H$H -QLM`PhB0S00ڸ`00@r0S4B4~/P  =00A=2  = 0 =( R|=$ Rw=, R q=`@4 Q 0 8p!0!d`=`V@  0 @ v> 0F=  0 v>  01=  0 v>  0d=X"=hu9H$$$H$ %$%8%P%`%t%%%% p- LM0Qq`P$0  Ō$ 0 0 $0000 d K@ y$K u$ Rpᫌ(K0 (0 h( d 0ypH -Pd 0L&@`6pS|06S _20 6h 060S 0P&00D0D  V $,$ hH%&DYH -MLM P, zp < 0BS8@<Kފ<0@pK@0 @G 00T`K0T0 S" DW 1 S@KHK0hPK0h0 S X< ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG222$38@4@1 0@冡940!1ZsNK@D0 @Di1804 04 1`1Z\H1X!UsNK@D @D8P 1 40!G0 04 R8@Z ZK'P  0\ 7`0V P7 {NK@D @D0h I  T,0 S@,<&H&X&Il&(Hx&&&,H&& -LM( 0R@40 ,0 00  S, $P N0 X I4 , K 04 (pK0!=0 ( $0  `40`V0 Z>70  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0$H4H -LM60 @ 0$0 @ tp$`KP 0 0 $0 $4Q: 0( S6 (K($HH&& -LM60p 00@00f$@ p PP(p  (KKP00P@@TP D(@ $K $([(H$H$H''' -L Mႊq`0P60S 0 6 f)P@0610=S 0`61SQ0&P 0AV2pᧅP@0z0(F0F0F0v0 61 p 0V;@ 80@4@@!061S @0@$S `S0Td : @ 0@0@6@ 0 rHH4'\''' p-LMd`0P60S 0@60&010P61S 0 06pH-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@塿pT 0s |匘00pG' -LM⁁@P4 8 0T 4 8`@U@8@@8@8@8@8@8@8@8@8@8@d@@@d@8@@@@@@@@@@@@8@@@@@@@@@@@@d@8@8@@8@8@@@8@@@@@@8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@^@Th00pW 0< 084p啃000''( -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @0( 0-LM@P@ .R r0\00000S0S0 S0 S K%PP 0 -PLMpQi@Q0T1* Rr000000S  0RQ 0 ?FP`F0'S"S $S `S \S`F\000`F0@0T:V00K9t(ܑ(@} p-L M`Pܬp P 17p 0@eb_om PK0  ` 1Kႋp@0DST 0 p(6 H(( p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< )P@ PKW 0s ? lD0Pp(H (($ HH -LMp@B d(P@ K r 40R ,Rk  ( 0-LMP@K  @@%P񟗮,IJJJJJJJJ\JJJ`H@I\IIII4JPJJJJJJxH IJhJIJJHHHxJJIT2c0P+ } $P!p, p(p$pp  pp4p@W TKS ;P N Kp(*H**) -BML M4%0P KL @,0 8 5`P P@Pd 4pP4H{>P ZZڼH劑00S 0AS B0C2S0UhVhVhVhVhVhV@ThVhVThVhVhVhVhVhVThVhVhVhVShVhVhVhVhVhVhVhVhV0UhVhVhV|UhVhVhVhVhVThVhVhVhVhVhVTSBKAA+f` K@ h3@PH吃@0 S BK@@ H ` P$ CNK@D@DP @$@ TBK@@ `y K@ 2@P CCNK@D @DH  0  K@ `2@PCNK@D @DH 0  K@w 2@PCNK@D @DH 0x  K@d 1@P Pڴ1p  PppW S ;TB ?H"P H"Pt1 (K dH"P TH"P81( Kp4CKA A 0S K@" 0@AS,P ;P    P4P}LP@1 BKA AbL$ `0 ,0S\,9 +8+L+`+x+d+P++,)+p++ ,4, -LM0pS`P P0S P0S  (K0P(僂r}P@ ({( <U00@@,P00Z00SP;P   H,d,) -LM0p$0 8@K 0S" ;}`V 0@0lP00<K0`n,P ;P @g d $0S $$,(H0),, p-LMK&Pz PU0 0`@T(<P" 0S0 % 000@ ␀0D0S |@T\O  Z<0D@PU,0D0S ? x'p,H,0   0-LMT@T@ D1 0R00$!00@0c!S0"c1AP0S (0s 0 (00$K0 0$ 1K2Kៅ@-t 0#S 0S |1[ \00S (0s1[ 0S 800S (0 ,HG H-$-  -LPMq0D`K0K 0 pP@#q1  L00L00S H0S L0S0 ("0(@0P,K TK X0 P0K[X0K   ` 0S H0-P- x- -L(Mp0P 0 Rp@k @`K À q; HmpP #[A0AS 0l 3K;mpPя͏ɏ 0 S U-i i - -L(Mp0` 0 p@@PK&  -;t m0s 3[X  Kl0s ጏ 0S -i i - -LLM,,a0$0 D@K(p PH : lP(3[A0AS$0HQ"l@K( . : lP z0SpB 0H0 T  P00 S$0 S $Hi -6i(- p-!LM@`TP 0S0P0 @TT P0@00 {P@y Pt` R 0S @p@p0S  0S0S0@0p,H.T Q0S 0R00Q$ 00 Q,H -L0Mp0` 0 pP- H@K(  3: lp0Slᛎ ᘎ0  ,00 S0 0 S -6i(-,. -L8Mp0P 0 T`K0 2= pP@P0`S PPP0D kP 4 0 S  D.P.HlB h.. 0-LMdP0  ( ,  㙤p@8  0K{p 00@0H.. p-LMQ0@ 0 (0( K}kP1[S1[Sh0 @K(X lkP8QH~0@( ckP0v0(($ K[kPn $080@8y4 40S8a 0@<@0 @@0D0D0,`K, ( ( 9kPL0< 0, Q0( <00( 'kPt:0l( kP\2pHqB@..pB,/yBX/fB@//gB/ ?wB0vB (0 -LQM0Pps`KKWK, KK\q  @@0@Ɯ WKD\1@< 81 4 0ƞs`OK VK0 0 ,q B~0 T1 0XQ P L1 0VK p@0  0 ,0S,HH80H0 -LMp`A< @0R 8 (4P`i 0<0 00@0 Q@<0lS<W44K  |"[<0,@0 R!(0P0<0 <43P<0 0<0,0 `, <408P<0, 000<0%<00<0,0` P,  <0000<0h@-@}0< 4@, |, <0000<0,V HH -L M0\S, `Q*\ 0H , Ypӕp0, 00 0S 1 \ZQ0S40 8oP@0  G|4  p%oP@p0|  4| /|0 00 x@0 0, \S:0000 -L M, p5}Y0  |`, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 {PU`4\ V00Ƿ0` 01 -L4Mlǟp, XP T Xp @gY@8Z,\    \ !00 S T0S 0 X 0LKX 0 0A0C3Sg(oooooooooooooooooooooooDooooooooooooopoooooooooooooooX 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  &!0 0Sx W4  0T|00 W00S4 g TP xT TQڗ Q@4 aLT R ZT Xp WL K0B0C6Ss,t,t,t,t,t,tr,t,tDs,t,t,t,t,t,ts,t,t,t,t,t,t,t,t,t,t,t,t,t,ts,t,t,ts,t,t,t,t,t8s,t,t,t,t,t,txsq,t,t,tsPP"00 0PET1* Rr200000SP 0RQ 0"b:`PE0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" Tx 96Pb |0!&:pPTP`@/08C808#8l!:pPP`@<0D!0K0C 0C1 BS 1Su@T ,0SH,H 2H1DY\T0 !\0!(H0h00P0-H0@0 80840400,0 @ 0C<0 2/P@\H+P@`@@T<0@@0 /P@5 P@.T*0D0 P@#T0H0 :P@P@T 0L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @tDDlDDDEK0C0C`#8 'qd8! SD5;<#fKA A`t(d8!M@S:rtP bP t( GKA Bxd(0@R:q|xP bPT x( )KA A#|(d8@S:rv|Pp bPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rGab0P1(> (PUڈ< 8 o k kkP(1S>K0CkPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,F.4EFF 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 }PTP (@ 0O  Q0 Q@L00kP 0@0CS0@0 0X( 00CS0p@0 0B(< 0RPHdHlHhH\XFP9G -LMPjPpC 0@ S 0 S`ev 0S쀟쐟0 UPP (i k`0$0O` bPg@00'(' C GdHhHlH,GGP9 0-DP@L,000 @@0 0 0 0\KId0 S- L 0S S 0SP S  PHDG p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  J\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  III,KpJ -`0` LRTLL0<SS,0 0Qڄ0IIIDGI -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0劥P 0#T 0EE@\KIXKI -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00TP 0@0CS0@0 $0h00CS0@0 0`00P @@0@ЫIIP9dKI -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 aW5 P %Q00!Q`uTş0 R`l00SP 0 0CS`0e0 |80"00CS0D0e!0 0 Pdt Q`l000SP 0$0C`$S0d0 =|00S? h@OX3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000~SP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000ISP 0@"0Cp8"S08r0 0 l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000RP 0!0C@!S0A0 x4000CS0u`匐0 QP\00RP 0T0CSP0PP0z Lw0xKIXKIIP9JH -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00\KIIII0 -43L M0 00,  R W,T P@` ;PpX آ 0S2SU0@` T QڐR2 Q@L000QP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S MP@` @@ lxP|0p p0VM@ T隂,@P0$ IL$'P9KhH -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| P `1 @ RD1 0o(0 Q`l00MP 0`0CS0`0 0G 00CS0@000 SH@P@(ITPIP9KK ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 Rp00 PP 0P0 P IpJlK -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000LP 0,"0C@$"S0B0 0V 00CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L0006LP 0 B0R@ q@0k ho0lY00CS0@8h0SL(@00Pi0FIdKtKlKP9I0IJ -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0II\KXKhK -LM " P2 P@" " q ğ0S   ?KěPW"R 20R2 84bPU$0S4 {N"0S \ 2 1    ?K啛P 3 `d 0Q,V,K 0S 2Pß0SH# HN030 AN\ 0 0%rŸ0 QP\00JP 0"0CP"S0R0 W0P00CS00B0 B0 0o࡟0 Up|00JP 0!0Cp!S0Uq0O L0]X00CS0$b"P U" 0S  M0 K9P0x 0uꬠ0 Up|000OJP 0d 0Cp\ S0Xp0 0" 0MIpKhKx`LP9 -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000IP 0t#0C@d#S0\C0 n*0(00CS0C0W0Ȃ T`l000IP 0"0C`"S0xb0 30w<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000kIP 0\!0CL!S0D0 0,00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000,IP 0` 0CP S0H0 e0 lKtKhKpKP9 -LMؐԀdP`01 ^, p@PHP@ @q0@0 A0@0,A0 00(H@@P9 -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S-...00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G\KIIIL -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@GT\KI -LM@` 먃0#sP 1 0#ẀpP H0@*SH1222122212122222222222222222221221222222222  0 1 "P00Pp2400X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY J`1 }1@D}Qq+L PP*K0S0E= 0 0!Kpp-ݝ0S?T%w  r!0S 0S  BKy1: S 0S 0S BK`x0: S.  0 0 `Tf HT <rZDYKKK,L0KK8LKKpLL -LM/@GP 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|Md$ %P  00 -PP 30CS55555555500 r nn00S3 3S0S$   ` P$ $ ` 0 pi/S @ 0T/S/0000a`0 Sn V_`K⩿p 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{L2 R QPq Q2 R Q S  S S-mQT1 R1 R 0S 0: SA 00XD!fY8\IP40n J 0S n@ 00 0: S k0: S0 R0S @0o@P!3S0@0lI0Sނ<Y9(LLKK M@MKH0# R00R\R0  QQQRQ -LpM@ m:p` T@B0S2 R! BpD" 00CS00Ӥ0 PpP PB00CS00Ӥ0s PpyUYUi  9:pPpZ (@ T np00T0S ؟pT>W6 1 R,0  !0S |XzXPH4弟pK[P  0R1 !P 够p PQXOX哟p|原CX?X..x@0Sa  (D,$tKKhM0xKKKK -LMMpA^K PE0PE` @ 0 |Ep 0T0 ğPxphMP\0P 0 S @ 偿@(0xMMKMM -QLM@l 0S\THo}0S@4 40 0Rh.0MMK -QLM@p o0S`X H);0S@4 40 0Rhݞ0MMK p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 01FP@BV;  ]P 0S 娞@0<0V$ P 嚞@~0V0 L@P t0-S xl刞@pL0S LDZF4m V q@xKMbMMM -L 8"HPC0 R  VM 0-,@,PL $E ACpM4N -ML,MT:P:K@(LD:L , @0 `gS0*Kp KKZHLH000詟䩟oP0K0L0 0uS0nS0 0 0JK(@D@D|TP pOP`<K@@ -49@YZ(K00, EFJK(@D@DP jK0(`F(K`F 09P@ ?hZKK0T(PE(LPEL #% *019P@0C0*K( B BS1p@ 10DES|E|E|E|E|E|E|E|E|EpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGpGFpGpGpGpGFpGpGpGpGpGpGpGpGpGpGpGpGpGEEE FpGFFhGpGpGpGHFpG|FFpGFTGpG,GpGLGK@@ 0DKHsjpJKV(@D@D KH00Sb DP0*KL0Z|&P&NtK@@ vKH KxxƟ80 0 0 > 5$6BK@@+Y P#%^*,6 (UKJKL(@DL@D0.S 0.  0 l b<00\5   %|%000X%X5{p@,<50Xq4(K0SzK(pG5pGY 40XS4ğ 0X0Q000 0SڼOH$0s8400 _~PgU pKd$hL00P0-S0S(0 ="0 x#,P@0K040 pɗ0 0@<0@ 0@0S(R&SŤoˬ0000P(T '"P@'0 5#0P@ @0p列Y@KOl[[[[KKK[\ M-LM01, 0p`S  o*00S P' !P@ '0 ",0 txp `0pS  0S P@P@0 ,0oY@O8\O<\O\\ - 0LM@ ܷp|\ -`QLMY0rSwS ?RPPU Xڣ00G 3P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` <H0090o`0wS  0  P  0 @X@H@L@P@T@\ -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  ]VO`O'<T@H@P@L@ -LM 0K# AAQAAq 0S 000  b0 QŒ00 , P080!Q,000SNK -0L0SK p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pKQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`ph`t0%0 0X00L0 0T00P0NV -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b;(0,0000004PcUP!f ;`V 4f };(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 9+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ?9+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  9/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 8+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  8/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#V64p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK6x0 00 6P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K p5U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K 4 G0B @T0D```Vx010 UU(XhX\ 0`X$1 -LY1 -L4M@P &v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&\jpH0@ 0S񟗇(4@LlXl`lllllll```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0Y@ᝇ0S0 t,0 R0 X@ 4@ PL WmPP ``nP@ 30C S@`ppH RI 0S 0S @ R4 @4 L00L0@8 L00L0@ LE3P Dd`0S @0SD fZP Z 0S0SPQ TX 5P ZTX aC@0<; oQ l`X0SE <`X0SP 0!R00Ss C4K8 K0K3P0 #80@ 080 Y`V+ `000CSކ,K@ zP@Ն0S ,0 R D@ @ = P =@ C†"00;P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@=ᜪDYpOOOO^ ^H4^lH^ -LM0@Sp oPdP`^0   K. R W0g=^ -L M0@S D^ 0 K R 0D=^ -t0LPd0 R X0XP PP00L+-@0( 4P000(OOpT^O^l^ p-LM` `P0@0@\  0S 0S 0S p0W -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` %20S0 0 (P  !0S0 R0 0  0@ f2 000'P0S d0 ,0S \,ʩ0S 0QORVVVdL -l2LM 40p\ ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8(,0 X0000000S0S0.P@0S0 ( 0 X@0@@@080   0 0S}zVL0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00VV  -MLMp0P@AnK 0 `F`F W 0~'U0 Ug 0S l 咨@R#0S D 08: S0 N LVLLL -L@!x0hFSP7 !0Q0 0 : S/FH` dGQ0 R TQ 0S 00g0hx##P ht (WXP 4hLWLLVLUMMM4M -LCM0`,$0 (@1A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , 0U 0SD0 R0 0  $0 S $ͧVVV3 2@=PP 2 P2R( K"\$ XD @A08"HX2 R0S @BNK@D@D P@6 qd4 S00C0 {y !0@00 000py `… 0000S U0,s 0S!PY 0 PQ 0 QP@ d0SE قB< @0S: U7u!PD LDMVUNLW\MMMMM,W0WM N$N8Nx``NxNNPM -T0L8M<0 0  8 @ 4 0K0 , ( $   @K -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,2EKI I0 0`$ @( K@X d 8 \ P`0@0 BNK@D@D 0$7P  @00@$;D+VNЛ -LMd0`\,0 pP Qp PP 8 @(0S  0 ,0 S ,崥08#P0 0"(( ,00h0O2 < 00 QČh \2 0P1OP5:\:00=4 0SMOK,-00004 0S@,-4 00L0TS:4"00<28 S0,  0P1OP59:\5:004 0S ,f-  1 R |4"@@ | P8P0, ,P( 0h0QO 000Lh08#a 85@0 L0T 0-40 0L T: 85@0 L0wVdNVNN 0)-L1!1Q@@ p딡`0(40PS , 04L0TB:0000W2 (A 00CSP00 0S 0tP00p@{tPp@`u`0` 000`0 ``< ,0 4L T:V V0W,W -@LMT 00C0?h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 @00S00X 3 0t/1E $$pWR`P1 ,0S ,壣 0{"jP  p0S@`1]WO  0W"F^Pp@0 `( B0B!O0p3s00 S k X 08  ZD@ 0(@_R:0S:Ph0SVpOxOOOHW -MLM0C\p#, 4 @(  P@Yx00480C48  < 400TPo t00\E" $`P@00 0t 0OQʝP 2Rb L <L(0 S8( @*>K0C0CH8 R( 4 Q @(8@pWT:<(0002 ,0S ,幢 ; X  0000@@`P(0@000|&pv&0td0,Kc,000 0 40O 404h0  T0 RH H60 Xu0 0V0WVVU (eVVV 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@S4 &\$0$  00C00V0WV -LM@P&zr0㘂嘒嘢,0 `00"J\pl N0@+S_,,,,,,,,,,<,,,,,,,,p,,,,,,,,\,,,,,,,,<!000  0b`u1  } 0 tc`hh1`!` P0m\>01 D@!T  `,0V04 @@w!T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , p뜠0 0P,0`U0@T UP@XKP 0 T `,0V00EV8WVVP@ -LM0 0,0 0p 6 600` @0R)0S&h6 R\FX 0L0P 6 ,0S $,њ0 " y0S Y. 500 B ?m Q!p`V Y Y` Y V@1(@Q0 T `FV@ 0tP P`@T1X@QwTHP $0000 00ST Y4  @ 4) 4 R 0s 0 p0t p,X$T40 03 00$4040$0h Ri  #0S xvq0p$0h0iPU 0 0p3l3   ^P x3 d `P3 R% @y"2 R, 2 R  R 0SR;Sh0S'x 0(œ R:0S:\9h0S6 0@#? S`, @CT`!0t0@DT `8"0d( Ÿ a.4 P8 ^1 R 4p (!8 h y084 004 Px(1 R 0tx`dtP 0p4<1/0Q($0 #P X "P0S 0S 4 hLP P0  D w!*  V DR.000 0. $0`F0V$0@\ P0 S00*fP ,@ R0 0  0R 0S R0R0S P  0 R tPd <\0 S00Hō$<<? 8WV YP WVUUUVUgPUDY -80LM, ,0  @zPVP\f -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S  V PV@pP0W -LM`VPڴp崀@PT 0S  0T @T R 0S `FVP 0  0P 00 P W Y -LM$$ @0 @PPPtf -LM88 00 @0ShT!PPf -MLMTTE0,0   BR$X P %P80  4EKI I4^0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:P,0 S |,>0S 0 P00S 0 S s S $#i P #   00C0 "VP  000 00C0  SV;;S 7 T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D01 R" 0̠  A0S0?0?00 RP0 @`r0̠ L8{ 8  0 0` xPtPR jPfP 0:0 ) F 0WxVVU|WPP`@,WVVVVDUfMVMMfVDYV(VMU@V\V -ML08M (8Rp, (`  Q 8 Q753 575$\C0S 5P bW0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK P$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍$  $0SX ,0 S ,,嶕00  & 5 R E0 S % 00}P%00C0 0S$ $\NK @D@D0@SS^K PE0$L0%B5 R qJP $\00$0S0 R$ 4 R4 R$ h,P x0: S0   4$00^$\OR$ 0.SHc00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x">KMK P8"4v00@P \ P !^0l!00S 0S 0D0gP>KMK Pe$00$0 1  0`0C0 崀t$/v@kP_ %l0S 0x04P\0 R\ 0SY <00M0 VVVPWVV W0W8WDW0WPW,W`WWVgWUWWWVWXDX\XXXXX $$0c -LM$$ @0 @P|WP g -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPX`@ PUl000`0  00C0?0 0@0  |WU@P0WWLW,W -LM$$ @0 @|P1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00T8WVV -LM$$ @0 @P(P$P@g -MLM0,0 K0 HK0?(@DD@K8K @K ? x_R@X\$UUd?(K1 U5U3HHKKQ, P0@@?|\ ``N A$e @?AV@0p`/110S(K6$ULqf QKPTPK XP58K1\@@?NA`@ 0|0l(K0R?K!d $5dKS@B@h@$5A@l@0` | 7?KAd@KK\ d0Tb 8KKP=aHK0(K( B@B8KA C=K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX dL?>1 H!X 4,(<(,$<HK ,0PKK K K!(K!40(K18K1T@8KAHK@HK K˟HK0 0 (K 0! 8 @˟0 S 3 S (K8 QHK@K0 $08KAK KP HK,0\K0CQK8KK1Ab KK e$5S8k(K!pK 8K0K $  K,(00@S0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !\L5KsHKɟAÄpX3L Ϡ0.0CS\HHH\K000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^$ ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0K f(KHKA8K$P @$(0K 8K1HK$A (K(K0(K0(0K HKKAP3P B P5 R9 K8K DK,0QKR$PPL5Ks8K0@P5 rP|,0 S ,܏(KjP K40PP0K(K8K PPHKAXğ0 S(K!KT0K0(SHK@TT08K 6P HKAh6P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK XDBQKK\0$2RKHK\0@8K P' HKA4P K0S(K K\00SHKA\08K RKK0?\0<000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 VVUTgN\gV8W$P(P@(e0W,ZtgUgggVgU h$hVV8hThVlh\ZK8K(K HK@T0\ S(K KT00TSHKA(KT08K @(K P0@@fK@000| ~(K!p0!SKKT000T  000| N@Pd0 D0` @PEV(K!0 SHKA2X0000000$%R8=(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8cW!(K!0K"0#>PK1(KTHK 0AO K0@ P54C0SPPr 0S 8KpP0@@?|`N A@?$%ARP `A?AP=L0@Po4D P  ;T3$5SDD0S Pf0S`rP Kt4 $ X\0  0 8@080< --L  p-PLM@P`l0l R  T D0 Rp808l 3< 0  /l@?8pZ --L  --L  -LM@h hJ --L 㽌 p-LtM/Pdn@TK KP0: S p0`rSo | 0-/L@EnPU+D0 00/00(++00,PZ -LUMpPKPP@lK80S(0: S  SU P U@P P@0 R000K@P h1: SD kc$^h<6ZZZ P-L P $[ -QLM@ 6P T $[ -LⰻP $ [ -^ML M/?@, @? ?_K A?A`PᄊP5: S d\PP "4P4/0S (? R|  0S> rk0Si .@>@.䮟@@@ @@n0 0j0S P\.,P(0t.t<00ePIXn0S >@T ,0 S $,͋--K B BP Pd5Tt5x%0%#,0102Pd5@T͟͟-= jd5Td `k\= R0  V,0S 0$$ p , -0 t'#Po70Cȟ5@"%$pWZ0S0<cQ0L\Qڨ0Qx -0@@0S X g+0S~ /Pz 0K QQ  000S pg+0S^ PZ  00H0cQ  000cH00+0S Vg0S>x P:  40L0cQ T  400cL00S  0S fd)0S P 0(<Q t <0(5 )0S t f0S2h vP.  hH080@_Q! L X H0S.0O 0S f(0S VP  |hL0@0@_Q 8 L0-0O$(0S xf 0Sl7P 8 pX0S0,%R0S0L%rX P0P@& @?|N A @A?$%0AR6 `pǏ `A0?A`=L00@WO$ ppP0@@?|PN A@ ?$%AR㰀 `A?A=`L00&0S f0StP  x00Q x 003x0%0S e0SP  t00#Q  p00#1t00S eL%0SP @0S D5 R @P `P3Sx 0pVP085"d@00PgS0$PP Ve 00 pW$00/>10@c4PF p4dDW4P@ M4P6 EPh4\& 0T$@PTP4 @00D00*0$S P @33    =h5P`"h 2a2  2 S2  2 4|"t000X@0S? #0 00L 0P5?T5 V>X5pP0@@?|PN A@?$%AR㰀 `A?A=`L0\!\1bP 0S j0 00,%0S><0(5 H0S.0O  L00O1ZP 000D5Sd000<5SD0  40 UVU(W0[UVVP[LW@WUV\[4WVV[[[[h \0\L\t\\VDWVhhhiV,iPitiiiijU8jPjhjj\8W\0W ]V,WjxWW|WUUUjx]kV,kTkVtkVVUkk]]Vh^,^k@^VP^X^l^DYL000U45 S>QH0S0O L0-0O00P0P0P0P0  0 0  0 0001@@((P  0<0[LPP 00Ml(tt!0xS|~0f 6i1Pzfr)ca ~f!cY vf -LM␢PpUŸ ?1Ph2hb :P@r: 0P\%42R, ,Q}ڴ Rڒ S0A Rh0 S0 0B RRq 40A0 Q?>QlbeV_? -L$Mp`P@u Pa0@S p<3@  0@T , q30  00S, ,2W>C 0C0 00 00 R R2!"9"0P4P `8`0p0 0D` 0, (] |00@W $,000, 808 0, 1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! n0!S 3S >0j^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^VVDW8WU (eV -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018ĠH8b\b800CS= = = = = = = = 0S0 #Q00 #LQ0 R0S800CSh> > \> > \> \> \> \> 000 10B0  2 R0  00800CS? $? > @? > > > > 000 10B0  2 R0  00800CS? ? ? ? ? ? ? ? 0S1 S20#B1  0S 00 -LDM@PP ָ@ <宸ZP ( 尸 㦯PP fY sY !1 1 !<p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  U  0P ,P 4` L H00$~$m0m0Hmdmlmm`F  mm4D TD \T W -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0Y000S0 --L Ѯٮ --L Ůͮ --L M((K0(K ʮl0 R  -LM@um -LM   K 0KK p@pY娷m -LM @ \K0   KpLY儷0 m -L -LM@@0S  hDY -LM@p$ ZpQ~0nDn -LMM B~KpGnK0pG`F+`F(0 Y+UrPÏ,PP"KAA NK@D,X  4h 0X X,[|,`4 0X $[`L$BpDa008 \P6KAA \p@X0S' T 880S@YT 0S 0@T8800 |  SplyT(0 SH(|pndnnn0o H Too`F o p-L$M+P`*4@K  P 0` ,` 4P  *10AS1 0K(0 $@ ` x(KhZd\ {p H<0! [P8K [p@ 'X0S  gpRT80[S [@YT80SS S 0 0R0<0 <KQ`!40LLL Dp o0ooo`F (pW Lp|DY0P 0-LMP0@S P WP 0@PW 00Wpp -l0LM@ 0K $0  K$ K 0P WԵ0 Wp -X0L M00 0@0 K P W巵 Wp -\0LM K"@ 0$ KK@  P (K0$(0W p-LM@;'PP` HpP@`SpdP`pm -LM@@0S <:0S 6 4h1 - 0LP`p 0S 0S,@, 0ll ppX PPV0(0 0$`$`@(@|W p-LMP`P  0p rP@ @p0S P|P@PpUP@ ,@pp&pqq p-LM`@PT 0SR(0@VT00P <pbP@0PS B pW`F 8U -LM@) r`RK !P0 X 0 8qdqq -LM@: 0`p`(Kpj \)pPP V $(K xP( 0[ 1S00 0V% (!vpPV0S V0S V0S$ 7)$) $0)$W0`S|10S p0 ,K,0 &X0  ;qqr p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 pᎯphpW V @ P)T U U U U U U U U U U U U U T U U U U U U U U U U U U U U U U 00,00$0 000 V ,Z W W W p-LM`00P 0@T PU 0sp00 03(@T8@0S Xpd0S 0pW V -LM`@pT? 00 0(@T8@pT`/ ‽P `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0U OPP80@T 0  U (@T W0rp8U (0 R 00 0( RW8U 0 W 0:0 p-1LM@T 000 0U(@T7!e p6 'p`2 P#$@K ,P  ` ` $P  8I K $! 1`V  0(K W(0#40S 0:0@0XUpOT0S P0 0 Wpv0S=T0 S9T0 S @TDx004pWDY0\r mWxr`F 0-L60 R 00 0( R @0 UpT0S P0 0D PWp*0SS0 SS0 S @T ,0WDYmWxr`F 82P *0P ": -LM`PኧP( @(K,pK 0  (0@S -L M0@p00 0Si VPP 0S nSZ =P0`0@Q nP QLQJ  0V0P 1 0* Y0  0000V 0`0bS00 ,K, ?R0S@p @PS0"Sl 0b Y000 LPH00D 0oSP K aď -AML0l0SKt00S0ڐ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0 :K0  0K l \bP OSO*  ,~O"  oIjKPt Ktp 6*KP|:A}K(pGpGLP`)   㛜P `V:JP @`吜0Sr0@0"0S P  T N0`Vj?0ZOӭ  AO˭  9!1ۻKA7rp !h1ͻp PNK@D@De/ K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , pDY$8Yrrrp]hY sK0C0C``y11 K00aΙ1P=@1!Ta徙2P xa嵙02P<a嫙P2P\"000pa囙2Pb咙2Pլ(b剙2PչLb候2Pհpbw2Pէbn3P՞be,3P8b\H3PTՌcSd3PcPb|0S @3#P >P NK0S h_.0AUwʤ> >pf  L h> d>R`.`pT $0 ,50(5P ( 1D= @ M^00 00 Rڨ R= =$ $RӜշڰ$Rӌղڈ000 0400 B`40AP HL0Q 0 R$:R8R0H0400cL0 H0S.0O L00O PP00Z0\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڜʠ Z`00`0| P80S0P5 00#1t0`+003x0@4|0d0 |Z;ʠ Zd00d0JT;\` 4@8@帊@Л0P4@8@@00" 8 000P|0@}8@@x000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00 )1 @@ ` TBP 0|00  0  X@ @ 0 H 0S S0$5P㸀 0P @@ ?|`N A @?$%ARp0`A?A@T0 S< R{`P0@@?|pN A@00$/>AQ@0P[`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ o0 腟 80080`00`0 80Sڴş4 00RK 80080 `00C`040040 |00|0l0 0 E0 PKOP? UpxP开 0Eo0 50 0ЄD5P0`x@!@@^Y l 80 Si  Vg  \Tb0$K<4@ ɐ00 000@80080 `00C`00 PP0@ @?|`N A @?$%ARp0` A?A@TLßPp @ PK0?PcxP0Eo0 [500 0000000 x@43!R@@ऀXPʸPB B0kKhKP帀PP2 @B 0 aP <3 RRR0S JK聟 @ @d0 R0dŸ  Dp@ PK0?PxxP0Eo0 5P0P10`x@!@@8@Tڴ00i 0p@PK 0?PP0 @?|pN A @?$%AR㰀` A?A@Th0 Sd` R`ڣ?/0 0 ^^D|]^8Y,YPYTY ^^|dYAQ@0P`u?P0@ @ 0P0i0p圁PK0 P?xP0Eo0 50D@ 0|H0@ `|%P00 T DHR0S T0T p 0@TI0I0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0P| $ Q0°0Pè Ű R>3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X3/ X#0|`0Pŕ V>T5 @T50 \X5 =L 0OOT0T$0 $]I0 X3$@t,@UP,00,0@`0xQe0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@BP > I0| 0 0 I ,00C,0`@@`@P4F 0|!$ d$010ҰPcUcP#u  R  G  YP@ {:  9 E6+$0| $ G@$P4u/ *0,0p`P4d/  0p Gd`Ÿ`0d |P  B 80lcrG80|00(8P@@d ]G0!XGh S|0` 2Q@500h0TXdh0 0Q 0hh9G0`40 SHH.G@!@)G8&G0S n=WrP T?/0 0 Wq0h0 ,5<0 kC0 00Ϡ΃4 `>L^HYĂ$XlЃ`Y$` -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|v/`010Ch0 h000h0h0$%10l0 @0`|Y/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  P`0 0p Pe<@6Pp Ri  00050 80 Y0 (00(0%540( 0l ( 048@TPp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 80@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 0p PePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU 0X@@@V 'X@@@ 0|/`01d0@]%^^^U |] -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400LpFt8Y]TYp]^^A -0`A VLP|`A@00000 0`VpcPBO ` p    ^ -L M0 d@Π , ` t3 R @@T 0X3 _R`0@P08_ P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p PeP1 pRU 0400C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04X@@@ ?^^U ؄^ -LMp%Ql0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**(0 0 0$@ x`0d C0XKB$PE 0x 00 6)  ^^U ^,X -0LM`pQ  X0X07!h<0@ L 0PrP "B8Y,YPY ^| -0LM`\0p l0 P X0XN0P@P ,0007 h $8YDY,Y^PY -8L0@S%8 ` t $ 0S0 #Q00 L0 R0S  鼅 -8L0@S! ( h D h h h 000 10B0  2 R0  00 ԅ -8L0@S!Գ 0 0 0 0 ȳ 000 10B0  2 R0  00 寛 -L M@H K0s4 A[TP @TP@ht@ -LMP@̿p1儑儡`px!pP@4 "P-꼵 ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ ĵ ܵ ܵ е ܵ ܵ ܵ ܵ ܵ ܵ ܵ ܵ 0`0``p0 PbUA40Sh0:aX0W 0 RgDY0^ ^,^ $^4^(^ -,bp0LS2 R 2 pRpW "PPs ء#P@c #0B SPl l l l P l l   0t0S@ dP $ 0S P  N 0S R R 0 R P 2AP 0S@<0Si0S@ $P #W<0Sm# R ^,^(^4^0^H -LpMP@T `KP 0 R Y<0S m@0S@: S! p0S : S 0 R !P @P 0S  P (0 R 4^ ^0^$^ -LM쁟0Q@(0 Pp`i 0: S (0 S (d` 0S   Up` K!p 1 S!3 PpE 8@ IP P ?0  0 \ ,P P0 K P Pv MKP  t(84^p -LM@`P  .Vp@0V U@0 @PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S `P$0 S $$_4KC@s+[ Q003 Kp?@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU~ ,,^(^|DY0 p-LMP`P @6@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,N   @@P0/S 4^ -0L 嵘^p̆ -L0M0`@/W@d#P000LP<H0K L0 AT0 P0 ST  T巆P@@:p'0p0Pphd0DSat>PphPhp(=0 TL@^0\m4m @H,\T,` 0-0@LP R% AR@ < & x"t00CS00  ä0 H< <0h< $ $A0h<xȇ܇ -RLM@p 0S   <Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Riy 0 Rd \q 0Rl  R R0R_ ,4 -40L R(0$0$   \@^ -L␌<0 R4   0 <^ 8^o - LN < -L< -LMhq0S \\PPL @!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0P 0;C 0 0d@d @ˠ$0K $ @~8ec\ \<^x8^ -0LS \|0H0  00S_\-\0S  p-LCM``GOK0PL  `80 Y 0S b\p -LM$@0 S A00 0-D0L R 4410P@@T00ĩDb 0-LBMdP0FOK\0 P 04 0S \0Ĉ̈Ԉ p-LM`@,0  PUph8^ p-BMLM`0<@KP0 B<0[ES FS AS f R0r S00x ;K⨂0 S X[pCNK@D@D 0<0[FS 0   -$0LM K YP [8^ p-QLMP`@00H@ph0PE S U@00p H -LM`Puဋᨋh!UpXq mP pP P@(@  !0AT3 T`7 A@P0/S Z  1P0S@!`P X: p`:  @@P0/S Q@  ZDY\0l -LpM`@pK{7@6 00RPPMYP0: SU/00 Ĕ X!60S U QP x60S  :6 -0L |~Zp` -\@LM80(0( 0tuuu u -LMp 7P( X  Q Qq00  R(  R00#R@@T;Rt 0P00 p  (0[P`@@(Ȉ0S 0H00S (S 0S(0 t0V0 S񟗩 H D 8 t  l L 4 (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;Sp( \{ jSa  ,[\(0\(   Q Qq00  R( 0\S  >(\(   Q Qq00  R( 0S: % D(0\(   Q Qq00  R( (0pS0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00p#( pi4ے( 0p_``[(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S *%(| (0 ( P(   Q Qq00  R( 0;S S ( `IQD>(*(YP( `4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( `d  Q Qq00  R( Z ldbԊ(Pu ċ؋8h 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ 0ЌK@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 ?W u(4 -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R APS0 00 ךP \00, 0 S0`B 0V, 0S`1\Q&Q\00 S SP" 4  0bp@, 0tejDt -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A 㸃pP@P@(S S (0(8 0 S  XV;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ᆅ0PU ( p 1 0tpdl00U0P0_(ȍ Hu X -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SPB@?T 000S0S   0S(0 S H(U8,l̎ -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,=U 0S S4 0-LM0@9SP$0S$S /S { 0P@  00Dk 000 K \S@D` R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ǘ \)0pS S 8p0 0 0 S S00 p-PLM@P& `0a0CS ,                  ,       p 000@Tp 0S0 C0S40 # u - P LR` 2P R 01@pT 0S @Tm0@00` 00 QP hr p-LM PR` 2P RT0 AT 0S @Tp0 (P0 0phr -\pL`AT 0S<P U@`V0 Whrď - rLMP@`!p?@H /P< l x 1`1`^ 0<TS00 0AQ0S 0S |0ap;P/PP n@0؏utut@ -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha |P@  00@ 0Q 0#S0nS0@0 ֚P0 @0  | ͖d~d0P@ 0X 00ha.噌0 0tlttuhtpttL  -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  pD0 :0S 00,K}0@ @C,  0)!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,M)0Sˇ P)|yPJK(@DP@D *0}3\ 40 sᎼ0ktut@  -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@)0SO ) \}0Rx0R P(p0\ CR #00AP 0 C0 b\ 00`0\ PJ.,`0R@tl)`vdAP sfL$ KP2[S<00Z @,ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 5"P P &D <0S1t uu4 -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   4000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@ u -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p xP 0 0'؅0 d[{Sp ^P00'必 0C꠭b00 0-PLP @T000 0-LP=P@0 0R0 @@0!Hꄞ 0-SL@p  P`}P@4 U@@V@H hꄞP @\0000Q005 -L,MS @D ||#lp LP ?PPP4#0SA $G H L Q 0S 0S"0S WP0 "PPe2p D 2`b`" L@ G82@ ?$2$ ; 00 , G00 080 4 幈ˉm@L̚TА|0 -pDaL MP44!ep dP ?P aPtP`` 0PX(PKxxP@ 0 00 q0w xP@p 0L 000S W0@̚| p-LM0@SP P `K 05PP 0 RPPSp?괡 -PL@`p ep nP ?P lP`pP` zPPPP 0P FPp F0PpS@ġ -L@啇pPPP0S?` d?P 0P gE0 SU0S VE Ԯ̡@( -tLPMB^p`L  0@ P @l0 @ PH -LM@pTP 0-S c@#|dp lP ?PsPYxPpP7?`W00S!0(R00S ^l!?Xd R $@KaP $0ASA2 A$ R20S`?1S2 R hBxR` R PdBd`VZX??0D,0  P5?BQc U`, (` ,pKPB0 R,0 P$PV`U ,@0!@eWpp@R 0%S# $K/aP $p`HP`AT D| >>DP  0p00  00S& @wPp6 P`7dKP`2 @@(ȈH h,|0gfff. pH\ 0-@0PTL 0Qic@@0( -XRLMP"@dc?P 0A`V PU / 0S {0S >1 LPl 0S0@  $0 S  1SqQ0S 1R0Sl= @P@!c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00R0@ ;0 QE Kˀ0P@@ RV  0 㵀 @, 0嵂0=(@((Т -PL@p` bp lP ?PmPp`t 0P0 PP =00P0 0PPS@,0fP p-0LM` P@|b?P 0AT K0-3\0 S0 1 !0l p$.=p)=@(ԣ -LM0@P,0 #Gbp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L <p\ p]  Qf` ᖄXIP@PR  Q8 劄P3 0X0C Sl: 9 9 9 9 9 9 9 9 9 9 9 9 9 9 |: 9 9 9 9 9 9 9 : 9 9 d: 9 9 : 9 : t: PI PQP'SP0-V +V ,Q@ DP \ \ =V1h0l1P 0a0CS; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; Ispmk@hXpVU @@K`Pp 0 0=00 b200P B\,0000D<ڸ<3@ܛHأ  p-(QLM !@8a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpGy P;P< (;pnyp@( 0-PLM @`?P 0PPKPK@P 0@0 SR R 0@( -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKH=PX Ln;sP uP`PX  L K<PX L <X;0T0 0P0 0!R40*X;$Xd?@P` 00X!PT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHKk[pP800c R8Ka[`Y U u P2 P$ R Xǰ P PX2 RP0\U00Su US 0"0  40VG 0S 009|0`71 R,4 }P# 0S$eT0S Xu XuX:<\00 000D8D<e  0d U0S4V  V 00S`FV 0V0 R hfPF\`0  @0 < Y@0p0H0 D 4:@ t|!H( 0-lPLh @h_0?S L0M0< 1 00S(0( 0hW0@(D p-ALM!PB_?P4 0P@ P 0SPU @Zp: _:sP``V 0-S PpsP@P Dt0S,9p0S`@(H8,D p-ALM P^?P`p0AT K:\P 0 ! 0 rR @0S PXWa@P00`h0 R 00C8S` RV 0  z9@(ԣ p-@AL M8!P^?P`E 0AT00  K \P: Q40 R 08SS#  R 08SQ 0S 000 0 at890bPW L0-9pQ 0`0029p@(Tpn p-LM 0S@`)p KZP'0S !0P@PB OY0S0eC10C0@0S0$0 R0pp|D -LM`p ^p fP ?PvPpp 0AT W CzP0 [ Q~@T 8)P@( -LM\` PW  u`ONFd`@ePX OD%BddW_N( FVe $P @e鄤hDY -LPM@lPK`ᄀzdK 0hp 0i 0 0x` -LM`SK@P lKJKG0S@ #3````0SS?KS?K0C0C0`|#S?K0C`VK@K(QK%m 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@l9bhX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C p|?Bx`@ -LM] DuP*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 000u1u P0-L@P T Z$|0 0h S`0 ! XT0hH$H0<B$40 ;$luu t -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lH#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P WjP XC@, < ,Pd00@TTPUX~WT$ "u |uu8u p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPUnP@ DjP80  p,xjP8uxuu\uo@-?>,1@LQ 00uu -LM@Q  Q Q Q Q$ h0 Du|u p-LMP` R @0@0R@PcPbV6@pt|uDu -L0Qh0 <|uDu - LM0 0 p` P0@@cP0 PPRt 00p 0L0L H0@ @0@p`E<T TPW񟗩ȵ \ X 4 \ ` V񟗜 L \ x D l l d `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , p004 080 PL=@` DA yA0@0@0@0T * 00 ᣪ  < @`DA XA0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]ShP | | | | | | | | | $ P | | | | | | | | | | | | Ժ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | P | P | | | | | | | | | | | | | | | | | | | | | | | | | | | | | $ | $ T   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ]P 0 UPuX p=40UzOP  @0T*  0@8@` DA MA0@0@hb0`0  `   $00(   0 S 8  b R8Kw<P00 0S )00 HKPp c  000  $00(   0S 8  b R8KC<P00 0S )006 0 | dK@K 0xc000 A^0@S 8  b R8K<0P00S00  00@0 Qc KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-Կ  Կ                         $ 00 ?00A `@0  (CXUl4,p2Z C0  0A 0  00#0CSO4 4  00)  000p 40Po]  H R000 0p 40P""@ 0 ]J]0p00 0 40@U  d  Xq 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D lD3[Sp<0D\F `A 6F`pN 40 U B GH0`VH0 `Pク ,M ꈚHDY8DЫ@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lY@-X=X ?X @4R44@T0@@Z0=X[/aP 0@S*S0]S =X Z[@00  #0HS $  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $  2/ 0,0 0 4 WbZP 0/Z40 0`CA 2020@S@@H^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 t[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[y`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080 Z0`P`ݥ@aYL0 0`S`Z Z H( -`1LM`p+@Q``@NP`@ 0S $Kn $A@4P P   僴2@#00@0 R0PU 0S 00S 00` AP@P,0 U <@ -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  m+8P@:p`p p:P`DT*P@: c:P@DT* p-LM 0CP`CA)P @0T *00 TpX0 @`DA A0@@0@`AdphC<  -0LMpH`C 0 0 R^ D 0`@VL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS  d d ,4 0044 |6 I/, 0@3,0 R,0 R @ ,0N00 ~040 0,0 0-PQH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00⅊P@> @48|$,,#0< <00, 0< S 0DS L x L x x \ \ x 44 4 c/ 0\/a,0 , 00, 000,,0 6P,00 3@  00 0@(M, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0TS:SQeR$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` i0S00p000 PU  , ,0S,P |1눚@|,0|@DجȚ(4TvLR P  @Ȥ\t p-LMP`PQP@ 0ST 0S`@0 0@L0 $ 0 0@ꐭ 0-L@F 0FPP$ 0h 5 -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`HF  @0;` 000W IM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p -LM`pE2/.VPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(.0 00 OP2P 0 PQ000Y @ @ Q0000 $F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 kP 00000 0 PP 0`GOYPX0P 0 c0 E@Rꈚ<tv|( p-L M PK`pFFP@  V 0 /R 0(00 0p| -LpMPK`@PpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0UP < P  ᙚH1  000 , ;00PT080 4 4 :4@TpW7 `eW 80 0c S8Kڎ-@ @ /0080  cR8KP|-@  <4 zP 0SPU4,64`,  Gp -x0tp00lL @`0PPy60D02 @L700000Ě@ -LM0X pP `ጣ $ Q uPP0: S}$a{ ayI}ar0-S 0 K@ P`0Vl<0K I0  0S` `MrN8 @ <0KI P^ 4ꈚ@P <tL | -0LMP8 ,0 < p AF/ @ 040 4 RO  z, ,0SG1 0 ,*★P@3<0S48 810Q8008 P  10  498*45p ,,寧I@0 U 0 |04 *,坧I4@ \P0P  L< 40S 4r5(3 t,L 0-0LSP@ @1SQLM0S9LMt lh(PHLM R 5P00P00S100!h(4( 0-LMP@ 0/80l -LMpPP`@ 20V`SP U@P0?Bc P@,, (0K(p $` @ 1gfff@ -LM@ 07鈪 -LMp`PP@ 0UPS` 00@ p-L M8a0@0 PR Q0 S Fp0S 2 0AR  SR $K0S 0 0dPU000PKP*00 R^:QP RP 00 RPP R t0 -LM0\ R@A 0 T  (MЍM0L ꀮ 0-L MP  04K@4 0@ (000 -L$M@L H 80KD , <@ 0@ ~(1P@ 0 R050( T+,0S&HK@0(S HKpHK@0(SL 0  8 [LMi(OL, LL'0@0 4  (HK ( -LM0@00Q3|    ( 4  &0BS     0 0z 'x0 L`0K 0 K0K < 4 , $  ꠮DȮܮ  -QL MP L@!0DTS.T, #T T&0DS``Q 0`T P 0`G 0`$S$ ; *!T 0`0 "T T 00c 0 0S00 A0 @`pDWX$01 RT,`  `0D S40 TT T 00DTST W!   $ 4 D T   4   $ 4 D T d 0 4  R,  0   ,L`@0DSp`"01 R Y, LT  0R 0R 0 0R 0R 0R 0R 0Rô 0S 00 00n 0 S 0 S 00C 0 0S 00 00V R 0 S R &  0x 0ct 0p 0"l 0h 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  C 0S 0S0 0( ,  HDT` -LMPXp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` (`+IPPl!7 P 4 _T 00#T0S @_T0 000#T0SA PE `'`{0<000 ` KP ⫿'0 0`V T  0`V )00 ,0 3P,0VPH D -LM`p@FT 0 0@ 00C 0 00P@   4KX @ J -0LS  0 0!   0! ZD -LM4@ ?0000  -0LS@ P0 R  pJ0S0e@050bI0 050`  -8LM$ `Rᬀ `ᰀ pᴀ 帀 开 r ا'+p{ 00ACS          , , , , ,  , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , h ,  , , , ,  ,  , , , (  P>NPpᬓ|6@  & `C P3PPP  RP  (<   000 |0WaB YX@00 P 0S R P0S R  Pp  0H0S0 `=MPP 42&00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B2@ QMP\ d0xx 2@ d2 RpGp W00W030"S /2F/pP`U pR p W00W030"Sc/pY G UHRX@"P@  0B.PP= K P`0 2 (00 20@ d 0Pڨ@ 0dSʤ00c0l SKچ%@ ;/00`+i$B x+/djBL $-2 RpGp W00W030"SRB Y "Y  0S  S0 0 R00ꈚp@̷tܯv 8Tx -`LVP |p ULP@  0S@00 T 0P0DP@!@v  -QLM@< @0 W ᾑD <廑\1  000 , ^00p0@80 4 z`g0PP 0*8K @\0S 800c Sڬ$@D0 @p'< #@Z+}80`P cR8K$@P  4, `.r0S$ p-LMPK`@&P* P1 000c0 P*U OppPU )pVP pp0dP?SX0 b@@0@ vP 0pvİ -H0H 0 SL4:QSC ذ -,0,  LQذ p-h0LM`@ XPRT`: 0DRC 0宻00C0 p通v|0vD0D  0aC1P  / 00 v -LMЀpPQ@Pl`ᑐEQT00? @AT, :0TZ,  o/P 0 AT:0T00cC>P ꀚ -X0LMP 0 cBA- P0 P @ P   P-Lx@0lpPh 0af0lCQT a8 1@0:P | p-0LM @R! 0S`0PSpphpX0XPPH08 <0 B PPJPpvvvvv| -LM8@04S} $0}/ 区0 @ ꀚ| 0 -LP@" `5JP000 RTpP@01Q*`P嘺010CQ*00 010CQ:|v  -1L M R!001CDP r"-P@ QP^\ 0y`aPG : 0Ip@ 0S 塴0SQ(pA60 P SPᇴ0 h Bx 0xpP o|ꈚvvv| vv Aq  R8& \& p& x& & & 0S Aq 0S     -GML M,q,1IKL 0 $ 4 @HPP" P 쀟BnK`F0 .-BP@ 2P$ 4P ᡝa$0 S h$*\0IKAP$ቝ $vv@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER ( ( h) |) ) ) 0S  U@PE0S0 0Q : 0FS   `` `0 l0 h0 d0 `p p-d0LM\@00cC1@QP 0`Qa0(S p| -LMl`4 0 wDP@P+ n0 8 p`ˍp`  0䠟S8   400C0W000 ` @F̠F00K FD00K/K.K-@K,`K4屍 4 0Ww@00匌vvv -LM@倌}00v - L ٲP  --LMT0T @0S4*po - ,@ --,@L^ |- r,{*@ --LM0 @0 Sg*0 |0 R   h0  20L0L 4R$ H- >,-@Ě0? --L@<<, ,--$ #,,*T @ P0-L@ 0P PP |0x-S ,T T@Q R 0<S08, 000PbGP 갚Ț@?  --,0L \,)v@ --00L R   ,, -LpM|KPt0: S  -H@LM |(0 x(0@D s( 0 v 0-LPSP@00 S UD - PLM @ ӖЖP@r0 S D P0-@L@P UT  0h(0`)@ -L M@K {P0P0 R d -LM@h p-LMPq 1@ 0 00S  R pP0S T00ppho0`@`P 0%0P00S %10P00S00P00S T 4 P0000ppT0Ա0     d -LM,@0SP 哚00d -LM4@ P0SR 00d -LM$@0SP o00d$0 0PQ 00d P0-Lp@ h@0S 0SPL000,PPD00P>00d -0LM`0V`PB@@pP,@d  0Pp +HP '$0  00鴚$ -1QL@P` @Z0Ǡ) v8Vpp 0S00 &0 S 0S `P@†0 0 0V8@TZ0S40 Rh=hiv\ȟQ vH, -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q0v㤆 0S S0 0S 0S0R`P 0SP ƆÆv$$, -LMRQ$ 0"Sxrxb@ hrhb@ 7@TZ 0S i= 0# @TZ7;=0QS 1 R R @qa@ 7@TZ0S aA0S P6P `1 00P P8ir0W: 0 M: 00~}0P0S  T7@c R0R *:t l00 :P b00ꈚv,H,hv$l|IJ -L Mp4 0  x, Ko` LDP @$0``0($00:PƮP@ 0#SUP3 RTPPU @0S @Q 0@0 83 RT  40S '30030 4:U35C ,K 㑇    8 000  0S  )0`V  )`V ;(D&" K,K ^0S  @b@R@ s6@TZ0S@ @2!@@@ @@O<50T 0S K6 G6_QyP@  NᷗVL1f81 K(1 ` A 0,  0(  00008 P0P 0`` |m,K Նh\vv(vd@$,,H<vD,$`x -LM@K @㯆8 R 㧆000"\v 0-LMPK 㕆x0p\ 0d 0 P  ゆ}0 @z0\vȳ -L M$`K@  fpTpP, (KP 0PS  @ LT0d0 C =( R p0!h`0\ @0 0S \ 0S\\$v -L M$pK` P(KP@$  R 0S P 7 hNUU  ޅ(0! 8\ -L M, KDɅ0K PPP 0S X0@ pT `0ŸS0``pS" @T~$W0 0qX 0SB0S  z0S pB h[PW00H0 U00 0S X 2 R0">0,K j gP1X`A00 R  0S AQ P ,K HO7 X F7 0,1!呚0  ,K(.70 h 0 } y0< s}9K,K lc,K T00 !H\(|0v,vvl@dl 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@v$DY ( 0-LMPK@ ᛄ80@0S 0@S ㎄0\v -L M,K`PD p}V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  A 9000!(@\v -LM pK` @T P0S 0@  00CS0<0@T@T 0 H@T0" v\@ -LM@K 800 \000ڃ 0\vv -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$vvvvvL00 000S  0S$4 0S000=v$ -LMP00좟000 SQr`p0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? "{ 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  @m 0  <8m40 `P0h;0l`0P@j 0`00@0000@00Za Q_Mꈚؚv,vl|p@HԴ -LM^0` V 2 0S{ `VpK뼠K  PPhڸpK`V 0@T 0S @T`VH 㰂V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H n00 0S0 0SS0000000 v$?Bv p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phdvvv -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@SV X X X lK@ \=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,4"0 SVt  V  PU 0S0 S t\h10y"x 0P@LDTn"l0[S (!T100l Kx` a" \" p0V"V 0SlK~ lK@ S"{0l0Kx @VT0 SS 02f 0lK2a R4P x X'"v,8@( HXh0p,HȈ -8#0L` %^0?SaZ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ d[ Z d[ d[ d[ d[ d[ Z d[ [ d[ d[ $[ $[ $[ $[ $[ $[ $[ $[ $[ $[ d[ d[ d[ d[ d[ [ 2P Z0010S P 1 @T 0S @Tᵁp1@PT 0 PX@TX Z 001@T 0PU p`P XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0Hv -p LP00 X R 0S R 0SRlvv| -L,,0@ S00 ҫ v|0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00vv$vvvv- RR  RRR00Q00Q <R 0S  R 0S v p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 6|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK?p Va @d k r Pr r r s t u v v 0w = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKjp P\P ʟ 0S  00   00X    20c RKAp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKhpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 00)7P )K P 0@S " b RKp  00 R<4➨n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x?)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`|q0FSGLAz@T *Xl (Q d|X0A0EA0US2 " / AE '2`A2&  b'P@ 0 0S 0S <0S 0( @ 0, <0喧 `  Hvvܵ(AE #'P@  P0R }R\ h 300T*X 0S0 0 0U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x(l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S r s s s s (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P aOy000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:  -LM 0, !B0001 < 40 0 408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K\ @P`S UU( P\P 0P 0R0 P U<K U$ <  b R6 @P<00c R- @P8 0 08 @@0 `̤0 00C00,vv --hLM 00CS0< 00CS0$@@ Q밚(@ p-LM@@`y0DSp0P B    $ < (`8 , 0 4 p<408`^400,( p-LM0`!0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  tX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 taꈚ4H4ܚ 0-0LPp@ P0@0 -0@L MTP@ T F,X-0A,S- 0, 000 H d@TP0H , S 0 04 -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 n~wXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄ꌆ P x ؈ 8 H \  L p Њ  \ B^KPEpPE0K,0A+K0+0Bv`XP@p86B^K PE0PE0&P5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%,5pl"lRB^KPEPEl%0l"lEB^KPEPE<%`} 1 P00{RPPU B^KPEPE0$4~KpGpG+0}0PPl"lB^KPEPE0 }0@p}B^KPEPElv"lB^KPEPE0$B^KPEPE +0w~*+tB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDlD"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE.0P0p0"3B^KPEPE0)|P sP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lrB^KPEPE "B^KPEPEo 60P  10P B^KPE@PE+00 )*@)*u`90P l)*10P B^KPE~0KKpPE,0L+A$)* P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8 @,H(x,<0d<`Ț(d6H 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(괍 0   @ #U` 00``` 00c R&@P000  V[U(K8P/ P(0PS  b R0@00S(x0ğP\P L0 R0P0 P0 `밚HvP -1LM  0((0 $ _(0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `FV00v p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0v( p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00pvv 0-8 P0@0L 㨞 @=00 -LM0@=C0 0 ʞ] -LtM 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@wwv\v0w 0-LpMP0@S|0lS`p0 TK  FP|0: S\0 0 00SQv| -LMp@:``KPP :-`PP%-P@ 0T\S T 00U0L0 R T?-@.s D;qv| P0-L@ P@(T T0| p-LtM@PH㴝08`KP0: S`0 0 0p| 0-L@D' P(,0P0h+d  -LM0S < " 00QOK0(dG/r00 K\(h@&&#&]   @ 0@S P@1PSg@0S P@1PSHgH7 0啀P,&( +(000-Pw'00  =6 ! P PP @0 @*0SƟ@P0PP |@*p"lk&`|'0@/SP< P @60S,06T  'Fp@R&:(N& '0US ?pUe%5Q00:&0@ 0S o0PP PD5P` ` PP,0S"P@T $@@$5p 0= oZPK;P2: St 0`@S@` 0XDSg$$02 e0L0  D$P0``P 0SK 0S8@T 0/%&| R$P PUY00 0Sp3  (00%&P  0X 0@T<D 0$u 0S YPw @$@$  $ 0 00 k$2op00  P P 0m 0X1\1pSP00] 1SPGh@=oTW&#+P  &0S 0S0S p!0SmKPKP!$2R! 2RTx+Pu pPptp0 @h+Pd@\ႛP ~PKD0`!  ;$Ț|̚ܐ<pnd0@ $8@d(` ($,`@P`P -TL$  @0 <0R4S0 h*%0~ꤸ`dmu -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1\P@. ,P,0 00S X00 4 0 0DSꀡ 1D R&0 R  @0S 0 @000 <00P8, ,0H 8 ,@ ,%,0@ L00S 00 40 -,0LM@ @@h -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2]\P@) 0@S񟗙갣 <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  T$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 A>,LGy@  0 ` ,ꈚ(ܚ0Ը P0-L@ 0S PP0 R @P 0SԦ Ħ Ħ Ħ Ħ Ħ [T 000%0S TT ꈚHH -P`LpGlP@pPT P00 Q @ -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  hj`V#0 R!0 P0@CTT WU@ ah0 P\ }0P$ H@ p-LMl`PU \ @0 @R#} T 0 0PU 00p -(0LM@T @T -,@LM0 01h驘 P0-L@ (P 0R @T0$ -LM/@P@rV(P0 0P00 -LM0P0@cSZ bSZ { `K Ƒ 0pR R ṑ  0R `V  $40"WĂ d,(0 ("4S `P鴿 ?d (D 0-L@PP0雿 P%꠭- X 00Q0000Q0  QH -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hH8 (,48 -H`0DpL0f@Pi00fiP@wL p-PLM`0P m@ᮗ@P p'0p 0Q0-@PL0 00h^0 p-LM0`S0 00@ 0PᙗPf0P00p p-LM<`P@1S@$TpH'Pp 0-LM@4P,,P$ 0 0鈚dPd -PLNMP! p0PH1 `AT P$UHR?K o{lQ?K-KAQH1`PH TP@<`0S 1<SP$U(ld h0 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0 -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`A @K$ j~P0 P_V 0000`QR rꈚ$` -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  goU<PP@ 2 V 21   N<"V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S G$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( p%jl@0* Pg%jLT@0@S 00$T000wDw  0-LM@P K0 S  P00 Q0 Sp 0 0-L@PP 0Vԣ -LDM耟0QP`@$0 P$0 S $j0pjUP!P0dP@UdpK  %P40p 0eȺ -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |$P X pX Y X R0!S@ R0]S@X -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  #P``FvX1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh G"Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?(00P000:S00P 0T HD0L0-SX^U0 00 HDYt( 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0h`4\PYP0HѺV -LMh4 4  , 00 @姑4q8 cPPP@cTX` U`V`P40cscp0S0W<0 ^ ~,@\8   00@T pWP8o频, 4 0, T < 0<Ժܺ( -QLM@ OPp `PP*PU e*0S O0S0@e PdUp:0h0 -L`p 8PPZ 0#S|0@Pu@ -LM @pP 00 pP00 p-@LMTP` TP pU +fP0  P000[Ő` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ \d 0 SP/R/00040 e @0 bRP Dd8 R00 4e0 cR@P ,-d,  P0 S/R/000.S0S/S  8 (0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` 'eP0 Ulp cT X0T L0hPЏ0P@@8|( -LM@d|0     圏00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /%P`dU VO V> 0/ c 0 0c RPBNK ` P@D7c@D` `P0`(K P/R P PP X@,0 S ,鑶0S 0.S0.S U0u/S U0.S^d`0/S  -LM@p|0`00 0,0< (p0P TP@20 P00S 0`` S`` og npsW@, -PLM`lp@82 T& V`0 0,0$ (` p ` P Wnꘀ[⊎x0\₎00@0P  P 00DS $! D! L! \! d! T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P DHlLPX\`d `0-0L@P^$,@0h'S^$!? -LP`p@ T" " " " # x# # # # # $ $ W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S% $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % $ $ $ & & & $ $ $ $ $ $ $ $ $ $ $ $ $ $ % & $ $ $ $ $ $ $ $ $ $ $ $ $ $ & $ & p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G ^y p 0 S P 00P @0S`Ey@PP200P @0S`1y@PP00 P0 00000SP p-LM`P@ex phL p-LM@`P0 S) ) ) ) ) L) L) ) ) ) ) ) 0S Td p@P0SVU@ PEP0TVU Sh 0-L0MDPK@ B 0 P* * * * * @* @* <+ + + + * 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjBx0@S P9x`00 R 0S0S1SP01^  p-PLM`P5 P0P 0@S 7xP1xP 0@S 'x0S x P phxxp p-LM`@PT P 0S 0Sw0S@pwww -LMLapP[00,Q, pm=P@, ]WPP VWP XWi[5% g[00x [@@מT QF5PpA5P@ iD,h?l -LM@0S[00, p-LM`P:w0 0P$w0@0S000 L000 D@H@ 0 L 0PpP -pL `L0P0A@TJ0S 0 @TZ 0 (Hvh+wj  v( p-LMd`dd n0PSpAW ,P1 S0 0Tw| -LM@pP` 0[S 0S@┐ 00  @ҟPv g  p,K0,  R* vU -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  H10 R 1! L0R'4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1 P 0?00 00<0 0@ PpL0PS !0[pS 000*P0<0(p!0[S(壽Hw -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,TP\Hw -L0M\0 p(0 N@a<    0`7 (!(1+`K @ 0O#ODP0U0f PG00f GP@ U 0 UBa1#  f0E  f00f 0S-00f  \`(0 S @(40]}(gfff -LMK @p ˼ԣ p-LM@,50 R00SP`@B : 0Q(*u0 V0   0 00 0p 0 00` J 0V0 H 0 0㩲P  㑼T pl(( 0-@0pPL  0 000hI80/    ~0w -L@ P`rM    RG  0 !@Up0 00SB Q/ \Q\-Qp% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QW@d@T00S$T@` R XRxR00  0R `00S _(H 0-0LM @KrpPh  0 R  R0P  00 t0 -L M`@I0P  0S082sp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @u00S  GH<H(|ܐ -LM0p hH` eH0P00 s@ F@=  0 0c0 FZ o/s -LMP, 00 AP` 0[S =S `@3 R  %0U p[0  , RV0 xᏺV h3r,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   _0S0 ?S 0S ) I DP 4  00 00400Z  hr dr ONDP PIP ,0h  Y`@P  @QL@00  Q 0 峹눚((dLH - L`p%60W00S PU 0@PqU 00WD0<0 0h> q q ! -PLM@ 0T0   R0 0Q [R P@H-0S00 0\00 Q\0[S 0S0 [S ]SQH -LM@P0 0S00 -LM@P  0S 0=S   -1L M 2q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 "q0@` DA qA@,@ 0 4  xL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Y0<0  0 RD0 -LM@8 $P 0 w -LM@$ P hw -LM@@P:J  3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-` \` \` \` \` $` <` \` \` L` ` \` \` ` \` \` \` \` \` \` \` \` \` \` a \` \` ,a pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c_> 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l $>0 0d c 00dR0c00P@$h@0S\0PpH0P0  c>0  A PȘt$4P(,0,DH -LMPP`0  @P0 04? R 0LyS{f e @e @e e @e @e 8e @e o @e Po @e 8e @e @e @e @e @e e @e @e e @e @e @e @e @e @e @e e @e @e @e @e @e @e e o @e Po @e e @e @e @e @e @e @e @e @e @e @e @e @e @e f @e f f g @e h \h @e @e h @e h @e @e @e @e |o @e (i @e i i @e j @e @e \j j @e @e e @e @e pl @e n @e j j @e @e o @e xk o Po @e @e |o @e o @e o p @e p p @e q j @e @e @e @e r -0S= R 0R0B00\=! R  04=" M  ╁P 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0  , i0PPS 0 ؋P 6P 0S  0R >@Q0 0cc `i  pK=00@Q@@@pp` :=8i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㹬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P%@4<0 0P 0000MA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000t8LxL|T|<<P,T\|(DH$q00  R 0P0QP HX@ 000 9  0 0 0 00P9 Pb 0P0 P00S@K -LP0Lp`tS񟗀x xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv xv y xv xv xv v v xv xv xv xv xv xv Pw xv xv xv Hw xv xv xv xv xv xv xv xv xv xv Pw xv xv xv xv xv xv w xv xv w ly xv xv xv xv xv xv xv xv xv xv xv xv xv ly xv xv @h0 Ru M00 pW-00Ĵp k  0pWurꨐ$ p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPpv0S00ꘐ -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0Y4,0 &{0S @TYP p300(Q 0ppPx$txHx~ , -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @+yPs Ve `FVV80S940q3`@M,03,0!0zP00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y05P PU48 Yv4ay540P``p6yx0 @ x00qQk D0@@ P[  00 xP$x~ ,txH -L$MK0 K @KK @xP@  vy6 0 RPPሚ -T0LM @R 8 TT^htt@@$t@ꈚ0P00 Ƚꠐ -Ltht -LM,@0(S]0000ꌐ| -LMp@P_` !Bgp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K%P „0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S DYĘ gfff -0L 㕨p -L -GML M<2 88@Pp`, $"fp fPp` iPp` 1 @bTQo1IKaAAPp4: S TcRnBKHH+ P: LC;20Y/S/00@Tt p/މP`` 0SP :0/S$ V:0/S `FV:0/S`10 SU0@T4 P  /P40`FV:0/S  -LjM M(kKH0 H`p,0 FP;2Q :P2 R2 RVဉP,0 S , 餃0S  |巇6: S" KA AEP L6: S P $ះ6: S V O0MK@D @DPUuKCPKPTn:P KA AP]NK@D @DLE DO@ P@@1( K ! Q@10 `HP00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`!:PRL 8MDY0hM -0L$M@  H0 < J!H@PPD@ <_@-@!Pp hPb[0Sp h x@T UP 4@Ն@LP??@Ȇa{?D0SF/P=00LeP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , .PU?P @@噆<P$<吆@勆o0-S @僆L0S @{_H@@ 0 R@m@i0;0<`H0P0+PrX<H D a@N}0Mb<L\l -LM0 4 ݂P= ,K rp# ,00#4 ʂP ,K _p ,0 #4 SS| |@0xx x0嗃hK@40(@4,8 ,0儃\ 0-,@,PL $ ӥp$D -LM@*P 0> 0-@Lw*PU ]0Sn>000 -LM0@S h**p@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P X* 00 -LM@08SK  -"p 00  >,H 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  P2P e갡l -L7| 0-XPL0S S 0@ S0 00봡 -LOM\0X,0 0P S ,0 S ,,OKKK`VT JTP W?K+:zPW?K \!QH1SD1 L1@j^0P S Tb818S \)<\00S#\! D`K 0  \ C0[SD[0 CR 0R P 00xQl垁0 pW@X D00CS00  ä0 Q0 -0L 57p( p-0LAM @P` Q`p sP` /0 @bTQ!P +Pp GOK6PP V~.4PP:DLX -0L pd -LMnQ@0,T  h}00000 0 000  -LM0p (0 P@/UoKK/=PKU  S?K\ Z0SKK,L1 H1 D1 @1 <1 81 41 01 +,KcL0 P4:(0 S (忡 -LaMb>K0C 0Cp( @Pv$6: Sg  S$+PW(0 S (員NBnK`F`F|!|1w+0S+@aDxPP$[NK@D@D  AP92W>C R0 RW W9|0S *@EPPW dBnK`F`F+O0)0KW ,uedA -LM@X 0s o`l`i`T0t9at -SL Mp@P|00!1/P`!  Vx ~|0S@ 0P P* W@i|?00 \@a` X0P P* W@O|?00 DY\ -LM@ K K 0K @@'P -LM8 < @ P`pm 4KP@h 4 0R SB $P`Z 4 (40@#YP0PS ,KL 'PP 0 P@ U10  PP 00S0 KvaP 0 R ;;S PP 8>P PP 0< @0T PPV $  ( 4\ -ML M0$ , p) P`:{?000!1 ,0S ,AP@ NP 0 7P q{0S08i{0S !0mBKHH F'0@CfPP- t0@S" 0S 0S+ 00L~ \ 0$ 0:1{?000, 06Vf$8 DTXlP -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/z "00Z z 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUtz"00 P pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 Wq0K J40K5 B"0@Z$$ `JPU *0 K0 ZP00KU:@ K00K ,@ {V`})V`t|| -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sy"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/꼥$gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PM PPڌ@PEUp pT00  0<0S000PC r0 0  R -LMp`#0P@ r \P \0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 5Px 0 6P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@h <K4K0H0S񟗦 l  < , T | x T T ` < T  < t  H < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < l  < , T | x T T ` < T  < t  H 8D3#cX Q0@ 0 KD0  DK5P0S t!000PKp JGt!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 'Gs!002cX" 00D0 ?0PKQ@  DKP0S s!00h Gs!00ŸH2D"cX 0QD0 @ 0 KH0S DKPs"00s"0020K00!1cX! 0QD0 @ >0PKA0S DKPps"00ls"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLfs"00Hbs"00D00K000 0cX @ 0Q@D0 00K DK\P,Fs"00(Bs"00$GDLThpx$(,@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R s!00 2Fr!00000KP0 cX 0QD0 @ O0 KA0S DKP01 R r!00l Fr!00x1a00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R r!00 Er!0002300KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R xr!00Z Eor!00Q200KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R Jr!00, zEAr!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R r!00 LEr!00200KR2"cX 0QD0 @ 0 K0S DKPq"00q"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R q!00 Dq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R q!00 Dq"00v0*00KP0 cX 0QD0 @ 0 K@0S DKPY0 R oq!00QL Dfq!00HD000K08@TX`t?G? 0&M@-O@d4xB 02d @-M0Ѝ@4=> 0( _8 -L MQ@0K00#  0 G0T0P00S00#0 -LM K K!2P -LM K K!&P -L 0KM#=' -@@L0MP0  0 L0  00S00 K( KP(d00 -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S W   0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  #0S 00Q -0S 0  0\\00 P              plhd`\XTPLHD@<8\$Lt< 0- LM@P K0  0p0y*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J 4 4 4 4 4 4       $ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 ! \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  E@` -@TL P`p T0g0 0l 0 e@DT  * -ML M<$08,0  ,副PP^ P@cBnK`F`F sP 0#S   P< P  P33p 0PP( BNK@D @D 44S ?R0Sp  iPP  ٲ44S ?R0SpO/2 ,0S ,僅BnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 㑲44S ?R0Sp  PP  {44S ?R0Sp BNK@D@D +"< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @( X\8`(aȎ -40L R4P P00  0-LP$P P$@ P00  0-LPP P$@ P00  -LtM@0SK V0ڂP H K 0S x0L: S< `O00`0P0D  -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ " 00 8K 0  (lDtx` (P0@-@P  0S ^ 0S^0 @0S SS00@00P0 * -QLM@,0 pR oP4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4< @,0PP`@,0PP`_0 0G *C * --L]M qPM?KC/`KK \1 4Q 0Q  =K0K00S cK|1 1  x p@ 1P|P 0S L /|1S00^ 000|1 B *yy * -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ ! QQ *vv * -LMP -LMl"  2 ,  " !H pX_0P2 0 PP 0Sb P լP 0S b^$481!`)!j]0`X0 `0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKnP"3@(K0SS SQ   Y0  S0 OK @DK0 P-?(K R!  0S 50?(K R2S "RK  K \0 4  MK0iPMK P+ 1MK P\ ɺb \0S \ L建* 41`\ԺLD / h\0#S \ĺ 场 R@]K 0{@,"|@B"2@@P 0S"2P h,H$LxDYt, -L,Mp`@ KD0K< 8 @ 4 0 , ( $ 嬐PDP@  0`4PP @TDPDL -LMp@P `p08K8 (P , 4` p7K0 8K (0S (Q -MLM Z,   4 `a V $ 0P@Q X1X1 - %Pp' B^KPEPE0$! @6ᦫ`0V INK@D@DP 4: S  R 0 0 ,0S ,Pt $R 0R\ 4 L 8j` $L -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $` -LEM@pKK, 4! K081 ЪP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,~0S @S P K?K+`0S @S K?K+0SP @S  4.P`8~ 81S  K?K+ 4t8 0SP @S 8~ 81S  K?Kl+ 4\8 |p -LM8KKPp <, PP `P@ ,0 S ,q~P/K%>KH D LB @B KH L @B *'':*++6*2* -L(M00K/0[0 [.[-[$(,<4&[%[L<,[+@[*P[)`[(p['[!4Č"< "% ..* -p-LMPU/ @0  0P0S0c 0έ`PU 00 00p@ K$ K(0K ( P @ PP$00P 0 ߿pT?P77*88* * -LM^8K- 7<K@ K0 <0 !Tp` P" qPmDK@ V `@K~`]vD@K p @Kh0 8K df*b*^* p-LM@PP! `@0  Q,00R0  0S 00S0 ^ @ 00pt -QL0 M4 0 0Z000(K00) "VPP9 0 P0S pЀ`@C0S@ ` ;P p WW0S 4 R 4 000Z0 000S40S 040t** -LM`t PPdq 0SL0HH!pվP0P00@(K P(0 R 0SMR- $GR R #@Qʑ T#ppx#KRdpKXpAkR gRmR,pF$DYT\0Mb*^* -LM<`p@P0$ P@ Ppc0 -LM@` q00  R@P pK 㔣 P00\0SP:Q UqD0  00S0SPU@  -L0Sh -ML M0CKJp`@P J! ,p P`@ P ` 噡PE~KpG`pGf :P\ \ 0 S RL\  \*B^KPEPE  \4  BNK\4@D@D<0S J "00V:`P@ `8%0==0` 0 @ a0AS"l @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖ꌁ X X X X X X X X X X X X X X ܁ X X X X X X X ܁ X X ܁ X IPI< @\  @ R  @0<@0 X V:H   ₑ H `P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H :P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 I 0@'͌@ wI @-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!"* --LM p-P0LM@`P8 4T  尵 lp? - 0p@L` GPP0S @TP@ -L 0Sl 0-0@SPL(( 00 00Ი  0-0PS@LPP PP0P -LM0`Sp (KPP (QC 0#S@ S> 0 S RA(  #GP0e(0 (P@} ( (0PPřP@ P0 S S0 S S ᶙP0P0,K ™,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @uP@ PP 000  bG0@NG0@00P0嶗P 0V 0 -L>0Sx\\*;;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ $ -p`LFPP P @P P 0S0S $ 0-@P@0LS00 $ 0000<$ $ -LM(@0S0 00$$ -LM0St (K 匔Q@`Tg ( 0 S RL0L(  S *](0#` @Rq #PU`@0S0T`ÅQPP `0 S S0 S S BP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\PP 00PgP@Ņ,,nP$(,< @-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0LH*AϠD* -PLM@` C00P,K0K 0, ( PPop VT000Pp  0 PPYp  *C0@C@* 0-! L0TT!P@CT @@ T 0C0 0 -LMp`P@匀T h=0S0d0 @ȥXo00U@ <:("vC -LM@(|v@T0 @u   B00! RA R0000000000000000Zg* c* --LM -L@`pC`0 XXP#T  88 $0:  gp?t  ?0-1pQ LR@` 0S ?P @@ 5Z0@< &0v000S@ ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@  0-LM 0xr.0l@hPTX0 RP 0 PP@ |0H@ D p-LM@hP`k\ 0 @4aTp`0@ R@X 0-@LP 00J,@r.0 D 0hH@  -rSLM"0@P` :Bp 0P B0p B p-LM@hP`M \0 @4 Tp`0@ Rm@X 0-@LP 00,@r.0  0hH@  -rSLM"0@P` :Ap 0P A0pA p-LM\@0PSP`PP ё@0PPPpꏑPpD` \ 0-LP(P0@P @0@X p-LMDP0@S8`p$0P@@@xD`\ -@LMmhj@ -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KnD\d QR d喩PPaDD]DPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,9eUT@PPh@T P@K0h LK@Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @lPULD0LP 0H3LK2 P@K@P`KP: h0S@- h@ )R fP  T 崨P@ 00CS0 0Ӥ0 P p 0+S:P P P P TK~C\ d0@RSA00h ៨PP \QP!00 DQ0SG d0S7 ,0d LKP@K@ePPP LLP0T@KPT @Cx!?l0S3 0CS/>u@41 ,0S 4,)c KOp>0S   WKBP7KXKL00L0 60[S0X K60K#:>00Hp`> 0 |x`? 0l0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q N>00 0 S 8 b, uQ4t,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd*KK**%*%oo* *R0S 0S0S0  R00 -MLM00  0PP q`@`@T T 0T,S 0S ɗP   0PU  0PP  0PPP p-LMP0 S0 `@0 P P0SH0X S0L@0Sp007 4 1T -L M̀0`Sp(` +P@# P\  09P x$ K10P(K|᷂P ( 80  $T0L@-0S@ @ 0 0 0  -LMha ^( @Pp$ < 0PD ( K100P= (P8U00T00S*0U0T00SW SP` "P 0 $@J$ 02P $ 03}$K;|T0 --L 0-<0@ PL,,hT 3 0hp? 0-0L@P 0SRP0 CR 0P0 00R P . 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``aMp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' -p"00@40S\00pgS \,00E0XSxS@`P -PL4MPL p` 0 Sx@P X 0 S o@P L0@KP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h tP & P0S1*8  sP+ 8000dl -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi !sP0S PP PP  000   PP0S  0PS  -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , rP0 R 0Spx0   0 R PX 00p , 00  RP | p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00SiDDDDDDDDDDDTl` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S X -LM P p0 0@W` 1R V>@0S P0 40S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ dP@ 0^?>1  ^0&0@GP@ 0@0p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`pa0 00R0HPU@  P g i鿋 0S  Pim- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!h000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0%P< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE -LuMp0 (, 1 P`` PPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 孃uK %P? 1 pnP@ oK 0 ,0S ,E0 |10S H0 @iy 0`YtP0 -LbMȠ0JK(0 lp! @)@KHpBZ_K`H!Pl0 \ TjKjK11 P 0J(0 S (E -$0L!00  -LMpPS`0 D -L MR, 00 `[ Epp P,0j,0 +Re -R`-S+S, 0 , S00 0Rx%00pp%000T0ST0 RR,5 \ u- ! 5 -Q* %5  Dp00 Tq 0 0 a0b 0 000000!` 0S,'P @T0s ,$0s00 4 0S 0-S 0Q# 3 1P -Q  -Q3   :Q ,P ,0 0p@ l3d0X#0P@:T0w -T ,ކPp 0WT00Q00S 0;S> 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@FP40DY0 -LM 0c -L M@@Y -L M@@O*tt**PP***33* P-L ht/00 -PL`0\p \=|# 0 0  R3 @ 姅h P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00S%0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ +h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ՄdP`a\ h000X0 WpGk 0002XpGH|( -LM0  mzQ< -L M@ 0@]zAhRR}*ZZy* -QLM  0K  0   0-LP@Ep PYp U T 0\ vpP Uh6 -L??>>>>>>>>>>???????????????????????????????????????????????????????????????P 0SL0 SxP\0R` XRP 0SXX$1H@0K/BA@K TP@`  l@D@KTE c @ K0M0L0 L  eeL 4[#[[#Ġ"!D ȠȞL,Ƞ.$H0@ K@ < 8@ +4K0KPVUUU -LM, ZpP U`@1, 4$PT` U@J0VZ @P U0 0P U -p-LM`P@>KC/JK X1 0Q ,Q _?K A xA 5D0 bKd1 t DQ " 0S >pA{{r*n* -LM@`p(PP< 0@0@@@@@@@@@0$` $0 P tP@5 mP, 03`P1ZY(ʐ \P ` 03$0 Y  < ?P$00$0e  `0S $ )@TD0 003$  3S03Z`` 0SV,0`@,@ ,@ 00|0 0DYP -LM( Dp$ ` x/EPP P P\@ h(@00 00 0S p-LMP`P 3@S0S0@d3S_P(P#W$0 #10#0V@@TJ0pE20`P`$0%`4 -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` 8P3ա 03š0 #0$0@P$0 :.$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P _ 0@Y@$0 @2 ux @@_Q $@ 0 0R 3 P0 3L00 ,P  *PP$0   30P0K0 8P:3 03 PU 0  PU:$000# 0B8S 3S  $0H rP3ԡ 03ġ0 #0 P R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h Pp P{600P -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z w:PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT0{ 40$0:$0?00puP  W $0 P T 0phTPֿ0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03P00 <0 |@H400420#4 0 BH  L ,0S V4 #1400 -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`1Pp` p 0 0p P 00 -0LRP@` V P  0P @T` 0@T000(00پPpPppꧾ -LM$0HPPp`_P@ 0 )$ 0I00D @0(`0 -PLM@ @wT 0-00L@ :0S00R?0 00^0偾PP 0S PN R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL00UP1S -LpM$`@P R K<Pp 0 0R, 0R p00V@@1p  6PP p-LM` PP p 0@0˽ ɽǽP -LpMpp`  KPP0: S g0 0 p" 4`P@ $0 0P $PP 0 PتD0@000MP  P`pP&7 y6 -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPkiTPP\_  `@L  0%0DPc`H0S[?=`@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4 Ϲ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$垴雴ꙴTPPY叴$却 Nd@L  0'0D>P^dH0SVmk$id@0\ >PP-p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y_0000AϠ0 P0P 4( < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8˴0 4ƴ0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Yw00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< UP ,Y 0 8޳0 4ٳ0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11a* -4L|MHK0 @K0P㴄)e/ẳ@ \ \ R *0S0\  \ 0|S :S 00HH$@@@$@8: @PX0$0L K@X0pL0<P K@(0P0T K@00T0X K@,0X0@\ K40Pڰ\d K@p00, d0h K@80up408 h0`l K@<0kp6[>Dp K@4cp7[0(t K@4[p7[0 x K@4Sp7[0| K@4Kp|00 K@P0Cp00 K@T0;p0: K@03p0,pK:| 0ml 0Km` 4Km. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@S8 -LM K"*vtOO+*'*$$#* -LM0`=S`pP,KP@; U鵭 P:0P00@S=S 0S=Sg! P,@厨P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q⿨P@ 0 0S 0 @0@, 0( p-L@`M@PK᫫P 0! 0S0 p 0-L M@>H0P (0 $ 00K K(0@  0  ,P aP 0x` BBy*A``s*##o* 0-LṊ@@-@0S  S 0Sd@(P*(I*Q0 %L 0!L$hh9*$%%2* -LM< 08 rSwS@T 00  㸧, ,0SZ 4K♛PTpPH P < 0rS <0@4噻,0@, P,00,  4ѕ@00@T 0ျ@T< 0rS 0w4P 80MW4g0@4cT L4Z0X,嗧,哧,0 -LM☀@`T 0S `@TT $pK pP]0S V0000eu$, -0-LMP0 S@   R1 00 cQ  R!,0 偶 0S "0` -0-LMP0 S@   R1 00 cQ  R! L 0S K"0h -0-LMP0 S@   R1 00 cQ  R! 0S "0p -0L  -BMLMh#0P,0 0L4  0S 00,3 ,0S ,!/ePL$H$ K2P@@b00 cBK J JH eMK@DPpP 0SrH`0CK0A S A P2D4 H2@ K0C0C0  A  ᐵ100C=S񟗗TTTTTTTTTDTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT0 S  1S!00 c0 p7C0L4 d껪PnL$R 060S3/xdpn\P0@-@^  0 S SS00N0 --L i 0-LM@Pe0S 0}g0S ve0S  pe\ 0 @@PpN -LM@`PteP pWŦW0S `U @YT :0S U000@0PTP:@T TWPP  ȩ 0 -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`YT < h000 ďY phYp?t P 0000ӑ p-LM(0`S/ X   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ uv0 0 -L 不* -2MLM#0@,0 ]0/S  P BKAA 2+ cp Y W3*WY 0P/S00@83 ,0S $,/ }cP<P"P@aTnK`F`F ឧ0Z0pd   0 S/R  Rm/0 0 x2(K RW\mcP LhcP@ Y 0C/0h@+(Y!PBKAA(P@L<: S< S0< ?nK`F`F!PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +X Pp* +bp?00^ 0@C/Z0@h>00SZ I, D\+b>00S8 B>K0C0C+< b!P p-Q00P00LMSP@`P 0s pXp[P@`;00p 0S Sg* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ꄍP %T 0S 0S0 0C` 8,0 S |,/fP 8P@pzT| 4DPl\pxiz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 ʵP MTt$\t Z  @ T *000圌P d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `_P T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 5P XZ @&43@4 0qL9  00S 0Z0C0   0SP 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSa4444444444444444444444444444444444444444444444444444<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXo%P  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFttDDDDDDDDDDtttttttttttttttttttttttttttttttttttttttttt@00CS0000?Z  /@xeTET& 3NK0d@3Ks =K43@ 4C  43 43 K83083 43@ 4# 4# @x3KXx3.KXjP    9 S9XP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ g000}P`dp@V W 0 f0 0  f5 -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K +0KP@@K 跉<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N@"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ۋ@K &@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S }p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 ` -LM0 @0pP `冀yPP @ Ỡ00@P0  PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0sP0000% 0-P@LT a DA0DSR0D@TP0 \([P.T.Q0 -EMLM@H$ 0r/, 喡'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l o8Pp\DDPV `V)*9` VX !*9`V H*9`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H妠D4@ cTH[D4 0D$ YYX^ X Y^ X P S@@ K@t XH@t0%<H$G Y[ XY d^`` Dd?PC3 WX^. `P! D4 0b3 Rd%D "d %o*3TP:hQh fdT4  T4 9`D40D4 D4 03D400D4 <K ƞ<0S80S40s@2 D4%?G9YDl?P%D4H$D 0 l o7PpDdPdd ``QD4 "0 ,2P^D45p#04P 5wz DpCNK@D@D 0F7Pp;Pdd ПD4 cPdp `d 7ZD$pl$ 0D4 P1PP*CNK@D<@D 07PpPd$ d$ D4P0P 土D4 00D4 啟D4 cP`p YD$p0D4 L0 D4< 0,00H4 D400D4 OY(X lL 0-0L@r/t剟P|80s 0  0S 00ꔛ( -L Mr/0P`S8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn ,0[S6 `S@ 0fS+ "bS @TV0S əP Ƞ 0.P 0L` ySX`{ 'Y,0[q0@T t1  0 D0S:R .R 0P.S  <P,Yh!hh1H @0 p@@81  :XPz0P.Sl  }<Pp,X < 00 @p@0 0x@v+h0K ^~/PP'\0 ]/00c0[ꔛ(X(l  -BMLM3@0r/, K8 >7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn ߂2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,?㰘P< Ƞ@ <4k-PP&@$< 02Pp Q<Ҙ  ᝂ!0X0P 1 8$0  0 0 <崘ySX p  b0 W@tP. K`g0 , ![P@p PPUZ.0K gWpt00 0  0 @ [\`/00L00SS (  h(L (\d, 0-8P@0LS((+?0@0\? p 0-,PLP 0@T 0;@ -L M0r/$븢4 0S ,K >P@ ,0 S R@0@,  S*h y,0`` @#R #?WP`,u@PP r` :P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`D@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4@PP @, t:Pn4 0 ,  P H0 DD]>P Wꔛ(Xl p  -pL` 3P@ 0S);P PP !;P 0S t0 -pL `P P@ 0S 0S 0PX -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P X90 S S0 S S q?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4=?P@ PVP $0W`4Xl0( -L(Mp젟0 S( PF;P 0@`8PK P@YP00^XΞ    t@@0p!lL0\S@0 !$ 0^A( $DG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@ЍDGg7 -LM`0(K\p@P.  ᑕ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ js  -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ WP@a 01S   @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:M p-@L$MaP2 ` 0( SX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S   韑  -BMLMr0D`K@P ,0 02S0$S aS@ l,0 S \, @0$Sz2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 )STK ᴔ tK @TK  T:mT(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000 E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` 哐 H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !ZX -LM@t@ğ0 8`, 岏 .P 00 0S$S 00R5:0PK c ᕏ 叏 K ႏ  x 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,l 0-PL@U !", 1#80!"$ 11PX 0h鯍0 -LDM@@ hK‌ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#*# -L P @ 0T `  p0S# @T 0R 000 00 @0pTP 0p 0 0R @ Q-L@ 0Q`Q p 0R /0t0 0 0R P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 ߊP@ 0 -0PSL`p  yP@ @P@  gT0000S Z~﵈*Π0ﱈ* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'99: :4:::9 :4:4:4:90U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:00 -LM;rt0p Rd0`V @@TJQ 0PES@TZ`V*xt 0-LtPM@KT 0K 0 %  @@徉p 0 S 00 0@0@ p-0LTMP`XK <@KhK0 0h0 屇0XK< K0@0 dK`0 \0 d0 奇uwt0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PlCP_00 0@T0@Tlpk0@P0SHp0ToCP00+ d -)MLP|M0pU K,0 $ P 0:S /S .'CP PU  0:S0/S XhV ᭈ@᪈@@ T*BNK@D@D+C+8+8.BPP 㽑Pyp@+ )K(JdJ' J *KfP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Qy T PXy @ T`@ T 0 0@Q_ T@T^ؕP` 0^- S@P0L00 SGT@ Tx 0@ T0 T5Q@]PX/ `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T @0LT 1 R@@@T4(K R K0j c@ KT$00 :K4@TXʈX KQPڠ3(K R4 @2T00 S00 X2> P 0SP @ß2D0  R P,0 S ,!1tPPP nP0\ S0 S3K0(AA 0LP2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$T0P Q0nK0(A^ A0 [0nK^ 00(A P:V^ ZtPU/APTr P06Hq+[[0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ ?P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  dۃ\@P0` ^!@d T Q -@LM $0S h{ -L@08S 00Phd(h -@LMὃh麃0h 0- LP@< P0S >P2 zPP%^@00 , =0h&l P 0:S H P 0 ,=00h(h(g -@LMbh_0h -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  AQ" p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQxU8 -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   xU8 0-4PL@"~h  W@~00hxU0 0 IX 0 0CX@0  R J1 0Q R@Z -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠ&p}0` PP   0@T P`;00P@@T 00 ,0S 8,g000X -LM0H @0$c}PH  hdhh -P`LV@ }p0S  SP@D -``LMwPp !0@ `0`VQ0@JDX {0P00SC/|`VX@E_Zh 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/q|0!8 -LM:L@0cP0S @0cP0SP8ep -PLM\\`p@P0SpC/0p8|PUX`EOZd0 n8i p -L0M0 @00 R/Lqqqqqq(r4r@rLrXrdrpr|rrrrrrrrrrrss s,s4s@sPsPs0 (0 $ (K, K00Kyp, E0 0K{Pd 0 K0 (0 $ (K, K00Kyp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`vP{ 0 p`dvPPk 0`0`KX00S   00 R 4 40  1@ 0 (@\`$@TpPw`8@ X0pX L H T` Pp /XK/P* <0 0PS` 008.0 @d@ 呠 P"0 0d Kg@@ 00Q00U^vX[v0 D0DBa ,0$@(;a 00800D~f̓ M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0mP0S0S 3`0K KP L  32a/@#b! ~P pj `@? B7c011N0 d 0!T 0 L0L " X`/uPDJLHEنNFb0t0xP 0-0PLr/8_l4@0, ,YlB@0S0锛(,h$H -0PL4r/Dl0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S kPp 0@W0 0 R@ 0TP 0Pꔛ( -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, P -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S -LMH L p r/0, HkH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢t)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 P¼00D"nPOK?K@DH2L42  p70 l" UY# 0K00%\(K h (K0S tEoK(K0X% SP1\# PP(K0(K0`0(K R`0 Rk tP 10#x0Q0S 8d0S P@%.K DHL"0@P񟗟t)TU Pl hl0,6^00Sh o лl |x| dǻx"l || [S#0S0SSD"0S 0SD2 ՎPP3dC0  0S p"x2 0S ßD"wmP3 2HL"0rL2P0p"RX  eX X2S0X2 T 喟Kxlb ZP@ 00Ì 0{PgdUF d"  O00̠KOK \ @:mPP `0 Rd   $  K H0P 00SS S  0 t HT`1|d"xS| P  0S |x| 0S D 0HL"[L2Pq 0(Kl0(K0KK ( l޺,8@7 P%(tdlpxh -LM4@0S w$ 000 dphlG-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ| -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ| -OMLM@ 0r/ , f05 - 0fUT U U U 0O`= K AAH !~p7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q %eY/0`00n0`A ` 냹P@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fd4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, 6 * P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4Ec4 R2% % P kcT ,d P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL KP ;Q Qq6  0P NKJ J  FPE %4!@% h1 %P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " GI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D[PPV:00P0:0 000,0 S <,U0jbPP ENK@D@D+P./P ,`2PbP@ `p,(`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sw1S(,h$h ( 7( ,ȯ &8DPT -0LMP0r/hc0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P01ꔛ(`lxnht<4<("4 <1QS0 g 0-L@PP@]T0] 0-LM@ P K 0K  P @@(`p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S T4^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB/00h -LMP@`T,`K,pK 4P 010jP VX`@TX ,K K`0V0.T00S` X  -$"L$M0P@ <K ,0 Sa0:QK 0CPcT RL K0 A ,P@)t W~ { 0  HP`K> @u>K 0C1Kc@@2AlA H D< L @L ^Kf07S  K A 0P@07S  0\KclA18 A 4< 0 < /KmQ T00%Q00S  `@Dvr `W!X< PPD@`PeX  0˩ 0  P PJ `81 K@@+ 0| P PJ ` 1 K@@#@ l   p,x`     -LM0@s Lf0000 -LtMp0|@ $0 " 0jP`KS  $0S $Wth KPK叀K 7[pPfPs|p a|   -PLM@R  ?  000 -LM@e 0 0 0P0 -LMI -LMp@`P0T@$K P,0 P00g Z@x -L\M `\, l Pt 0%S U 000S,0 S ,&@zT \\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ \\\\\\\\\\\\\\\\\\\\\   4 P  X t \\\ \\\      D P h \\\\\\ @   \ @\Xlx\\ 8@P`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdK!0 :hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A ulp*$IQnmx`$,H0̷0< -LMTp,@KP` 0    0S DQ *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0QLp -L M@KkPT `0 -L"ɠ2l3c13@"c1MP 1K0  F C -L^M⸠p`OKPC/MK@( h < 8 sSVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (P -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @P$"(0K!48<#8 S*S 0H T H0L P J I@O  LOh@hA Hp\ zL0p4Slgp PBNK@D@DhL!L1Ap@) PpPD0#SEKEKALK 0 LAIP4 \ X T KQX4P$0P _hP__p$RhPV0pL|M -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hKp -LM$@0 S K0ꔅ -LMPp`P@b ,K0,px!0p  P @\T`E,0S      d!  d!        ( 000,(0 $ p P@T` (pP0P (0L 0 (0 ꠭x`_ -Lh\P0, -L  hB  -LM`TPpP 0 S S 0d f 0 0 @0$ U@5̓  -LhP0t --LM  -LM@$ O0$0KQ \  0  K 1S015 -@LM z阅 0-LBP|@ 0S L| 0SPeT 0S \00LS `000zO0 -LDM@ d _JP dZJP`} 0Sh 0S0J0@ @@`KԃKLpP dP00 H XP L T@ fXKP0SVdJXaJ ^P0P0H0STTA 0@81H  XtP SP0@ 0000p0d  N X%4 40JJ  `0X@\4 0000 00(@,4 0000@+`-̓ -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 P@ ꘆ -80L0S ( < 0 阆 0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0 0-0 0 0LS@P 00S 0S 0S  0S 0hP111111000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @  @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 ,J<4(<"4!<0  -LM0@SK C < 4 P@O?K  8GP@0!V@ 0 ,0S ,YT` K?KU .KYP`  M?K Gۜ.00001 00WZ>P 08)  ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W =00<PU 00 =PP 0 ,0(U B   P WWX XXXX$X,XW4X    -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*O00Z 0P0XR00S @( K @  0IZS|a,,a,,,,,,ahc,lb|c,(e8e8e8e8e8e8e8e8e8e,,,,,,,,,,ez,z,,,,t,,t,,,,,v,,x,,,,,,,,,,4zezzz|e},},8}u(,v,, ,.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ] 0 0" 2Sd P ?KP +e02 Pʟ,0 S D ,Pb\ R \ 202 b  K).K?K b+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K 6b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  ?`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ PPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPK dPtL 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 \&0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2"SK1 2 2`0" 2  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ P- >(K ` -KP㔃2̌S 3KL -KK K2 +GYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K N2 S``2 2 KS12 2  2@02 ʌ lQ  " O Q 2S12 2  2 g@ 2 KS P12 2 202 S  2 KS"P12 2 202 ?   2S"12 2 202 )  2S"12 22 /202 2S 12 2 2  02LS1x2 2  P`" 0" 2 q2 0Y2S12 2"0X T "  !P`h`8P`̌:@ Y K >(K`2S0 2 +KP % FK PK0S"t 00z -LM4j @PK  4pK, 0 p 4K3K2K1K0K/K.K-K7 K 0KZP*ڸ0@%SP@D0p! @ 0BZSL  L      $L Lt LTTTTTTTTT                                   d  |  ĉ      $000C S`K1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKK꧉ 00^ 4 K^ 0\00 f,0 S ,  *R 00B SF 00B SA000C S`"x1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0ş1 Pb0P0C 00B S$R0p  0X 0Z KKW 9  0X KKJ  0X KK? 0X KK4@ 0X0  ZKK$0X KK0X KK0pp  0X KK   0X KK  0X KK 0X KK@ 0X wKK0X nKK 0X cKK0X ZKK0hS0{@pH0lS0pC pA  0X BKK 0X 7KK@ 0X ,KK  0X !KK  0X KKt  0X KKi0X KK`0X KKW00X KKL0|RZ  p`0 5ppt  Pd0Q0S  P P>P0{  -LM0@p`P*W10S 0 5pP  3ZP  bX5pD0 u5p ~p -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  hgfff0 p-LMP 5 0Ae10T0d1 P40 00p <00c1S1@0`/@ꬆ -@LMT( 4  10Ah4鬆 -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ 2p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `c3@T \3Z@S0ph@K3<?`@$E3 0 1pq -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4"000`0@KP X5\3d1`/h-<@TLH^ 0 K00KN<||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! !/4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 Ku`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???| <A8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 pO*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#ꔯ,T4\?aCoc?`(?yPD?< PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `$hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh$` 0 Q 2RhF0P13P1 <2 ` -(0(   %P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 ! !M0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 00D0PPUl 0 0 -LMP@ `l)\0 p 0p^) -LM00@S  R 1S01P 00 0 0 S 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00Pl 0@0000 P @0P 0 P<0S0 8000^ p-LM@ P$K, ,0K $0 (` ` P `Rp -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000P P*0P` 0PU:P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P 0 0e 0  000P E  P0g0,0 j 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000 p-L M0K K@C 00p!`iPUhC 0 SP P000pP` 0 0 p p p-LtM@PP`K*P0@: S  Q  SL  p( 40R p; 0p0+ 0 p -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 #Pp0S# P t -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 p@ 0E#1, 0@St 0-LTPM@KT 0K  0  @@p( 0-L0MpP0 @0 V&0SDK@ 0S ,Ӎ00@@B&% t,@ P-L 0 hUi 00h*p p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`8R @0S R Mp-LM0`0 @`p p-0LM`KPP $ 0!P@  R 00RϙP P0 0<0@0@ $0, 808 `(0  ph0 0H -LM@TPP/0:0 p-LMP `@0 : 0ph; -LM@pP  0:0q0:09% -LMp` 6%\0 P@ uP@$% -0LrS aS >h0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  ep  V KA(P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 g0`g`g`U}$g`Z 0S 11 !A/J@}t AT O` 0R00CS  @0P0(P !D010CS1!N1 fg`cg00P  da% P0-PL @[0 -PLM0 0At 08g00 -X1LtM@0 00 8p̠ 40$18p` DP @ V KÉP H hU P0S400S 10SQ l `0QQPf00B00S 0 p-LMP@4KP+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@&0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP pD#W0kf0pywu1`fpn10Cs1 1!0C1c10Cs1\Hfp -QLMP @4P  P P0 *f0 0 -LBM`4P0 0  NKQ@pS0A/pp AP@18!0R@T,JP eO00e0,1a% -LM@S0 h;e00,1 -LMSS@0  \h!e00,1e0 -LMR@ 0 he00,1e0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0PPP 4 80oP00000@ < =P 0Q[PH@ 0S 800 0 c 000  80rP  zP 4 80+P  lR   R< @0P`p(Kp!   ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( Qd0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP   d P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"c@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ $ PP    P@ 1S0C1H 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0;P @-0@0 @0!00 Q'  0R!' ((''''' 2 2 2 2 2 2 2 2Q 0S !0S: 0-PU@L P :^ PP * 0}` 0 0 -LM@PU 0 0 000 0\0 p`-p  0P 0 -LM@PU 0 0 0000000000 0\0 p` p  0TP 00ܐ 00 00ܐ -1LM@h p R 0#P' X R 0#P R8 Q5 0#P: 0#P  0#P* R 0#P*  R 0#P:R  0#5S  R 0#P:  R 0#P*P P0 0 S0 0#P:  R 0#P*ꀐtx| p-0L,M P@ w 0< @8 p 040 0@ k 0,0 (P f \0`@K $ 0 ` 880 00AR`pd pؐx`Ȑ 0-0L(M @RP#0 R0 < 6 |08 4 0 000 ,P + 0(0 $@ & @0 <K 0  0%pؐx` -L$MSF`2 p< ` P0 0(6,& 0Q4 80 P8@r n x"4@0Th2@P,K8 PhP@P P@P @pWm,P X`pBU 0#V < F* 1Š P,P @,0p, ,0 R,00,00,P V0#03V00St 0 0 V( 4T!L   000 0V,P @` Vp,@ P@0Y:0 <@i 10,P UP0  V p8@ 0@`040@ 0 d"6h0< P@`0K p< 0p4Pg1o^ 00<  \g^< А|tx -#LTM0,0 U^3 p R`V V @TQ 0SN 匣p<0C>S񟗹34244344444 444$4444,44444<444444D44L4444444T44444\4h4p44x44444444444444444000@ 0S`VLB0S<2  02 P@0 2p' 2. 2Ύ 000 0 00S 00 6 0]pPPl1 ,0S ,|] 0000T1LQ:0@1 14101,1(10p0p0000000PpPt p~lpK? P@`&yV0@  W^Pqp @ Đ|tp%%%&x% -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  ? Z&fQ *6 p,K(2,  R 2Pi@0T1 *aP,0@ 0, PT1:0S QP,0 0, P11 0F0 Q 000S P!0S0 0 v P  , R0000@ 0f00   R,  0#P R,  0#PR 0#P L\0 0 0 ,0 `ꌐtx̐ĐԐ& -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p `tx0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0w &P`VP@@`@P3PꈐĐ - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S  # X,r[P 00T bpԐ0& -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K72,P UP2 2p\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 c0GP@ 0 ZR Z 10 % r P :#:S `5P PU,P ; @$ET P, UU` !@1SpWPU,P   @$ETP,p U0 00 SR0 :JR|0 R0P@   렐pD&d&tx&Đ&&&& -0LMR@0 0 80 t R h:#:ST,K0[,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 Y01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@ThU -LM@\Pp` h^\QU0SD R 0S=W00  00CSYYYYYYY ZYYYYYYYYYZ Z0 0>T00 1 0 0 ;00 0 0 R 0;S< W  4 T 00 T 0, pn@- 0-LMPK 00%0 @( 0ST 0S @S 0ST 0SST  ST?00 t100*2 8P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10 -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`@0S  0Sb RCA 0\R! B Mp-LM0`0 @`p22**"*xx*JJ** * -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b} Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ (PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , ,@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40PoP P0 00S"P@ 0S 0 00S 0$P  Q p-LM40@SP`$ 000`!H 0 +Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pip  P eNO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1  wM001  nMd@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S( -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h%}` -LAMp0P 0 MANK0AnK @D `FS@D `F) \0 0  ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6lessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostname P@<h@@ỏ t@@0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputȎ̎Ԏuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseȎ̎Ԏmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track  4,<  ĩ̩ ԩ CT̬ܩ: $ , 4#<3D#L3T2\3d3l#t@|@K@@ȬЬج  @(@08@HPX`htpx ĭ Эح (08DP\dlt|@@@@   Į Юخ@@  ( DC$0C8C$@CHT`lx  ȯЯد@@ discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.105 2007/02/24 03:33:27 ray Exp $0XX<DDp\{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#e1؜?EPfadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.24 2006/11/17 08:38:04 otto Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d oc(clclclclclclcblblblhlilamPg mhmnmn mpo(mpo0m@p8m@p@mhrHmhrPm(s\m(shmsxmamb|mdmdmdmdmem em4fmT_mcmcm cmcm@cncn8n`n؂́(nP4nP%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_aliasprefix %s: %s%s=%o%s=%xusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%lld%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offȎ̎Ԏ|Ԯخ, <@$  @ĕbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjlO6Ul|6Nfc^*!8H-AQ~&9}X n/Gc|ڨݵBŭLR凚~2~g|>^z[[xȋb/֞~ʼn}Yld^Eb-PLC%6yλO}7 ;T[oGB/3/y̼ۙx3/yj3O LYy+LY< <zyt*O<ڻ3w B@ѽw4>X)c!HdxʅU\(s{BW _d !< 9OX<Q u fi2ibE[o qC=PBoT/ߴ\ρܑr4:>pB`f/$3"'%L̕$HEU>jfϩXh}zAC蛛Ow"d[WV,ē+d,qV ߨ|TBL1wggK2?p;0l]ͼO33̻: =k:8kE0E8PDT\aᖬ9^; #!@'d~VVJvmA$ I" ;R7d9كv!@*T|smx-M҆Jtg2rɽ?"qc:Ku zozi{çסFVI ,BD !qgȔ66X#6 uK EcU`'sݑHxRF%C?zk=kUCZk1vPOFf?H@;!OdVZ۰ɛ,j yDQO6F~D`U3LZ 1%6nj3%{x1J G5%vM8gx>f. 9I#m]x|CehMt C1.*}f R|B8@ހ ȵ>x^ f'p 9.Vg5g0Xib jCFCوS*Ăvl9 1 ӳ?ė4؇#E_O,-s Dj>o0o.aم[Ӆ1s9j鋝ta1!x8|6d #ĩM/h? \pG[7L@ /ǎ,K$a"HC!r2 ͡X7p4fy.̯xjA719 U4܆Kv")~t@2'ӌ) neRT3)+ $G'EvBıұI@of߼L@^ȝv}"vfOh<>8ٻp`J5[QpP0SvgenJ XBI-gWqFBx1 ql䴢lon)Vi].Q#FA+ rH0!? cak48T{j nYf(1MF{=.eVX#9Kf&}Q:JV36qj.NRZ@O!0UK59GsNvK:@̡mI81yxD W\>?U&(+W\u-P[YO?Bqc<ٺـsUoN즨b4\YJ X[-[u?!=a 9"9 iUBt<3vUsgZe՜YihYᬣ,zv߱ѧuqUP:s֙tޤq8,G؀V_w7v @n6jNo/̮ ] Y;T gFH)q+gE.C28,YBTݭh}5-L+hlWʋkڷf}'g$J>A GXWk43\ձa:-݄JAȫNf6cpu:c6,_fnއPI? > %F9mПb˫mBGI DxA:,7bc΄?=&.rO#ڲVXu &QPËl0OƠ Q0'}uzG9tǯ>>8Xx8 y鏆yf UضN/5&?=v XӚdx{;ofxII?'3x<ΤFru;/L S|8QڢͫT?768,"lQDj&7s-Vh.oi$Ί揬\R{WdKBoTj7>?BbbV<#8Cʃ+ֻһ}y5:r`6"/KŬf>i"BzS5xuROXU;X">m.Wj.~dG)Z+6jqzbrmuPM|N햹bm dphSk _KeS8Uϧ%/1n1Jn:Wb066 2LQ#JwgEiP4wGu]5뒪eG!=fĚ4Tֻ-qi8+ll ۴+X%GdONrmۖkvp#ռ\QZ2~ JmZa ģn*JFܣnJDZ#L*+N?ӠN* 1[c) 6Y\\>yK=Fqĝn9_GShoH+UZвnRW}eBت1 %/} נvYJoH$KP?ڔ,Bͻm|lJuYY55WfGnjƉ0Ѽҵ,sZ.{Z)tmdlwbWݩi{dfOQ5کuZn*8F(WRw'4F3-VQNF"{ƕ V /%,_ ŝ^YM?ҕhAA RP%_BAQjm?{6{X%a}gwF Dq{NelH=Ƕf6]/h7w<6$߫ܫCS=7>z| j6ZPާ[?>\C f E#L\3@Qo{q4+Ңku.Q8@8'4/oJ=Pcդw7i@qJTxbu 5 ӓ3&͏F=L&:y\GaBOtl@MCsMXO17YE4{"=0 :NE *tڷ[h1t刊tc]8 p^ K\ÂwtIk\81r2.vb4>G!/(D⇟ Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFOBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]Ȏ̎Ԏsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p  x}}`}}@}}}}x}}}X{UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [ -T tableid ] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, table %u, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s:%s): Name (%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] Ȏ̎ԎL@p|4reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node  "22222%I223 { 3&n,3#43|$<3D3L3T3\3t l3 x3!33 BDY445 5555055D55P55`55l55|5555ܛ555555h6h6,606ܛH6 X6p666ܛ6h66h6h6h77,6,7hD7X7hp7 77h775757x75858 08@85P85d8|88 8 88889ܛ9,9@9X9xp9x|9x9959995959595:5:5$:50:5D:5l:x:x:x:x:x:x:x:x:5:x:x:x;x ;x;x$;x0;x<;xH;xT;x`;xl;xx;x;x;x;x;x;x;x;x;x;x;x;x<x<x <x,<x8<xD<xP<x\<xh<xt<x<x<x<x<x<x<x<x<x<x<x<x=x=x=x(=x4=x@=xL=xX=xd=xp=x|=x=x=x=x=x=x=x=x=x=x=x>x >x>x$>x0>x<>xH>xT>x`>xl>xx>x>x>x>x>x>x>x>x>x>x>x>x?x?x ?x,?x8?xD?xP?x\?xh?xt?x?x?x?x?x?x?x?x?x?x?x?x@x@x@x(@x4@x@@xL@xX@xd@xp@x|@x@x@x@x@x@x@x@x@x@x@xAx AxAx$Ax0Axpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory TY\Y`Y[lb dh] `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@L]\]DY\\]]$]4]DY%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.19 2007/02/08 13:09:53 otto Exp $$OpenBSD: inode.c,v 1.28 2007/02/12 16:41:07 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.29 2007/02/09 19:52:32 otto Exp $$OpenBSD: pass1.c,v 1.21 2007/02/12 16:35:55 otto Exp $$OpenBSD: pass1b.c,v 1.13 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass2.c,v 1.25 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.15 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass5.c,v 1.24 2006/04/27 02:40:03 pedro Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.29 2007/02/16 08:34:29 otto Exp $$OpenBSD: utilities.c,v 1.31 2007/02/13 20:37:07 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %ld, offset %i, size %d blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZEILLEGAL FRAGMENT SIZEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKcatchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.23 2007/01/09 08:37:44 otto Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.10 2006/10/09 00:23:57 tedu Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty@H0% 8 < D H T X3 d$- lp/ t, D  x  ,+  . . A6 h̷l< pt7 tR xF R F C P E t7 E ĥ@H ̥7 ԥK ܥD = > R t7 Pb \8 DI hTQ -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$|ئPܦtfcd$s4lHmXnp  , D XХ h0 t    ̨ ب \ $ ,  [D T   ,У 8 D0 TИ  ` lȚ x܋ ̔   < ĩІ ԩ    ܎  $ 4h P4 l |    P@ < LP ̪p ܪ   ( ث hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD(d!++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():(@LXIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }xdd@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $`alxc eiGklĹX@|mйCnܹfbuphr0xIshv(0<L\xlet$, 0 ȼ ,x 8 @HCL{P}TX\`dh ||&&!()!&),]]<>( (d06 @  L \T`lt|@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s (8TlResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u8 ܫ (,4<DL8T\Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR20(4<HP\lxnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem$0<X`l4D\t$0<X`l4D\tHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanf b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call   gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ $,08u %<HLlp     $ (  < D X ` t x  <            ( ܽ DsG $ 8 @ d l p |      !  "  , 4 P @ X `   d  e  f  #  8$ INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/` "("too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log                (4<HTX\`dhlpxJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding <Xl,Pl0Lh; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH,D`p`$8D\ht4DTl|<\|4d| (D`x  0DXl| <PlUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium type$0<X`l4D\txdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)ģaṬbT@H0BTXPxcTPФdTA4eT0Lh|fTpFT8ХgTh @lhT4HA`iT,0HjT$pJT!@ħlHLT\ܧmTd$4nT"L@XlpTHxPTqT(rT"$HsT!<ST!|ЩuT" (VTwT"t@dxT(pЪܪXTAyTT0HzTl"T~T!Dԫ?Tp#T.TAl(8 (press RETURN)... (interrupt to abort)P381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUgd4xix\^d$_Ta 8xh@(hd,xe `fgggLgH\0M@AB:CDE(F8GHUPV<aXb@cde`HflhxiLlnqqrsvwxu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.18 2007/01/28 16:23:58 bluhm Exp $$OpenBSD: mount_msdos.c,v 1.21 2006/12/15 12:48:29 jmc Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $D@@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.15 2006/12/16 08:49:18 jmc Exp $2 l ܩ ( 0 D Ѓ 8DHpnxnLPX`h@|t m|l !"|#$%&'()*+,-./DY,Hl$Dd pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL6XuH`hph0DYH4LHSH@ HXHH@%HHH?HtC|H+HDLH >H@,HClH$*lH-<H0H@Hp%H?HD<H0DHH(H) H%HH(?`HH,H8RHT9H0HxM H.$Hp2HH9,Hp2H0HPH8RH8H@HQH0HHdEPHCtH0H8RXHK`H)lH'xH'|H\AHH8H?H;HH<5H0HHLHt?H:HQHLtHH'HD<xHPĩH HHKPHlMpHH%H H>hH7HP'uHSHd p x  @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.28 2006/06/01 17:22:14 dhill Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.17 2006/04/25 15:41:07 deraadt Exp $PH$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $I$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $JH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.32 2006/04/25 15:41:07 deraadt Exp $DY$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $T[X[\[`[d[L ... ...<DHPX`hpx<o $t,4DYDYDYDYDYDYDYpDYDYDY0DYDYtDYDY8ubbbc@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.39 2006/06/22 00:25:22 deraadt Exp $`F $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.52 2006/03/09 13:35:02 pedro Exp $Ȏ̎ԎL@@@ @%s: can't read disk label; disk type must be specifiedxTx|xxxxxxx,y\ylyyyyyzzLz|zzzzzz{$OpenBSD: mkfs.c,v 1.50 2006/03/09 13:35:02 pedro Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.20 2006/03/21 20:28:52 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $  ĩ ,Xp@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.18 2006/03/24 04:17:26 ray Exp ${}abcdDgGhHilnNpPqrs tw xy !:#=tt Pxdxddxx(8PhķзX 4ؔ0 x _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.17 2004/09/16 08:35:49 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.33 2007/02/16 09:04:34 moritz Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $<DHPX`hpx<o $t,4DYDYDYDYDYDYDYpDYDYDY0DYDYtDYDY8BKMGTPE@5MS7) xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuuTxx:xx:xx:xx:xx:xx$@LhxK$ @L `l  P9  <HDYDY$DY\DYdlDY8DYDYDY$DYDY$DYDYDYDYDHLPTXX0\`hlx |         $ ! "0#<$H%X&d'p()*+,--..//0|-1234567 89 :;(<8=D>X?h@x[\\]^^__`{{(|8}D}X~`D&H&|&$',(?DY<DHPX`hpx<o $t,4DYDYDYDYDYDYDYpDYDYDY0DYDYtDYDY8  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzT0123456789abcdef i0HH H$0(v{{{L|{ 't*(*@**x*/.///d//3\345L5\55234445L5\552<:<;;T<<t=$>>W 0000000000000000}`$d%%t';$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt$$$F%ppt_+5 >C JQ  Z  p _ f q44~ mya  un}of!NI u p + & H  H _hoststated*YYHostState Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X S   nobody*Unprivileged user/nonexistent/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"yt:5 _ Z  z u , ' _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hoststated*YYHostState Daemon/var/empty/sbin/nologin1_hoststated_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 [ V   E _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_hoststated*YYHostState Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=41 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -g0123456789abcdef(Xe)8///0(Xe0Y+dc+00j+@n+(Xe,\*9+P+PJ+7+|W+(Xe00t00d0(Xe:/0t00d0|///(Xe</(Xe+dV0(Xe,ȗ/(Xe)n+00d0{+(Xen+00d0(Xe000d0|0`(;Ue(Xe$>)@\v/v/@2X Xd$`XeXeZeZeZeZeZeXeXeZeXeXeZe ʚ;5ym8@ E82(@AAA==(A*\XehXelXexXetXeXeXeXeXeXepXeXeXe|Xe`XedXeXeQ ZeZe A;Hhx.;LhA;PhA;ThA;XhA;\hA;`hA;dhA;hhA;lhA;phA;thA;xhA;|hA;hA;hA;hA;hA;hA;7g@0A;7gt0A;7g0l\e`B;t0\e000D; 01811 1L1p1$8,8<8L8P8d8888$8X88D8L8\88t888888(8\88Į88,8`88ȯ8808d88̰80t11\D;Լ8p8x88888H88P8P8X8`8P8̿8T88 8 8P8H8м8h8м8м8D811481G;G;H;H;(H;8H;HH;armish141ʏ%%%%%%%0/%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%2x2h2X222%%%%%"p""|"P"X"%%%%%%%%%%%%%%%%%%%%%%%%%#2 &2`'2,24232%%%%%d1111$22%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%v#Xw#x#x#x#x#y#%y#9&% :&:&(;&%;&%&`D1D1D1D1 H1%8%G1%%//%%%%%%%%%%% &%&%%%%%%%%%%d]%]%]%%a%%_%%_%C$%%%%%%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%8%%D;!0A!C! D!D!`M!`D! &%&%%%%%%%%%%%%%%8%%%%%%%%8%%2x22ܹ2X2%8%%%%%%%%8%%"p"x""|"%8%%%%%%%%8%%%%%%%%8%%%%%%%%8%%X((Y(Y(d\(](%e(%f(%%%%%%8%%#2 &2H,2,2,2%8%%%%%%%%8%%d11111%8%%%%%%%%%%%%%%%%%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%%%%%%%%%%%%%%%%%%%%%<#=# >#>#?#%@#A#`t#""X"%"%0"%"%%%%%%8%%%%%%%%8%%ؓ##̛#Р##%#%L#%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%%%[,[,[,[,[,%%%%%%%%%8%%%%%%%%8%%%%%%%%%%%%%%%%8%%%%%%%%8%%%%%%%%8%%%%%%%%% &%&%%%%%%8%%%%%%%%8%%܄##~##\#%#%%%%%%%%%%%%%%%8%%%%%%%%% &%%2X22%H2%t2%333%3%3%%%%%%%%% 3| 3%% 3%L3% 4 4 444%h4%4)4(-4%.4>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy;2 282(24et:@;D;H;L;P;3P3;<W3W3x`3_33؈33d33 3<33܉33303\33l3USB audiouaudio(;ȣ333383$;ȇeЇeeeee8e@e(ehepeXeee  eȈeЈeeeee(e0eeXe`eHeeexeeeeee؉ee eeHePe8exeeheeee؊eeȊe؇ee eHexee؈ee8eheeȉe e (e#Xe'e)e+e:;;;L;3 33@33 J$  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  L;`;4d44 J$9;@;;;*<;_4;b4b4;;`;# # ;;;0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-`;{{$;@;D3555d35(45d1515;D5@5pA5>5?5X@5|;8Q5\K5M5N5P5;PZ5U5,X5X5\Y5|;e5ha5a5 c5Td5;`n5j5xl5l5m5;r5;P;;5 J$;5x5P5555h5d5̦5l555;,; :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  0;@;P;d;Qx;;;;;;;;0;H;H;6666|;@6l666;$"6P"666;L%6x%666;p(6(666$;D.6.666;l061666t;H56t5666;96D9666;:6:6660;<6<666L;?6@666;B6(C666;F6F666;8H6tH666h;8R6dR666;V6V666T;f60f666;i6i666;m6hm666P;q6q666;}6}666;`66|;,6T6 WD2?2?D66H    |   XD31  F7XG7H    | SB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB" X7HY7Y7   | 6ԣ6<Ш<ب<<<0 <@0<P(< 4<08<00<<3D<5H<@4$<EL<FP<H\$<PX<Q\<R`<Ud<Xh<al<0p<3t<5x<@<A|<E<F<H<P8 <Q@ <R8<Ud <`<b <c <X o7o76.2.9D%K5dZ75f^en&w&h85==)\0 0lE=\"<$\h5$-=#4.*7[)pE9QP'D\'3l 0d|x*%XL=j:<pE%x8heed8<?6T16H= 0m"(Dt54X3$\>L%3LTԪ!`iQ)<wf/$,846,@$h()33:#D<8<e7<'H6=$D&"8. u0;AA=R 55_R3Xm3#D84+ `4D-$@M=$! hE=  <t"|(65x@v/DP 4=PVT6@fLu#@u2(D"#<#$ "eК)4E,x8(0"(T5d7/C$$<K؛eT<88cE=t"}P 6`T 8P9H=d(H7P&Lg,2Xg `gA' gg$-%h*T=5#450J.8X' 8g4=l*Dd}%dP'T<(l # #8&* E `Og[tee"|( X54.3@,*!x%g"\`9HР#=@0,L=@=@L=Ph[l&hhy,0y&<x.8pf3$P83#dJ \-L)c,#08g ēe =X*3$=H8VH%h^K5,iD)v\5x\{0ti4i:3xtH=(Y(hlJ3% d$\554d&B=`,4h)5Hw<54E3$H=55$3D *L#<M$2؍gO*$r1D0H.9L;=F+"]<$$f64Tuv0XtetO.@33(dlm(|F$l'15D=/= $tg",g!H7L9B,'ND41\ievhQ*x'@]6t8"lḭ8g#8.603,P7#h)B<"=LNP4X2d,qH!2Le<3PRĀeYJ=h){$T74,=N=F,42)62\1@h4= T 5$+g:dgPH8W-MJ=[ k5iԪ2$@z*Hy'8)481]#~%,=,4g;( L6<+(,%x82Ef6S28`h h=|J5.dg6/@2H0(T6_5pd4$$)<.eDh0M=& "&[,&-=&y#&=&8'PW-  'P3P'̇1d.'Q(?'1tU'$~,b'*3Ly'20'-'3#'(':4(ug(C6  (5h1(\Xe@(p.N(eV(44``(gn( '1( (5d(#8(A=(#\(y74(p;)x(d*3()(d/l)[*$)u#h6).(F)$+T)܄"4n)-4|)&)e)=)lO64),4)0<)#)!)O P)ؑ8 *4-'*4"*#&,*-==*d"!M*ia*X4l*_)*| 'L*l5`*l71*h*:),*4e* *6`*|t!H+6+ &2T+7=.+('(C+3tT+t@&_+$k+$v+4##+.+,9+$,+2+h+|.+D=+D$+c6d ,`f4 ,71p),P,7,lL5dJ,42\, 8t,\#,=#l,<3,$8,О.l,"L,!,(T,58,j2,(Q( - i-|g#-}10-b4`?-XeW-v$\`-p*po-x_5|- 8 -XQ5\-'\-r2- O1 -M=-g(\-`$#-"-4$ .D..38).i 5.hJ.1HR.hU=^./ k.T,=x. 8...`$L. .C$.$`1e2Tg2,@  2x>5P-2DB)<2H=W2l$l2P7H|2 24}342126423H2$ 2J'2(!82 2N=3('3e337(M3",b3 j3`l/v3W'3v5T3l6=3 23#@3["3%35$333Xe 4<-4tL="4264l\e?4,^!N4 <$\U45b43m45&Lt431`4x8446`4P24e4J=494+4g4&' 5"'54x85@>2d@58S5$[5#g5@r2v5.X50l75`y" 50"=5e5i5T-5"5H 5<66"`64!6Ȩ'8.60J$96+ J6)0i6.w696I3H6"6tm/6"6)\6X4686'6d3=745`7$D)!7`|e)7|J" ;7T8N784\7R4f78Ll7<% u7\*%7s5\79 7&7x67"x7LL=7#P7P"0858XU=8|-,8=E8/#,a84k8c4z84e8\R=8pm-88_484g- 84'8<`:<8\!3`8d6 8$* 9(8$9v)!9x% ,9`'T59&!>9 iK9 *PX9'`9Y7`x9d49X59t0D9i5T999HA4l9$&`9|#\9pi9g93:g:[=(:Xn"p#:=-:,85:$A:1#<R: hf:51\:3:X'):<':#0:-=:$D/h:l&:<.$:L2.;";#;Pu& %;H .;k%7;=A;-* T;Dg[;4\j;L"0;3\;00;(;l!;~e;3&;2(;));T'X;G$P;=<D#$<f4H <|H=0<g:<>%|G<70Y<+1(k<f& v<P3$<3<*p<$(<L58<2<A&<'<<7<<ȯ8<-@=00 ='=Р'x&=<9 2=t::=t E=p)1V=, `=F$tl=d!H=L5=4=X2p=.=C/h=48*p=R!|=De=8 >,g('>،8B>$N!J>P [>F7m>4w>t'<>x>%h>\/&>H=>P&>\^:T><->8!>@1=>lt:A># ?e?d"$?-=)?4t1(5? "I?0eQ?d.Xa?8q?7?Z7?i?|2?g?$;$?p#L?x9 ?8h?D 5?/=?2?5A=@`6%'@Xe6@D*HQ@~e`@h%.,m@%s@'@Xe@$=@Ue@$[1@Xq!@9 @`e@+X@4+@( A0$A(3 %Aԟ57Ap4FAx.XAB7jA2LwA[,AV!AxL=A##$Ap!tA@3A32A'AD4 AP$AT:=$ BK5xBL6+!BH=)B M"H7BeCBd9xOBX#4bB1lBS(H|BM=B'%Bd4BA=BX;7 B3LB=HBL9$BDMgB4eB54B,= C"CXe "Cl?&|-CDU!8C^eAC.QC9 cCL inCt-wCO!<CSgCz'C.8C6C,%C؝!C$\CT5xCd:"C}2D0'D("41DX29DP-JD2@UD6PkDe zD9DP7 D#5Dl8D0%Dm%DH5D ,D 4D0E8EȌe+E8H;EY5`EE4PE`t: ZE#pjEa#zEiE7TEȯ5DE3E@5E $EhEj+ E%E0]*4FD'dF4`)Fdi4X1F$,BF)h\F,$fF0"PrF ((PF4'XFgF\e F=*F8F9 F.F|$F%FL $F4pG̩!\GH6*G#6G )TMG=XG\"cGLa3tpGܲ9Gh3lG"GgG,M6@G4Gd&&G #0G iG/=G=X$<'X274X؀e;XȊ0(FX" ,Y57Y8AYI= NY4V$LZY04deYXx3|Y#<Yr"8YD.6xY"hYT4XY9YD'Y'@=x@4$Fx'0Qx@-`x ,'XjxP&tqx`gzxH0x̊-Tx\g+xl'$x= x!xnhx'x43xH0 y -y!H!y44\+yg4y8(>y,iOy3HYy$!HmyXe~y(,y@ yp.y1y#4y+Dy2=y5Xy1zhQ/ z* (z4t4z(:=$Bzy!Qz$]zЏ#<kz8228wz zh|ez-z؄8z5tz""z z2\zd8{@M1{Ԋ, ){**(7{HU=B{."xY{ d{pel{34y{L#{D=@{P30{3#{={3{2'd|G$8|#"|d /| D#:|84H|hU|8a| " q|5~|w!|"|g |8|g|g0|'|hg|-||E=JT.S!=Zr2$l*<x1$&!tl3„(ʄ$@؄\8th!X5, l~1P8+P,;H=T._0iu-=|$T>=(`M3 '…&Ʌ$$\Յx9 `eh&G. {#x dv'P3T g)`L%86Ċ9A.=Q i_p9=w|!8gw)8†<2Ά<%,ۆg'~e@f5 c54X5l@3+%?ذ$(Fz#\MP4|[ik 0lwĎ"e37+Lir%DLJ!և\S7x5 e  D2 h2&!85/Bg#Oxl:xk-|ym6X],,8#@#L%6,TU.=ƈd1`͈S+ۈ}44ؚ2 (,D  ~eؓe$8"88l4D'DQhaM,n09x@g)l %tT24HT*8‰B48҉pe܉"4I"I)l %`!%L.l3<$@x$#Rl(x\>5g(x%\3(e7dĊ41D0O=$L,\o(8 G&؃4'h2<+C#TO"@Wugc4H=l%w85`2$P1|#\9k(x̋`8ًb),g"Hd9!$@2"#3)"pJG4<W1,c8=lx5 y0B2Xly-@%%$8,eX6Ōt2،I=.= R)4" d H!%(Ԃ$0d)\@U=(M3=Uȩ'D^$B!hDO4t@+X$g%"e TXS3@ȍ$1ݍԚe3(h-|g<,)(Sg9V6,Ft56S5dDt-q"x (,'8I#5z58 /(N '@X'%td0"yhe)\ 4<%HI$%țd35՛',#g܄470*3H8.=Ms%tZ4_:q<9p|pn(3'L@"1Hho18tJ=T*Ȝ0J=؜L$ޜ"hG&  e8\E08=(4(<.̿6`@X9H! X̕"c}6,p 5y 3D5\'<_)2;(ĝ6<؝4h!xi'P9 N4\(Xe450 21H$Qq!@b.ts2xe%=P2)HΞ30ڞ`A)6`<" |(8El2Q`2=aC=n4$wP8lB) #4_%pe0̡h2=ܡܺ8%0tF#`б#P ,G('Z.6;(HDx= K8HO5^ '3wC-Xp8X̌1(P04Ţ"pӢe&4ޢ2L,Th#)xD1'tiP{1' J=3#B"pVh23PfiqD-, D,=@c6d,I38ˣG#dףT8<.8`c4 [,,*/5:`n5 J0gQ9h]p(h%(wg}%L30g!tl+-Ƥ|[*pդ @p(6,$"6,H5O=l#"2ܰ(TA7=V4m.=~ugԛ6'2̥@Mgߥg?#P87x5`(M4\p1)l-;d2=K g0T62L[3dl=Pg88G!2 864<˦#ڦ 3<"0"LJ)#,86hJ*-Wt9,(jPg<s,1` h(8&T99  & `E=(%Ƨdgͧ=&`4=583,dS=x/3EXeTt, f8u )3484Jx(X'd(!\z(02 N `2 _:lҭ,=}6\*7L'L8&lз!' 3:H7JX1WC,h'tq`"5v-D&%t(!`ŮHe̮%t֮0L"6hXe,L)#d)e2h%d<h*pL4pYThies)Lh( P4 ;+P(TƯ$ԯܹ,Hm$pJ"tx,'Ћ( =p2!#p,##t@4hT|/`1<yLO=g+2Dm23@5=$D"\D-l2h'd2Ƚt1ֽTH)HX"2Llg0 #0e1T-hh452A6R1 Z4c]5q(l}Ԭ5@9 (,F3,d]%$ɾ:6׾!!|&*8Lh \8$(p2d)/5(`AL8F9*lT(^PL0mv$8y&  #< 7=$teأ53\пgܿ'LH iiD-D |W+ت'D t 3(j1 5$@AeM`.3]$Ln"|x#h8|!\X2Pogi*)2@3 @=%xj:\6T%\?heI75HYD%4xegqx-=}Ѕ"4Le,c22!LHv7/=!5<pH= 1-1p>&"=)t3<48R|2Xa'Tl$4w(z483! H|)F'd\6]:A=+ $5' i9+l'|"$:73lGw-U@0h.Tz` dL3 0*6=gM='|IJ6P 3-5LJ= Hg77)'6d&(ED!Vf&g33} 3(02=8L ^,<E=(0H,2@Xe%81#,'Ht4p2!('T,v46 -EP$ OO'H_X=o,3\o(-=10xg = 8)h@9(8 R.<53T(G/5h*C'P$h^p'fi= p8(yX[/i"|D64ih.L :&d#ԫ6<.=(5<'64'1%`2](4;7%I6h'PȠ'@808- r2i[,6t.X49C,I`&X<8cp$lk(}'xx84\M*HH%$48894"PHq4l1L4 2|-+p+1(,8"L0h2T]tP" gD;!o(6d3T)0Ȼ6(8?2p3p-=(5D4 3\51\W$l"02@*<8m'F-RTc)`aC=mW!$w , h"c,ȧ804p0$/L==(P+3PX<#H"41,>H=Sx4\58m(lz88t22 V5p((#l=|K!,.=$"8D= #4 ="i2I A8= V2ap&`k1@z5'0$8e5\[%=)D|,$HTog5\x2Hi@\'!x5P3$,A,*%0L1TZLgb8gi& w0/1x1H30<# \X-*tpg2\lH.@L0!@,l( s:di"@%,L93X#HĂeQ76(_D5ue~T8W,LH75LI"Tg(;=$'Dk/`HW-(,LLg%$0ԧ28A2T$a40 te|,3\lD-7!LD&(|&(=0X48.h"*X3ؔ//, @6HN|w4$Wee=jHY7\|<1=e"(t1D1g#<-"+` eJ=,, /ķ992LNx 1_d+q.=($$iW(e/((4lT7<?-U50h8!r6 X/&&P|(d5%@8=$QZ,^g*r$&@{L&@/G=p'A%P+D#Xt!`"@Q4T5%  'i;<~eHI=Og(\%8vT43 p6~e1=#Hogq"\(?3H( # |# 949$LEt,PL=`8!n'(y'HeO=$C=9La5%!7/3tM!=%h2d $#49 #r5D-}2$>,JhM"_X*f$&$8t~8l{8t44{2,8,=@!553D8-%T"40D8#0S86\j1&qe{+h" 84"04`=p8`1$*(<p\"|5$#%D-P62,B$tO67fp2y 55gUe<F0D=4N?=@]\eh" |4!,d3P.dB7h4)8Du3Pgg63(&L3844 C5$T4^[6l9P|36#O=0<80f6,Dh4|'DE-<p4=PDu$l# !9tI.@BgO`f%Y-b 'qPT7<1\K.Pl4)%(.(d|^gT3`)P g(d15 |/P+ 17P8J&TXHr%l@O @},3H0[*L<6wgTU(eTt:hgTJ5l.8o#<p8(32( h@\ IgQH$@d̅"nxb4{=e*X"@j3`+j50p 0PP)eeLe i:T d4*O 6І,J8'<W`9 c\.m8=$|, 2&8M%0eej7\$,\%" 2) g:?$q5I>%hY@8`La,n%x}'-$x"l$H4/45h2P#6 .3|F,x ,{* !02(:`m&pGP.=$`\Y5k$y$~e4L9 ,eL3Hl"H3:6,N5xd6xd5$h*#($426!d>`W#Im <V|.gJ1uP7ht2`o*0E=,#485/,(:,(,=%XZ#082'66Mk5YP4e" qf)`~H89!,!X7n5\܄#hN&,#(8\0"!X7`2T1Ah%N1|[geĠ!u2T .Lii.(<"h44)X)hHr2l<'d'h #,4t'10 98tI,@ [ee)7rX#pl'06H,L$x'"L0@Z)x'4J=z1x-4 $+5x<V$dI8QieA=q$d#(D_#@8\4e|H<2$I%Dj: 8,-$:&%1,t&5 :2P 28X@93d4o{%}xg`4XZ- 9 3d!tNh8[Ļ6mĦ/"#<_59go18r)D2l/ #ug"89؞*DO% Rp"ZHl(dgmč#@/#0d' 598XT&d38T4`Xe0`,&t29v. N$S<6,_ ,t:=$8Q&\'l8601d' U0h8^.u*86&.t5j: J\,U$lcĎekX)e h̦5P8h;0  D-\60=i3=6t5(43@j.`A#-dOċ9X2nh|,,Q55H Th3dD-g|$0.!e b2D'D$H-/E=AE=NDv7Z'e#r`7 &xxz#8"$6gB&73 x7%dhe 3&(P 486,$E=Ca2SD$pc8leve3^e`+%2p(!`n6<&x44< ~ d*l:AeW,j@04{؅*LC&.=x8d 3 eH=<#p"HL*3/L#BgM+T^|go3=yPX#2h}-L0\x-DTB3'&$|"|\S! &LL#%|"-"p9x]/TE6W+kP"}`58N4d|+$Le2\ds/|)4L^e 6X9*e8W%Dp. Weed2ty\%|T't+3T1"0A!\e,$`&4r2  4 ' Xe a6d7 8T> b'xK D3tX 5=m :8 ,= @+\ 8 5 =/ \g He |e \$0 9  b4t xj(X X,# \3/ 0lD $W3T d3_ \hm "hz {5 t0 % |e H"T 9  ha50 4/X 8 '. `%d 4 ,a3  8i/ F); 2H 6=$X 6tm  +{  i "p 8!& ,*$ <)8  ' N= 3 ^e ]& !7( T1\2 Tk-< W,L l06W $)k H8o a4<{ i `8 *" 8/ (@% g XG7 L4 h C=  @{2' ,X<  4XF J=Q P%dZ #Lo Po. ,;-p $E3P 7< Hg Tg d4H ("8 (= lX-H xu'a2<p"$(T1T5B`k/<QeZ8_07k42r~'(~De02(2t\e , HhL) |b2dg[.LW!P(83hDH'@O+3Pdp.p=&X{H=^:$|r5D- $T!('#$Ă ش96 . XB)[$d!/#(,9 :J=ClJ=Ql5pa=k-{X+$ Lh3=3hn/Xd.54= !$ 1,F%#260E2@@0Q8"=W^ghP'*qh5}g 3 .*`:!8g6=$46=85hD' b86+6TD#6 R9xb1#<qh2d|A+l(%48{2X84"8"7o+L%#`D!& $,<=4T8H$3\X\&h _.t.=$9=$81@!P+"4X/* 6x$<<i/7= E+HM̟7PVn2lgoh41`iČ94č$!)T@e/LLx.@ h^e$2c%FC(T\$l""zȾ) X4hSg~e1l0J=W!P3p5=$5l "$6 #H80,(9<8A)LC6#XOl}1$\5lizLO#d#H8Tg"P_7603`\*&$!p%8d.L"0=l8Ht(5`[58n4}1'd XlK" 7$7`O=$.h\v/x8 34/@#e10tC!PW=p10w,X'4'@g#X- *(y=(-8'r"@'<3 #)L5)E$LT J=`"$k- yg 6"(,3T&8<#5pee ~e@$@8=$)D!2A4TB4,X(|h&$4w 6DXe785HV5.DP'a50$4 Ժ"0 u%,=?D0O2 \k1i40\v<3X.5l i# f"@|(|hg#s:|5l <Lu/8>"47hq!K+*Zd4d5n,p4yX,8)l%pd7-41\h$3\H4X?= De0#414"$?+#GP/&QiaerZ,igL13P !#4 0&t |70.8H= 6"x3<4X1E`)Y2$g 4hq$n2 |,5x_4Dd)<e1t,\J+Lug32(j+"((/94=$-,M'PWugb(4u,x%l&Pt3'X8 1 ."4."H '` ") L. 3 0f6? p'DM !$_ 7$h gn x8v  $ :7 *( X" h-  $$ 4' hv"t D0d /!$>5T!5!*3,4!L!p@! t^!.q!Lw5!6=!X6!u-!,8!P+!H!$!g!64!+"p% "l5=$"X(%"X78"`"XC"Z1|O"._"0Po"dW-z"ؑg"<#"D8",'L"&#D"p8h"T4"ȗ/ "+"#\2=#, #)@4#8+D?#P%&`H#.V#@hh#`hu#],#y1##D#6#D7#8#'8#;$#\:0$HRg$XeT$g2, $41($T'(?$%`P$e ]$Pgl$83w$g$)"@$t"$"0$E5$D+5$4x$e%8"%"(%$2%=:%XgB%ieI% 8]%D35 o%~3L%.\%X2h%.%g%e%8%x.1$%B%(%'L%Pg%`)&O'&)"4/&5D&$4[&R,h&u#,x&F6&X.0&"&9&|8/&\<*D&"&l)&u1\ '1'^e*'-=9'A=L'*k'6T|'(''t4'xe'3'dc+'%('1''%t'1P'2(\e (`D1,($,#(T, 5(@"4O(ȗ6T_(g6l(4Tv(dQ)~( 4l() (Ȓg() ($/ (e(`5T(\1(8(D= )U')P=%)D:*2)L(HE)2lV)hA=t).={)T&T)9) 4)|R=)DU=)D.P)%)x"0)86p*x3P*R= '*%5*3B*$I* R*|+`*@1Pn*K0p*9 *ؽ1@*;#*)*)*4$*%$+o14+I6!+h%),+(8<+L=@M+&V+&7\h+'<|+ 1t+5+pe+hh&\+$+h#L+ '+_4t+9+xl5X+Xw#+0og+x+2D,J=,H=,'`.,4 :, 6K,gR,XgY,|%b,R# n,5,l3<, .p,XI=,-(,H=,-&,),9,<*D,h -) -J)P(-.5-Q(I-9=a-,""p-D=-P#`-U48-d!8-9-\4=-,=-$-=.X.T.x*$.b70.@'\B.$\P.$_.(<q.28.i.ܚ. .G=.0#@.%.`2<.T2.4I%l.3 /Xe/hO=*/3=5/ %A/]eH/@0, T/"4^/0gg/2t/(6/ 5/(2@/4/H24/H 6D/>)/Tg/&/le/H-  0̒g0+20=50X5LH04HW0`t#e0/=l04A%`z0Xp.(0"00050a4<0 10 g0Вg0e07X0}2101!\-1li.0@1hJ=O1.=]1+Pi1L\:<~1(81,=1h4d1,1&t11H1De1d= 1(V72 22W1"2 .p22HL=@2S1PN2I,p]24&e2h"v282<*262pZ5\24Sg2~e2>,283i& 3,1 310>3P%G3&S3,&$^3d3dv38@{3=3|9 30ng3,y"43Ze3dV03836=$3(8314&4&p$4x#h+46t44e=42L4Xe[4`'te4t/t4 g4#D4I=4d"4@i4}%@4%&,42#H57*5U$65 #@C5.=S5o7`a54j5,=w5 5[75H56,555o2,5=525h 5@,55`n06\"06Hh!6( /6 7&56"F6 8V61@`6=j6Tes6v5\6 5$6N=6:=6967686L '<6$r'6<&74s"87 +7(|<7C=J7) c7hC%k7x t7~ez7"7E=7'7}77<"L71L7,=7#P8@%(8l6(8428L&`<8-=F80#40Q84]8 ig8d1,w8TY+ 8}e8 i88h8%)L8<2x8m2$8n-8$8B$8g9 9=x9,519@'<9|<(0I908[9=r9G=9g$9X"9,9lS'L9x89#9$y*9|"98u :7:4<:$;=4:< A:,2M:ԒgY:d4 g:d&p:9$w:8:",:,8:X$8:!%:8":e:4:؆,;& ;0}2#;d&T0;#$@;$\L;h*X;4 3l;c'w;+H;$;a3;,h;k1T;p%;#8;h%;A%;$4`<,<8H6<<1*<83<Xg><!M<((DZ<gj< h(u<.<,C2<<,=<"<8L20<D.<[$<<Y.<4;#p=t%@=Tl5$=i"=ԣ60=xK=>=&LG=3W=#Xe=eq=#{=p&#$=g=x%=$<&D=|6L=|I'=ؒg=7P=h =!3\ >82<>133> &C>L.M>"hc>h}3r>"{>2@>9't>8>t8L>j50>%%>U$>$b'>g`>)X>V# ?8T! ?q!x$?%+?2;?h,$G?`4Q?*b?#@w?pn/d?k2?tt2?lg?g?H&?5?i ?@g?&?خ9 @h'<@i(@h 6@1(;@Pj:0O@eX@Xea@d!\t@D=@h%\@$4 @i@$@d#h@T+X@P5@h4@L7"\AlgA,"A3P2A4g>A;&XGA45RAd/^AhL2@gA$gnA8Aa*A-= A 1<At=00Ap($A&A"(A,J=A'Ag BeBh!BXe.Bo:9B,6\FB$68SB<)<aB6sBT8B30B1B*-LB gB`X. B|1$B&@B"4BlH=Cl|eC<="C$e(C041C %$@C\4NCL'VC&@]CP$TgCDepCX8CiC|1CtU= C.TCȄ"C58PCiCԱ"C  D7 D8,.D1x;D(!LDo2`D9pDg|DK%8DP(LDi5D}*<DD*D(gD" DY.E(g E*&Ė!4E4x6lHE *3D]Em&dE$DpE9) xE`6 E L%@E(0E(3`EH Ex~5E5E |E+E&#F!`$F%3?F1LQF']FLeoF5PF b#F4&)Fn:TF.xFpf3hF%F^$ Fh7@G60G`5$$Gș3-G!4BG`1LG'dVG$`G`r!pG,#${GP'"Gd=G@L1G(J=G.=G$gGM,GC!@GQ4G.H$"H$4+H<->Hd,LJH=x\H(9/|hH&wHq$~HP$XH H$$HeH؏$H%$HY#HLJ"0HБ(H'hH=H %3,I0 I*If&|(Iԫ2h4IA3DIiUIt$\I$5@nI`y4xI`N-I,ID=I<%IiI R=I0,Im$$I9I@)3I8X4\J\& J{,J M,&J41JĂ4 >J4d!LJ ]JH=pJH xJi J\ 2J%J4tJ+J<'HJ(-&JL6J|6,J#JL7Kld6d$K8g,K%@GK3RKZe`Klk"vKQ6K4w3$K}2KZeK<8Kp9KO=K"0L "4L\g%Lxi:x9LԼ8DL#4UL5TeLD+HsL=xL\eL(H,L\t:Lj5Lo2dL'<L1LeL5lL4L X M8MphMg#M0D1M%5>M]4tJM PXM%`hM)'0sM.=|M~eM\.`M؈3DM԰%0M{-`Mk*8M6MP/MH^,M$9'`M= N8(N8x-N6 FN$SN=lNĴ({N@ 'NT=N08N$>)hNa5N\l$`N%|NH=N( l O)OH4'%O6"h;O0&6 IO 2SO.=aO܋8qO\$O@n'O'OP2O1pOgO\eOQ.O -xP0P'P;=$.P<97P,5DPD.UP5=$gP"4sP5|P0%PQ'PP(}5P PgP,>3Pt: PN'P% P8Q(gQ[,&Q\g/Q0?Q܍9]Q]%leQxemQ:)~Q'lQ*PQ4hQ iQgQ%Q#Q`5Q8[eQh RV"KV8R6,WV/mVg vVt7=VgdVeV(V86TVHC+LVD=VěeV2VH1V(4+ Ws'Wd#,&WԹ&\6Wx|!<GWܡ3lTW r2hWX3#H}W"W8"W=W#`W1PWd\(0Wl2=W$\WG7W 0Xj4DX[,&XZe0Xl!@X=MXdB&SX,`X4HlX6wX9X&0X6X4"=XdeX %X XXF/X|9X,P"H Y 3$YЙ'dY?5|)YL48Y 4EY f/WY$R=fY3vY-tY&Y&Ye0Y|XeY$(Y #Y"Y" Y~+TY`!Y, ZLT.ZHg)Zh"3Z(AZN1(PZG=aZܩ%qZ8Z5Zм8Z\#ZX9Z6<Z5HZ8Z1= ZeZ=[h9[)5 [̪25[H=H[T 'x][ؓ# h[9[e[|&[8[m5[ i [9H[.=[3T[(4[g[}6,[t=<\(\^g'\`4H6\iE\`-R\3=$]\"$k\`J'|r\`g|\P3p\$g\8\,\xE=\1\p#\e4\!\l9 ]82]X:-(]a%1]9 >]l50L]@8\](1 q]8$x]!]`0<]D9=]<=]']X#]4]ԃ%]2]2^8 ^D l^-=&^ &/^!C^ 5V^43hf^Diw^4*^`g^1^H-L^L$^, ^Y+^8^'^Pr7_94_K8|#_(/_&8_4&G_u$P_|7=$`_ 3dm_i_C l_1_H.4_(_$$_ă2`_D-_(*_,h_|E'x_pB# `0#<%`(1`I"F`2R`h[`Logi` ds`@ }`3#H`xv-`48`'`4 `d2\Ld 4`Wd G%cdgod\8(vde d30d01d,ed6@dp1dx!tdܔedX"d~e dX1$e=sT)1tX)p't'(T6t(8It(hXt47 @ith)4|t}eth3Tt$$Lt9=$th5tL2HtitPhtT0%8u{#u3,(un,\5učgHur:XuLo+dbu*"luxz)}u8C%0uZeu 5`u~euy*u*`u=u Putf0 u44Xu\2 vp=v 6(vP(3PEvdf+Rv 4dvs%|vvD[:$vȓ*vP=v Tv,36vJ=vX/0vL2=v$v0 w(wA% w"7wU=(EwH -tNwl.]wx#ew!rw,|-<|w<"w,e0wo%wgw8Sgw0ew0&\w(Hw"$wD w,q4x@& xܐ!x5,x2>x$PMxhZxTg(jxD5{xt3xx, xe&Lx"xܜ6lx64x4#@xN1x8yt3Dy8,(#y"h6yY&?yxgRyt1ayL9ZH1do4evo: g"e`760eL28=spec_vnodeop_opv_descwi_set_nwkeyucom_unlockpfslowtimonanouptimeuvm_map_callrandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickuvm_page_lookup_freelistlongjmpwi_usb_rx_list_initffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodeuhci_pci_attacharpresolvechrtoblktblsys_minheritputcharural_update_promiscbufq_default_allocchild_returnuaudio_add_outputrtlabel_unrefuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donewdc_atapi_drive_selectedcopyinstraue_miibus_readregsys_getgidext2fs_vnodeopv_descsdofilewritevwi_inquire_usbuftdi_matchdumpmagttyflushsys_setsockoptvop_lookup_vp_offsetscomdefaultrateieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswohci_powerpowerhook_establishwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpciide_triones_productsdisk_finduvm_maxkaddrehci_pci_cansphy_cdral_pci_detachicsphy_resetrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidieee80211_encapusbd_intr_transferaudio_attach_mi__ashldi3artisea_chip_mapvn_statvop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchchange_sign16_swap_bytes_be_mts__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockenc_xform_aes_ctrrt2560_wakeup_expirewi_read_data_iomyip_ifpwdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachvtagssiop_pci_attachfilt_audioreadwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchgeneric_armv4_bs_wm_2if_group_routechangefiq_claimohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caehci_pci_matchipport_firstautoehci_strmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldohci_endpdm_freemuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeedusbkqfiltervn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIpdevnames_sizemichael_updatealaw_to_slinear16_be_mtsscsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execwskbd_cdsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsuaudio_set_paramsnd6_dad_startuaudio_add_extensionexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitricohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopslogread_filtopsre_ifmedia_stsvndxfer_poolfilt_fifowriteem_set_multiffs_specop_ptcp6_mtudisc_callbackcopyoutstrext2fs_fifoop_opv_descatu_capte_l2_s_prot_uieee80211_countrycode2regdomainradio_attach_miusb_transfer_completelxtphy_serviceswcr_newsessiontcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writeem_phy_powerdown_workaroundsystempagem_zeropdc20262_dma_startural_alloc_tx_listffs_specop_entriesunp_gcingbdevswumodem_matchbaddynamicportsohci_root_ctrl_closeau_set_lr_valueX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpdlockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterre_ifmedia_updwi_headttyunblockbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetach__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnamesdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequestsiginituipaq_cdpci_mapreg_mapuhci_device_isoc_abortuaudio_activatevn_default_erroruaudio_query_devinfousb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stalldb_vnode_print_cmdums_cabio_registersetdisklabeldeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocroutedomainhid_locateicmp6_errorVOP_MKDIRusscanner_scsipi_minphysip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_syncscsi_mode_senseip_savecontrolstackgap_randomulpt_detachfiq_setregsffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapbpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3pci_classuvm_map_inheritfifo_printinfocd9660_syncem_display_debug_statsin6_ifawithscopevop_inactive_descaudioreadumodem_set_line_stateuvm_schedulersync_printnchashvnopsieee80211_rssadapt_inputpool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuscannerioctluvm_map_protectusbd_get_xfer_statusre_encapprintfsched_lockehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtsys_sbrkrandomuaudio_mixer_add_ctlsysctl_doprockcopyaudioattachsiop_modechangeext2fs_initrtfreecuio_getptrcd9660_linkhostnamelenupl_cdcd9660_specop_entriesusb_needs_reattachxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlocknd6_ioctlphyslockaxe_miibus_statchgpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintralaw_to_mulawkqueue_registerpciaddr_resource_managecred0in_delmultipmap_procwruvm_forkvfs_op_descsuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromfifo_ioctlumodem_closeehci_devdttydefcharssigexithidirtypagesrt2560_reset_tx_ringin6mask128dead_lookupbus_space_read_raw_multi_4atapiscsi_cauvm_amap_poolin_pcballocVOP_LOOKUPbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatvop_rename_vp_offsetssys_ovadviselockmgr_printinfousbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initi80321_bs_vaddrbufq_default_freeufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolpgrphashsys_setpgidprofhzcache_enterdb_watch_tablei80321intc_attachedexec_elf32_makecmdsradio_cdradio_caext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1db_trapuaudio_halt_out_dmathecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readsimple_lock_debuggerauth_hash_hmac_sha2_384_96crypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogatu_start_scanipsec_def_compfc_lmdistancewdc_atapi_ctrlnch_poolsomaxconnural_readatu_external_firmwareipsec_exp_timeoutip_directedbcasti80321_pci_decompose_tag_bus_dmamap_loaduihashtblscsi_get_xsau_get_portaudiommapumct_activateticks_per_secondieee80211_get_rtsamap_initffs_flushfilesetherip_allowubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekulpt_resetmainbus_bs_subregionaudio_check_paramspool_cache_getnprocsdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicewsevent_finiip6stathotplugread_filtopsuplcom_set_line_stateuvm_pageboot_allocconfig_pendingmii_phy_updateswwritei80321_i2c_matchether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptsys_seteuidwskbdpolluvm_map_checkprotmax_protohdrmixer_openatu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spwdc_atapi_intr_dataumass_scsi_attachbufpagesrandomkqfilteruipaq_attachusbrev_strpciaddr_resource_allocateiic_execrlphy_cdsys_keventcopyargsarc4_reinituhci_device_bulk_methodsrt2560_attachmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorsuaudio_drainkern_sysctlnd6_delayin_pcbinitsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_doneehci_device_ctrl_startuserconf_cmdbuflinear8_to_linear16_lewi_get_pmumass_bbb_stateaudio_init_recorddb_print_loc_and_instohci_device_ctrl_abortvop_pathconf_vp_offsetssvwsata_dmacmd_readrt2560_updateslotrt_mpath_matchgateubsa_stopbitscdce_startuaudio_identify_assensor_task_schedulert2661_reset_rx_ringuvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncehci_pci_shutdownvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatwddkdriverdb_break_tablei80321_softcfillmapentrytcp_timer_persistsata_chip_maprelookupudav_newbufsys_umaskpci_subclass_i2osyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodepmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupubsa_intrmemmovesii3114_mapchanicmp_rediracceptugen_set_interfacevop_reclaim_descusbd_get_hub_statusdb_boot_halt_cmdural_attachip_outputbpf_mtapuaudio_add_selectorfindblknamenkmempages_maxkue_rx_list_initpool_initbpfreadpool_putm_copym2umidi_casysctl_structohci_hash_rem_tduhci_poll_hubpmap_pinitaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimefiforead_filtopsehci_freexcryptoclosesysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptusbd_get_device_statusspec_vnodeop_plookupnchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkaudioprobeether_ioctlumass_bbb_transferrnd_attachedtqphy_serviceuscannerkqfilterip6_forwardinganon_swap_offural_cdkue_resetarp_allocated_bus_dmamap_load_mbufwdc_print_capswi_watchdog_usbslinear8_to_mulawifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallfilt_audiowdetachuvm_pglistallocsyn_cache_addohci_device_ctrl_transferulpt_do_writeincoreurlphy_cdhzdcphy_mii_phy_autoulpt_statusmsgdefrouter_resetcd9660_ihashinsrt2560_bbp_initsiop_script_writewdc_atapi_send_packetcheckaliascue_activatettyretypestartuphook_listre_tx_list_initpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutsdclosevop_poll_vp_offsetsvop_generic_kqfilteruaudio_set_speedpffasttimoinitsiginfosys_getuiddb_set_cmduvm_unlock_fpageqcpuidsexec_setup_stackobio_bs_vaddrpager_map_wanted_lockuao_createdb_free_watchpointssensor_detachbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctswskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffaudiocloseugenintrgroupmemberuvmspace_inituhci_powerrt2661_ioctlether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockscsi_task_listselwaitpmap_init_l1udsbr_get_infoicmp6_mtudisc_callbackssys_forkip_setmoptionsuvscom_reset__qdivremumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freeehci_alloc_sqhaue_shutdownuvm_fault_wireusbd_abort_pipekernelstackip6_forward_rtableidsi_freevm_nphyssegip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkehci_freempmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncswinChkNamedvd_read_copyrightbio_delegate_ioctlvmi_list_slockdb_history_prevem_read_pcie_cap_regem_setup_receive_structuresmyip_initializedsync_vnodeop_psys_mkdiruao_reference_lockeduaudio_get_propspmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbrttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwuaudio_opennd6_mmaxtriessiop_intrsys_socketuhci_abort_xferuhci_detachuaudio_getdevugenopenSHA512_Lastdead_vnodeop_opv_descohci_shutdowni80321intc_imaskfilt_uscannerdetachwi_init_usbugenioctlspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writedead_vnodeop_entrieslxtphy_caiso_disklabelspoofmidireadfifo_badopfdfreefintek_catty_countdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchKERNEL_BASE_virtuaudio_identifyremove_coproc_handlerumass_polled_transferucom_to_tiocmsensor_attachbrelvpre_intrwdc_logauth_hash_hmac_sha2_512_96msdosfs_mountfspcibr_flagsem_82547_update_fifo_headehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatevop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocusercryptowskbd_deliver_eventdb_eregscom_fifo_probefdcopyatu_send_mibuaudio_setb_to_qbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceulpt_caSHA1Updateifg_headvfs_rootmountallocehci_device_isoc_transfercue_tx_list_initnetintrbs_notimpl_bs_sr_2rw_initcd9660_openi80321_bs_mmapuvmcnt_dumpixp_setup_channelohci_root_ctrl_startcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_lineuhidkqfilterVOP_ISLOCKEDsys_kqueueSHA512_Transformieee80211_tree_RB_REMOVE_COLORuao_referenceurio_causbd_kill_pipeuhci_freemin6_addrscopedb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockraw_usrreqnblkdevuhci_find_prev_qhbs_notimpl_bs_wm_2uhidev_detachurioclosescancttyinput__stack_smash_handlerumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointcrp_req_queue_tailmulaw_to_ulinear16_be_mtsehci_free_sqtdwi_usb_txfrmmaxslpext2fs_makeinodeehci_device_intr_methodsswap_bytes_change_sign16_lecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkudsbr_attachufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassocin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_taskusscanner_activaterip6_ctlinputubsa_activatecdce_caumass_cbi_adscsbdropmidi_out_stopmsgbufphystcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocblf_keysys_setegidnoswap_bytes_mtswdc_wait_for_statusbus_space_write_raw_multi_4ucom_status_changern_matchfifo_readcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoreceivesiop_iwrpool_getuextralocdb_show_radix_noderootfsudav_csr_read1ohci_root_intr_startucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdndflushcompose_tab_cmprn_insertspec_pollfilt_kqdetachmidi_cddb_flush_lineaue_unlock_miiipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventbsearchif_attachusscanner_matchpciaddr_ioaddrm_reclaimnameiem_read_pci_cfgbs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_pollvn_accesstqphy_funcsversionwihap_init_bus_dmamap_synclzs_dummykqueue_initrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerruvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufwdc_atapi_the_poll_machinecomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivateclallocipsec_esp_trans_default_levelbiowaitpci_subclass_inputfilt_ufsreadrt2560_rx_intrunixswsccsdb_stop_at_pctqphy_caehci_check_intrccpupmap_updateehci_device_setintrobio_cduvm_map_replacegeneric_bs_sr_1em_setup_linkacard_chip_mapnexttickeventtcr1_writeboothowtofdinitarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2namescsidebug_lunsuao_dropswapenxiosys___getcwdusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressSHA1InitRMD160TransforminflateInit2sys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanvop_print_descuplcom_breaktcp_closeicmpsrcohci_free_stdumidi_evlensd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varsfallocbufferslxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapuvm_anon_removeumass_bbb_methodssoft_intrqufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statususerconf_initrt2560_ioctlkillpg1url_tx_list_inituhci_stri80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putusscanner_sensedata_cbwi_set_ssidcue_ioctlnd6_prefix_onlinkatapi_to_scsi_senseugen_seltrue_filtopswdc_atapi_ioctlumct_intrcue_attachosversionelf32_read_fromau_get_lr_valueticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_inittvtohzvmi_listudp6_usrreqratecheckin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollmsdosfs_check_exportlf_setlocknbigpipecue_devsin_controllmaxrlphy_funcsuvm_pagecopysysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapmidi_attachieee80211_tree_RB_FINDrddkdriverohci_freemuaudio_matchi80321_bs_tag_templateucomioctluhci_remove_ls_ctrlmbstatdcphy_statusuhidev_intrttyinfodb_flush_lexscsi_task_poolttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdpciide_dma_initextent_destroydb_lpip6_forward_srcrtenc_xform_rijndael128if_group_egress_buildloop_clonerwhichqsgetcttsetwatermididetachdb_last_addrural_update_slotem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrfirstclinear16_to_ulinear8_bedb_read_bytestcp_rndiss_inituhub_detachaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsrt2560_media_changeffs_fsyncfintek_attachau_portofinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activateuaudio_chan_set_paramcue_newbufsi_getdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocfilt_usbrdetachspec_writeaudiostartrsiop_wdtr_msgcom_obio_cdipsec_esp_network_default_leveldb_map_equalin_broadcastpool_page_free_oldnointrfd_getfilemsgbufaddrucomclosesdioctlutsnameexit2__hex2asciiaue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlcurpriorityrddumpem_enable_intrcpu_setperfufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsugen_set_configsi_finddb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levelffs_fifoop_entrieslogclosegeneric_bs_wr_4nbufinstall_coproc_handlerSHA256_Updateohci_rhscudav_detachufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelif_qflusharc4_timeoutumct_openpci_subclass_networkusscanner_data_cbext2fs_checkpathns_scx200_chip_mapsocantrcvmoreuipaq_rtsrt2560_update_ledfile_filtopsmsdosfs_renamesysctl_proc_argssiop_adapterext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3trr1_readcd_load_unloadpmap_activatebmtphy_resetvop_create_vp_offsetsmidi_getinfoconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswmulaw_to_slinear16_beSHA256_Update_intrt2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controlem_setup_ledleapyearsys_sigsuspendcd9660_unmountwdc_atapi_the_machinepciide_dma_startehci_device_bulk_abortswcr_authcomputetrapsignalcurprocmainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecevcount_attachlimcopywi_do_hostencrypttcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachcrypto_pool_initializedsiop_pci_cart_timer_initudsbr_cdnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initehci_pcd_ablerip6statmulaw_to_ulinear16_le_mtstcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTi80321_pci_initsrv_ipohci_add_edwdc_xfer_poolusscanner_cdcdce_newbufbus_space_copy_2soacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsdb_call_depthpool_page_alloc_kmemdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimermsdosfs_unmountelf32_load_psectionuftdi_writeSHA512_Finalrn_mpath_nextuhci_device_bulk_transferarm_pcache_unifiedmidi_out_startdb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1uaudio_id_namemsdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdsiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryrgephy_statusiophyattachselrecordffs_validatecomstopatu_wait_completionaxe_ax88772_initrip_outputext2fs_accessrt2560_read_eeprommld6_fasttimeokthread_qimaxwsmouse_matchvop_unlock_vp_offsetsohci_free_seduserconf_pdevuvm_object_printitiq80321_devmapclock_secs_to_ymdhmsmbpooltcp_canceltimerstqphymatchrip_recvspaceroute_initdb_store_countlink_rtrequestwdc_get_xferuvm_vmspace_poolspec_lookuppipe_createfifowrite_filtopssysctl_vnodepdc202xx_setup_channeliodatand6_sysctlpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createcdce_tx_list_inituao_detachcpufunc_controlmallocamap_pp_adjrefapollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeueuhci_root_ctrl_startwi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctluaudio_io_terminaltypecd9660_rrip_analyzeohci_hash_find_tdexphymatchbio_unregisteruriowriteip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statskipjack_setkeyvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKubsa_devsicmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzenc_xform_cast5wdog_ctl_cbuaudio_mixer_get_portuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptext2fs_vnodeop_opv_descdetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4brgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopohci_allocxcopyrightsdattachxscale_optionswdc_default_lba48_write_regtcp_timer_keepusscanner_attachusbd_devinfo_vptcp_mss_updateiopiic_cdpciide_lookup_productfree_pagesffsfifo_reclaimehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastchange_sign16_swap_bytes_bedb_output_positionem_mng_write_dhcp_infoicmpmaskreplin6_pcblookup_listenmsdosfs_mknodcd9660_specop_pip6_defmcasthlimsys_munmapsii3114_dmactl_writeudsbr_hw_iftcr1_readfilt_solistenvsnprintfarplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodspmap_copy_page_xscaleifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablebpf_iflistem_reset_adaptivewdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputwdc_atapi_real_start_2pciide_mapreg_dmasoabortlinear16_to_linear8_beuaudio_trigger_outputem_get_bufem_82547_move_tail_lockedcast_encryptunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfsensordev_installdb_clear_single_stepuvm_page_printitmainbus_cai80321_local_dma_initrt2560_intrsoftdep_flushworklistsys_issetugidinitclockscd9660_mmapsd_reassign_blocksif_detachaue_watchdogmidiprintwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolext2fs_specop_opv_descunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startudsbr_set_infopool_serialxscale_cache_flushD_SEuplcom_activatescsi_probe_lunirq_entryaue_ioctlsdrestartvfs_mountedondb_expressionboard_powerdowncputypepmap_deactivatert_lookupfc_lookup__bss_start__linear8_to_linear16_be_mtsif_downndqbfilt_rndreadallocsysVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratesiop_add_reselswuvm_km_pages_headwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headertcp6_usrreqrt2661_bbp_initdb_historyeephy_cdinphy_cdukbd_parse_descmidi_unit_countttytstamptcp_rndiss_cntural_set_txantennaieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirehw_serialehci_device_intr_abortauth_hash_hmac_md5_96uvm_unmap_puaudio_halt_in_dmacdattachuserconf_deviceurioreadin_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatewi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_caucom_dtrrtredirectuvm_map_printitwdc_atapi_pio_intrdb_read_variableulpt_cdsoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endmtx_enteraxe_devskqueue_pooluaudio_mixer_set_portvntblinitallcftablesuhub_activatein6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedugenwritesys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctludp6_recvspaceuvm_km_freeusscanner_intr_cbsys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16em_watchdogrt_setmetricssys_getegiddb_set_single_stepem_check_mng_modeserverworks_setup_channelumass_init_insystemem_validate_eeprom_checksumdirchkexphy_resetipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typewi_usb_activateconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsc_pld_shminidatacleanrt_timer_queue_destroywi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enableukbd_sunlayoutext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetcryptodevallowsoftem_driver_versionobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodeieee80211_dump_pktsys_unmountuvscom_dtruipaq_detachbootdvmainbus_bs_tagelf32_probesumct_detachin6ifa_ifpwithaddrvgonelsofreeeephyattachinphyattachuvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeoutpmap_removebpf_mtap_afuaudio_determine_classicmp6_fasttimoext2fs_removeif_clone_destroyehci_close_pipewdccommandmyipbpf_setfuserconf_historyuvm_page_unbusyfilt_hotplugreadtk_noutext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enabledb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstamphotplugkqfilteri80321intc_smaskip_randomidaudio_rintbrgphy_eth_wirespeedaue_tx_list_initnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdasttcp_disconnectvop_open_vp_offsetsuvmspace_execuhci_timeoutwi_usb_detachsys_mmapehci_bus_methodsbootuaudio_hw_ifnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnameaudio_cddb_print_llinfocmd680_setup_channelpci_enumerate_busem_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listip_dosourceroutesoread_filtopsieee80211_media2ratebdevsw_lookupdisk_changeuplcom_matchsc_devsamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinitem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protobrgphy_funcsfilt_ugenread_isochw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadem_rxeofuhci_root_intr_methodslminscsi_probe_bussys_fpathconfarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopennatsemi_setup_channelscsi_test_unit_readyural_set_bssiduscanner_activatericohrtc_reg_writearc4random_bytesnmbclustural_get_rfvop_reallocblks_vp_offsetssominconnrt2661_mcu_wakeupuhci_device_clear_toggleredebugnchashtbluvm_vnp_syncem_transmit_checksum_setupiopxs_cdwihap_assoc_requaudio_chan_ptransferarpt_downrdgetdisklabelulptclosearm_pdcache_line_sizebpf_tapdb_lookupSHA256_Finalmii_phy_automax_datalenmsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockgeneric_armv4_bs_wr_2db_lastsymsiop_resetbusurl_memip_srcrouteuaudio_add_mixeruhidioctlip6_accept_rtadvpte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1usbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishfifo_pollkrp_req_queue_tailumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthradioattachdb_putncharssii3114_dmactl_readmainbus_bs_unmapnd6_maxnudhinttcp6_inputwdc_atapi_donesosetoptehci_set_qh_qtdtcp_msscache_purgeudav_stop_taskbpf_mcopySHA384_Finalauth_hash_hmac_sha1_96siop_printstatsfork1curpcbdb_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriesrt2661_set_chantcp_rndiss_msbsys_chmoducomreadprelist_removeffs_vgetrt2661_tx_intraxe_encapinitproc__umoddi3arm_dcache_alignugenclosert2661_media_changeip6_log_intervalnull_encryptwihap_auth_requvm_page_physdumprootconfX_db_sym_initsyn_cache_timersolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorcdce_detachvop_bmap_descrt2560_tx_intrsuser_ucredmulaw_to_alawsd_shutdownwi_shutdownmem_noext2fs_buf_allocral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reservemainbus_bs_rm_2pmap_free_l2_bucketRMD160Update_intrevarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockieee80211_mgt_subtype_nameugen_do_readchange_sign16_swap_bytes_le_mtsdb_not_taken_bkptuaudio_chan_initvfs_mount_foreach_vnodekqueue_kqfiltermidiclosewi_mgmt_xmitaudio_openuhid_do_ioctlzeroin6_addrstrncasecmprt2661_shutdownatu_tx_startrt2560_encryption_introhci_device_bulk_start__guardwdc_atapi_minphysin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freevop_default_descurlphy_attachscsi_inqmatchfdesc_poolcmd_pci_intrusbd_add_drv_eventvop_strategy_vp_offsetspool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencpool_head_slockbadaddr_read_4bzerotickfixintervalarmv4_drain_writebufufs_closefixjobcdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_herebiossys_obreak__udivdi3blf_setkeyusbd_set_config_norgephy_cdusbpollpciide_cdlastddateucom_do_ioctlpmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinitchange_sign8usbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdamap_allocVOP_LOCKMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internallinear16_to_linear8_lert2560_decryption_intrdb_page_print_cmdwi_intrvgetrd_attachugenpollieee80211_create_ibssbrgphy_jumbo_settingstisr_readwsmouseopenwinChksumserverworks_chip_mapfreeclusterchainmld6_initrw_test_and_setmainbus_bs_w_4disk_initcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsatu_cdrip6_ctloutputwdcrestartnetioaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createem_local_timerusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_cabmtphyattachucomopensysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createvfs_opv_initissignalwdprintnetclsfilt_uhidrdetachin6_selectroutecdevvprt2560_bbp_writeuvm_pglistalloc_simpleuhci_intr_setsoftintrigmp_joingroupinflateIncomprandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_allocdb_loop_countwi_intr_ackpciide_dma_table_setupfiq_releasebpf_reset_dslinear16_to_mulaw_lend6_dad_stophid_start_parseuseloopbackuvm_waitnexecsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdoguaudio_trigger_inputloioctlrw_exit_writebs_notimpl_bs_wr_8rt2560_free_tx_ringumct_initpmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesspec_vnodeop_entriesusbd_new_devicefillinusemaprecvitfill_kproc2bmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchlog_openevcount_initfragtbl124userconf_totdevi80321_bs_tagvop_inactive_vp_offsetsrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgwdc_atapi_real_startobio_bs_maprealitexpireipstatunix2dostimescsibus_caubsa_attachuvscom_openurl_newbufusbd_delay_mspool_page_free_kmemcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimert2560_tx_datauvm_swap_getaudiosetinfopciide_serverworks_productsext2fs_reloadurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetskipjack_backwardsphysmemurl_cdinferiorxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_pcryptof_readuplcom_cart_if_remove_rtdeleteltsleepwskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_cauhci_timeout_taskuhci_root_ctrl_closertalloc2endtsleepwihap_check_txuvm_pageratopsigactssharedb_set_watchpointbpfattachuftdi_openif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5crypto_kdonebpfilter_lookupm_copym0axe_miibus_readregvm_physmemSHA256_Transformiso_shipdirrdwriternd_timeouticmpmaskpipe_ioctlural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootnetlckbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrcomprobe1getphysbufcdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupscsi_deinitdb_evarsupl_activateiic_smbus_write_byteufsfifo_closewakeupgetnanotimeatu_devspciide_matchi80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffurio_attachSHA384_Initbuckstringuhci_device_bulk_startsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesmsdosfs_vnodeop_pdes_ecb3_encryptcomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopendoscheckpathpcbmapaudio_readatu_newstateuscannerclosend6_option_inituvm_km_alloc_poolpage1brgphy_serviceaudiopollpiix_setup_channelext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgiduserconf_common_attrfilt_ufswritert6_flushrd_ioctl_serverehci_timeout_taskuvm_mlk_callatapiscsi_attachgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespuvm_errno2vmerrorsubkey_table_gendohookswdc_atapi_tape_doneem_pci_set_mwiieee80211_rssadapt_chooseehci_free_sqtd_chainem_disable_intrukbd_activatetmr0_readsiop_sdpiic_probeem_poweraue_setmultiif_detached_ioctllocnampvop_close_descwi_usb_causerconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridpool_setlowatehci_pci_givecontrolleruscannerpollkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulsys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadsoreservepidtakendb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactlradioactivatearoundin6_pcbnotifystrrchrusbd_clear_endpoint_togglecrypto_threadgetdevvppci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybacktickdeltaisodirinodb_strlcpycfrootswsmousepollchrtoblksiop_get_lunswscsiprintuserconf_pdevnamminphysukbd_matchurl_tickrtalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivop_mknod_desccdce_cdip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activatedb_breakpoint_cmdcd_powerhookvwaitforiomii_phy_tickuscanner_do_closecd_read_subchannelextendfilelortrequesticmp6_inputuserconf_addwdc_atapi_resetohci_device_intr_methodswi_func_iocreatedeuvscom_closesbreleasedb_history_sizemsdosfs_islockedmax_linkhdrem_dma_freeumass_attachalaw_to_ulinear16_lecryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_serviceuserconf_hist_eoci80321_intr_disestablishext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizeacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreert2560_beacon_expirerootdevaudio_fill_silenceehci_device_isoc_startufs_ihash_slockm_tag_firstmixer_closeem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogatapiscsi_detachusbd_ar_pipecy693_setup_channelext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readre_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeydb_map_currenttcp_rndiss_nexttcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesudsbr_detachi80321_gpio_initffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointciphy_cdieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppumodem_paramfifo_lookupffs_reallocblksrandomcloserootvpaxe_miibus_writeregem_print_hw_statsugen_do_writeuserconf_maxlocnamespool_reclaimpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_opencddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitruaddrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_uppiixsata_chip_mapumsm_cart2560_shutdownehci_intr1rgephy_resetupl_intrucomprintural_matchVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopsys_openrgephy_funcsurio_matchinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletert2560_next_scanuvm_pageidlezerowskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachraw_attachural_set_rxantennadb_boot_sync_cmdastpendinguhci_noopether_ip6multicast_maxpipe_pooluao_initvop_abortop_descifa_ifwithrouteumidi_get_quirk_data_from_typespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolrandomattachsys_sstkem_smartspeeddb_print_positionrtflushclonedb_radixgetblkem_tbi_adjust_statsdead_vnodeop_pxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initvtypesnobuffersdata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrtcp_identtcp_rst_ppslimrtrequestuhci_openifinitcd_load_tocunpst_recvspacezlib_versionkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closeaudio_draincd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrblf_encadler32vputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizecd9660_setattrfilt_hotplugrdetachusbd_get_configcyhc_slockufs_quota_initz_freekqread_filtopsbrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbaudio_closexscale_cache_cleanIDem_read_part_numaue_csr_read_1cryptowriteieee80211_beacon_allocatu_attachubsa_get_statusbioopscpu_classesbpf_setdltmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocrt2560_set_macaddrufs_ihashinsin_setpeeraddrwdcactivateeephymatchinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstraudioioctlpdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeunpdg_sendspacesession0viscpywsmouse_do_ioctlE_abs_lunsw_return_Usedhw_vercopyin__umodsi3comparamsiop_common_resetural_stopudav_sendcd9660_defattruaudio_round_blocksizeohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_paritysigacts0findblkmajorpager_mapntohlsorflushugen_caiophy_funcsttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelaywi_usb_infofrmugenreadffs_mountext2fs_specop_entriesuaudio_chan_rtransfericmp6errppslimSHA512_Update_intbadaddr_read_2usb_desc_iter_initusb_neventspool_inactive_timelinear8_to_linear16_beuhci_add_intrconfig_process_deferred_childrenohci_ifcdpool_cache_reclaimxscale_cache_purgeID_Eluphymatchbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistm_tag_getsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterupl_watchdogsuid_clearttwriteatu_initchange_sign16_leehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsdead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutvop_symlink_vp_offsetsunputcendluphyattachVOP_CREATEprobe_switchcdce_stopvop_readlink_descuvm_map_referencespec_ebadfphtree_SPLAYuvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closeohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupem_setup_transmit_structuresre_eeprom_putbytemainbus_bs_mmapural_writeucom_cleanupcd9660_vnodeop_opv_descVOP_ABORTOPehci_pcdchange_sign16_swap_bytes_leem_identify_hardwareuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolwi_inquireehci_pci_takecontrolleradm1032cloneprobetcp_rst_ppslim_countukbd_detachif_clone_listsys_futimesrt2661_update_promiscsdgetdisklabelwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessmalloc_errintvlciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchcrypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorohci_alloc_stdcmd646_9_irqackip6_sendredirectscast_decryptddb_sysctlukphy_caitimerfixip_stripoptionsaxe_setmultisyn_cache_countulptuseinieee80211_add_xratesnd6_timer_chcpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapmidi_ointrdb_watchpoint_allocudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1uihashrijndaelEncrypttcp_keepintvlvop_reallocblks_descuvisor_detachvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocwrite_multi_1aue_tick_taskatapiscsi_cdcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32rgephymatchipsec_exp_first_userlphy_serviceusscanner_sensecmd_cbplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewireem_stopin6_joingroupsys_munlockhotplugattachuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlemclpoolvfs_getcwd_commonset_cpufuncscttyioctlffs_vnodeop_psys_lstatfilt_rndwriteohci_timeout_taskohci_hash_add_tdiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesmidi_iintrumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsuvscom_activatenullcnpollcuvm_km_initpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolnkmempages_minvop_mkdir_descukbd_accessopsusbclosesis96x_setup_channelpcipowerudav_matchcdce_get_descvector_pagesys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbletextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsscsi_mode_sense_pageboot_argsSHA384_Updateumass_scsi_setupproc_pooluplcom_dtraue_intrmainbus_bs_wm_1udp6_inputsys_writert2661_next_scanmap_forwmergedb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedulptopen__bss_end__cnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_lineusscanner_cawdc_ioctl_findsiop_productswd_get_paramssys_readlinkrt2560_setup_tx_descext2fs_sizecpufunc_faultstatus__ashrdi3bs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEpmap_dump_ncpgip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistlf_splitifafreeVOP_STRATEGYtzucom_rtsxscale_cache_syncIrip_sendspacexscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_startSHA512_Initwi_func_usbulptioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcsoftclock_siem_82547_fifo_workaroundwi_usb_threadin6_pcbsetportalldevsrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufaxe_rxstarti80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readfiq_nullhandler_endumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutpmap_zero_page_xscalettyread_filtopsiic_printusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotatmr1_writefifo_ebadftmr1_readscsi_do_ioctlrtable_existsehci_free_sqhcd_resettimedeltaX_db_foralluhci_pci_cascsi_detach_busudpstatcd_read_tocural_amrr_updatecdioctlcue_stopuvscom_detachifmedia_addatu_usb_requestlxtphy_funcsskipjack_zerokeyusbd_set_config_indexlogopenluphy_servicert2560_txtimert2661_rxratebreadntcp_hdrsztcbtable__xordi3i80321_mem_bs_initfrag6_draindosdiremptyidleigmp_slowtimoifpromiscip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupvop_fsync_descricohrtc_cawi_usb_intrusbd_alloc_buffermask_rnheadproc_isundersi_headpte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitohci_pci_causbd_set_reportexec_elf32_fixupradioopenrt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttyuvm_pagealloc_stratural_bbp_readusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupbpendtsleepenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessionMPFailcnbellm_copydatainswm8wdc_atapi_timer_handlerumass_atapiscsi_devatu_stopcd_setchanuaudio_value2bsduvm_cnt_headmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4uaudio_feature_namettymallocupl_attachums_intrbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlvfs_busyfilt_ufsdetachlf_getlocksolistenpdc205xx_drv_probewskbd_compose_valuepciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupem_set_promiscuserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establishatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_devicexscale_cpufuncsif_link_state_changepmap_virtual_spacepage0_endusb_disconnect_portbpfpollnumemptybufsupdatepriohci_activateciphy_fixupbmtphy_serviceuhci_device_bulk_closeumidi_search_quirkulinear8_to_linear16_be_mtsuhid_cdwskbd_cnbellruntimeuhci_intr1pciide_print_channelsoutswwi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encpool_logsizebrgphy_bcm5401_dspcodesoftintr_establiship4_input6pdevinit__iordi3inetctlerrmapffs_specop_opv_descresetpriorityau_set_portrt2560_set_slottimeenoioctlwi_usb_start_threadsigacts_poolpcaled_matchexecsigsconfig_initcpufunc_null_fixupskip_fcicmp6_redirect_inputrw_enteraue_read_macpciaddr_print_devidmixer_ioctldb_access_abt_spscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyX_db_symbol_valuesieee80211_wep_cryptiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descext2fs_advlockknote_fdcloseehci_device_intr_doneif_clone_detachpipe_rfiltopsubsa_openin6_cksumcomcninitpciide_print_modesstrncmpvfs_opv_numopsdes1_decryptvfs_shutdowngetsockbs_notimpl_bs_c_4upl_startin_interfacessyn_cache_respondif_creategroupllinfo_nd6sbcheckreserveuvm_iopreemptbioattachieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatumct_rtsaudiowritesyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskpciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_poll_randseedumodem_activateulpt_attachrtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationsscsi_task_bus_dmamem_mapnet_sysctlcom_cduaudio_identify_acxscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputvop_ioctl_vp_offsetskmemusageswcr_sesnumlf_getblockpciide_irqackusbd_add_dev_eventumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrfifo_reclaimsbappendstreamrt2661_bbp_writem_tag_copy_chainusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpycseaddrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastusbd_set_port_featurebpfilter_createsysctl_lockcdrestartlockfpoolwihap_disassoc_reqaudioread_filtopscpu_switchtoieee80211_find_nodeucom_cahtonluvm_km_kmemallocusb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatehci_ifcd__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initbmtphy_statustrr0_writedisk_unbusysysctl_fileugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modeauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linewildcardin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlite_chip_mapVOP_READLINKumass_cbi_methodsdb_ed_styleufs_seekmii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleepehci_root_intr_doneatu_get_opmodeunp_disposerd_open_hookscsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closeuvm_km_pgremoveramdisk_ndevsex_region_plfscaleip_optcopyvfs_registerieee80211_proto_attachsys_dupulinear8_to_alawmcllowatmii_printbpfilterattachpci_find_deviceswcr_initenc_xform_skipjacktimeout_tododb_lccpu_read_cache_configumsm_detachwdc_sii3114_vtblpanicget_pc_str_offsetL_cksumdataciphy_resetural_rxeofcue_rxeofmsdosfs_lockseltruepci_subclass_systembpf_m_xwordsoftdep_initializencvhashtblunp_shutdownwi_resetext2fs_sysctlgeneric_bs_wm_4cluster_callbackkthread_run_deferred_queuevop_lock_vp_offsetswdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbipport_lastautouhci_endpdsis_setup_channelcd9660_fifoop_entriescom_raisedtruaudio_chan_opendb_last_commandicsphy_statuswinSlotCntvn_kqfilterem_validate_mdi_settingfiq_getregsext2fs_synci80321_io_bs_unmappte_l2_s_prot_maskcryptoreadpciide_intr_flagudav_ioctlcrypto_registercache_purgevfsem_led_offpostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferieee80211_tree_RB_MINMAXpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressaudio_free_ringudav_openpipesffs_setblockipsec_expire_acquirekue_stopatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionumct_dtrmsdosfs_createcd9660_startdb_output_linecomstartpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjiq80321_irq_mapsiop_clearfifovop_rmdir_vp_offsetstisr_writesbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printaudio_caieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootpmap_dump_allbufpoolMCFailwdccommandext_bus_dmamap_load_buffercpu_forkumidi_activateaudioopenwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initcast5_setkeydeflateReset__bin2bcdpci_ndomainsttyoutputkue_cacd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdwdc_atapi_intr_completecryptodev_cbumodem_detachuhci_root_intr_abortrn_mkfreelistvop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimesys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureufs_quota_free_blocks2re_stopsenditcluster_writernd_event_tailuriopolluvm_setpagesizeehci_root_intr_closetcp_xmit_timerucomwritein6_recoverscopeskipjack_encryptnsphy_serviceaue_ticki80321intc_cdticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmclosenumfreepagescd9660_accessffs_statfsuhci_shutdownrijndael_set_keywdcprobeiophy_cdudp_recvspacewdc_ioctl_strategyuaudio_cai80321_mainbus_matchbus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimiti80321_mainbus_foundbpf_attachdfintek_cdicmp6_ctloutputulpt_statussvwsata_dmactl_writeufs_dirremoveumct_setre_set_bufaddrrgephy_servicecinitif_attachsetuppipe_writevop_symlink_desccryptof_pollin_pcblookup_listensbappendm_copybackuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachSHA512_Updatedb_continue_cmdrt2661_mcu_beacon_expireehci_timeouturio_activateconfig_scanwi_get_nwkeypmap_copy_page_funcscsi_runningripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startscsidebug_targetsnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSync__wdccommand_doneumass_adjust_transfersignal_initffs_updatedb_print_formatrt2560_tx_bcnunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachip6_ecn_ingressusb_discovercomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolip6_savecontrolau_check_portspciide_chan_candisableq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_senseural_eeprom_readusscanner_detachlodirtypagesem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execatu_detachifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferdb_write_cmdif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategyem_config_collision_distnatsemi_irqackkmemstatsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthmntvnode_slockfilt_audiordetachmalloc_printitulptwritecomwriteuvscom_intrVOP_RENAMEcdclosecast5_zerokeysys_fchdirsysctl_ifqalleventsrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctluaudio_query_encodingsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVEuaudio_add_processinglastsecondswdog_timeoutpci_probe_deviceuaudio_signextwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopbrgphy_statususbd_error_strsusbd_sync_transferaudioactivateffs_vnodeop_entrieslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initsync_vnodeop_entriesproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsvwsata_dmacmd_writebootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctlsys_xfspioctlif_free_sadldb_dotucomstopieee80211_node_joinfilt_bpfrdetachumodem_openicmp6_initdisassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readrandom_statebpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadaudiogetinforeset_entryucomstartwdc_exec_xferwdcresetipintrqsensor_task_createohci_noopudsbr_statusmaxprocusb_frag_freelistip_slowtimordsizeuaudio_add_inputrijndaelKeySetupEncubsa_rtsip6_nexthdrrtdeletemsgumidi_cd__bss_startdcphy_cdpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descdeflate_compresswskbdreadsbappendrecordevcount_detachsd_causcanner_seltrue_filtopsixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrconfig_activatememsetcuio_copydatapipe_free_kmemufs_getlbnsohci_strphysioin6_selecthlimupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asynccrypto_kdispatchicmp_mtudisc_clonert2661_rf_write_spllowersodisconnectpool_allocator_oldnointrumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsthreads_pendingucomttyohci_device_bulk_doneusbd_initmtdphymatchuplcom_opensiop_lookup_productural_set_basicratesip_flushmidipollkue_startre_watchdogaudio_pollsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errorinpcb_pool_initalizeddb_hangmanukbd_delayed_decodebs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsaudio_pintvholdpciide_map_compat_intrubsa_parityurio_detachdb_help_cmdrt_if_removewdc_atapi_in_data_phaseusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchmidiopenm_adjalaw_to_ulinear8mld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckscsi_free_xskmemlimitrt2560_rf_writetcr0_readamap_copyphysical_enduvm_rb_spaceuhci_allocmuhidpollieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_maplf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfwi_rxeofehci_pci_detachskipjack_forwardsbrgphy_cahpt_pci_intrfilt_rndwdetachdead_badoppciide_dma_finishblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgateulpt_activatetcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closestrlcatpte_l2_s_cache_modeifnet_addrssysctl_int_arrulinear8_to_mulawau_set_gainbs_notimpl_bs_wm_8cdce_matchumidi_quirklistsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremcttywrite_bus_dmamap_createurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_cauaudio_chan_pintrext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readpciide_vendorsufs_opencopyout_statfspmap_modify_pvehci_pcd_enablei80321_intr_establishm_catsplxohci_pci_attachrtinittqphy_statuscluster_collectbufssiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inituaudio_chan_alloc_buffersuaudio_add_featuretcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msfiq80321_pci_intr_mapre_miibus_readregtimeout_setrdread__subdi3ntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishdupfdopeni80321intc_calc_maskchange_sign16_beifmedia_list_addpidhashvfs_mountrootrt2661_updatestatsxscale_context_switchuvm_totalencdebugdb_unread_chartimeiic_searchstart_initelf32_olf_check_headeruhub_attachrt2661_prepare_beacontcp_mssdfltrt2661_alloc_rx_ringi80321_bs_unmapuvm_swap_freetcp_rndiss_sboxwdc_atapi_update_statusatu_newbufdata_abort_handlerbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updradiodetachcd_sizettycheckoutqrt2560_watchdogread_multi_1piix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_lineaue_carnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabwdc_atapi_intr_commandip_forwardextent_createrdclosebpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_besys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeuvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatevop_pathconf_descbs_notimpl_bs_w_4m_pullup2dead_strategypciide_dmacmd_readswi_handlerspec_fsync__wdcwait_resetip6_optlenuvm_map_deallocateicmp_reflectmii_phy_activateext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsurio_cdieee80211_node_attachuhub_cduvm_km_pages_freewi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startbrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneem_shutdownspec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinernd_statesm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namericohrtc_attachsysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwdc_atapi_send_cmdusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalaudio_calc_blksizebufhashtblsyn_cache_lookuparc4random_stateprtactiveaudio_mmapksym_upcaseufs_makeinodeip6_process_hopoptsufsfifo_readusbd_find_edescfifo_writefilt_ttyreadsys_getpgiduhci_runcom_common_putccache_lookupaudio_clearrdioctluhci_allocxin6_purgeifobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writein6_ifawithifpieee80211_recv_mgmtaxe_detachdumpsizepci_matchbyidukbd_keydesctabusscanner_devextent_freeuvm_aiodone_daemonusb_cookie_noi80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featuresc_err1db_mount_print_cmdcomcloseiopxs_mainbus_casetsigvecsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchvop_close_vp_offsetsem_blink_led_startrndread_filtopstcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cdhook_disestablishexphy_funcsudsbr_setfreqbpf_catchpacketffs_isblockucomwritecbdb_stack_trace_printusbd_find_quirkuaudio_getuvm_aobj_poolhotplugcloseuscanner_do_readdb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedauth_hash_hmac_sha2_256_96uaudio_match_altbufcachepercentm_pulldownacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanminudsbr_startpmap_zero_page_funcarmv4_tlb_flushD_SEuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regukbd_cngetctcpcb_poolz_errmsgi80321_pci_make_tagBlowfish_stream2worduhidcloseipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryusbd_set_configem_write_pci_cfgvnode_hold_listlastdosdateudav_unlock_miiuhci_add_bulkral_cdufs_linksys_mkfiforicohrtc_matchdb_cmd_searchifa_ifwithafural_read_eepromin6_leavegroupsqphy_caiminem_reset_hwsddumpsys_chflagsobio_bs_tagdelaysdstartdb_machine_command_tableskipjack_decryptddb_regsieee80211_media_initricohrtc_gettimeipforward_rtableiduvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pvn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultire_gmii_writeregfifo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueswap_bytesums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffffs_oldfscompatrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachipq_lockedfilt_ugenread_intrdb_show_arptabcom_detachfifo_vnodeop_pvop_write_descaxe_stopvop_read_vp_offsetsbs_notimpl_bs_w_2ural_set_macaddrdead_printem_enable_mng_pass_thrueephy_serviceinphy_servicemii_media_tableswap_bytes_mtswdstrategytcp_rndiss_encryptttyprintfi80321_pci_bus_maxdevssigcodedb_elf_search_symbolhpt_chip_mapipip_inputdb_delete_watchpointcomttybuf_undirtysysctl_tstringdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediaputphysbufcpu_reset_needs_v4_MMU_disablevop_remove_vp_offsetsMD5Initem_txeofpcaled_gpio_pin_writeqscryptodesc_poolbus_space_write_raw_multi_2cpu_info_storeffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputusb_dev_openfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVEmsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchboot_eaddrscsidebug_busesscsibusactivatend6_timertcp_do_ecncomcnpollcuaudio_bsd2valuevop_open_descatu_matchbioopenqsphy_service__cmpdi2cd_patternsraw_detachaudiodetachpmap_get_pdeural_read_multibooted_kernelaudio_writemulaw_to_ulinear16_lebs_notimpl_bs_wr_1domainnamelenehci_pollacard_pci_intrpciattachusbd_get_report_descriptorip_rtaddrfiledesc_initrt2661_enable_mrrload_dsard_server_looptag_switchurl_ifmedia_statusatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmohci_alloc_sedem_set_media_typeem_update_link_statusprtrealloccheck_consoleamap_freein6_domifattachwdc_atapi_reset_2ugen_get_alt_indexswreadusb_blk_nfreend6_prefix_lookuprt2661_mcu_cmd_intruhci_device_ctrl_methodscddonesync_inactivespec_printlocleanpagesarc4_stirext2fs_lookupmsdosfs_openehci_hubdext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachtcp_do_sackradioprintext2fs_renameipsec_def_authmii_activateuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startumidi_hw_ifwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtssensor_task_unregisterehci_intrlist_timeoutpool_print1db_breakpoint_listip6_copypktoptscd_get_parmspmap_extractnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogbooted_devicecd9660_printohci_rhsc_enableif_congestionnfilescd9660_islocked__bcd2binuscannerreadatapi_printin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutrevarpwhoarewecue_txeofatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilternforce_pci_intrext2fs_openpmap_devmap_find_pausb_insert_transferaxe_matchmsdosfs_vnodeop_entriesukbd_keymapdatamulaw_to_slinear8stopprofclockdb_hangnullioctlukbd_is_consolecertance_irq_mapcryptof_closepte_l2_l_cache_modeisohashparsediskumidi_print_quirkre_eeprom_getwordalaw_to_slinear8wi_set_debugbreadem_intramap_lookupipctl_varsapollo_setup_channeluaudio_chan_rintrpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readwdc_output_bytesatu_ioctludsbr_matchieee80211_media_statusiophy_capmap_set_pt_cache_modemichael_keytcp_usrreqdb_playssd_interpret_senseudp_usrreqifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilteruaudio_add_processing_updownfifo_pathconfcpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferfilt_fifordetachdb_command_loopwdc_ioctlamphyattachfilt_fiforeadrt2661_updateslotfdexpandtickssrandomwdc_ata_presentpdc20262_dma_finishmsdosfs_closehotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateurl_setmultiusbd_get_device_descre_setmultiwdc_default_write_raw_multi_2uvm_pagedeactivateuscanner_attachvop_write_vp_offsetscy82c693_initufs_unlockmainbus_bs_r_2tcp_ctloutputrt2661_plcp_signalmono_timeukphy_statusMD5Updateblktochrvop_create_descifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractnd6_prelist_addufs_removeboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdwdc_atapi_intraxe_watchdogfrag6_inputuhci_device_intr_closeunpst_sendspaceffs_indirtruncieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolcryptopollpmap_pageidlezeromulaw_to_ulinear16_bemii_phy_statusmsgpdc203xx_irqackcpufunc_domainsVOP_PRINTfdsharepci_subclass_memorybuficmpv6ctl_varsfintek_matchcdstartfilt_generic_readwriteuserconf_disableumct_methodsspechash_slockusb_detachipforward_rtuhci_device_intr_startdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateuvisor_cddb_set_temp_breakpointdb_buf_print_cmdsys_nosysat_pollallproccdevswxscale_cache_flushDumodem_get_statusuaudio_process_assys_mlockallwskbdcloseuvm_sysctlmalloc_lasterruscanner_cdgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transferusscanner_scsipi_cmdpowerhook_disestablishcryptodev_opfilt_audiowriteukphymatchuvm_pager_putohci_device_bulk_abortudav_caip6_ecn_egressin_canforwardohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutwdc_cdmmopenffs_inode_freeSHA384_Update_intohci_device_intr_transferpci_findproductamphy_statusukbd_intrrtioctlkue_ctlieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputicsphy_cdwi_usb_cmdresppagemovegeneric_armv4_bs_rm_2route_srcspeedup_synceraudio_blk_msigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_cauhid_activateufsvnode_filtopsreadbuffersuvm_fault_unwireuserconf_common_attr_valuhci_add_ls_ctrlobsd_pci_io_findumidi_detachext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartetherip_inputcpu_configureip6_freemoptionssqphy_funcsscsi_create_task_threadaudio_alloc_ringieee80211_amrr_chooseieee80211_end_scancdce_txeofpool_page_alloc_oldnointrpmap_fault_fixupdcphy_servicern_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelvop_generic_abortopsetregsupl_rxeofusbread_filtopssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkaudio_ioctlwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectmsdosfs_reallocblksvop_readlink_vp_offsetsuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessurioioctlrt2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodsuvmspace_unsharesys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createem_hash_mc_addri80321_timer_initeduvm_map_cleanicmp_redirtimeoutulinear8_to_linear16_lettyclosewdrestarttrr0_readdisk_resetstatugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freecmd0643_9_setup_channelural_write_multicpu_initclockscue_sendwskbdioctlmii_downrn_mpath_hashkinfo_vgetfailedbrelseprobe_addrsext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miiaudiokqfilterttyoutdevice_lookupuvm_map_pehci_device_requestDebuggerwi_usb_txeofudsbr_stopcdminphysnumcleanpagesschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputre_setpromiscuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baseSHA256_Initpci_subclass_displaylooutputtasklistcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonecrp_req_queuepmap_clearbitcrypto_freereqclrbitsdb_boot_dump_cmdxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorscsidebug_levelcrypto_newsessiongeneric_armv4_bs_r_2soclosescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonuaudio_get_minmax_ratesskpcrd_sleep_priluphy_funcsdb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vop_read_descswitch_exitboard_startupcluster_newbufsys_socketpaircnreadpcimatchcertancepci_addr_fixupudp6_sendspacedounmountuvm_swap_allockthread_create_nowalaw_to_ulinear16_betcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizepool_cache_destroyttspeedtabulinear8_to_linear16_le_mtsns_scx200_setup_channelkqueue_readcd9660_mountuserconf_maxdevre_pci_attachcue_initfork_tfmratesiop_del_devacard_setup_channellxtphymatchusscanner_sensei80321_bs_initpv_sizewskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevuhci_devdciphy_causcanner_matchupl_inputauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1raw_recvspaceieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatsums_detachcdce_attachavail_enddes_ecb_encryptudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrpcaled_attachufs_readdirgeneric_softclocksys_flockarc4random_initializediq80321_startpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatradioioctlmichael_finalvn_initialize_syncerdxscale_controlcd9660_quotactlicmp_senduhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogvop_bwrite_vp_offsetssiop_ppr_negwdc_ata_errtime_uptimefilt_uhidreadsowakeupinsidebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashremsensor_findip_fragmentusbd_endpoint_countsys_statfsSHA1Finalsensordev_deinstalluaudio_attachrawin6pcbtablepmap_protectpool_cache_invalidateslinear8_to_alawkprintfdevice_unrefulpt_matchrc4_keysetupdcphy_matchscsi_startin_cksumvnode_poolrt2661_rx_intrdeflateInit2vnode_free_listtcp_savetiuvm_pagereallociicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadaudioprintpool_printitubsa_flow_endpciide_attachdes_check_keysogetopthid_report_sizearc4maybeinitricohrtc_cdmidiwritedb_deletewatch_cmdarp_intimerpollscandomaininitsii3112_setup_channelvflushbuftime_secondacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachuaudio_add_altbioioctldvd_read_structvdevgonehtonsehci_pci_attachubsa_setdb_show_callout_bucketkqueue_writesys_syncbucketieee80211_reset_scanaudio_selwakeupcominitrt2560_newassocenodevobio_bs_barrierffs_mountfsudsbr_reqin_delayed_cksumslinear16_to_alaw_bein6_is_addr_deprecatedfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startabtstackspeclisthbdwriteversion_to_spcVOP_INACTIVEpte_l1_c_prototcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initwi_write_record_usbcue_csr_read_2uhci_device_setintrfileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollural_startsys_swapctliic_dumpbd_reqbs_notimpl_bs_rm_2in_selectsrcmsgscpu_exitip6_initpktoptsbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDuaudio_match_alt_chandisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsbflushehci_device_intr_transferipsec_require_pfsswapdevsiop_devwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closeem_write_vftastatminehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptxscale_setuprt2661_set_bssidpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolbufq_default_addif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_rateinvalhashuhci_rem_loopuvm_km_page_initrttimer_poolieee80211_regdomain2flagrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimitrn_initcmd_channel_mapbufq_default_getloopattachusb_match_devicesiop_update_residuscanner_detachural_rxratewdc_input_bytesRMD160Finaldb_listwatch_cmdrt2661_set_slottimeusbd_do_request_flags_pipeprocess_read_regschainlengthwdc_pdc203xx_vtblural_disable_rf_tuneau_get_gainrn_lookuppciide_ati_productsuvm_map_reserveuaudio_find_ifaceuserconf_show_attrsys_execveite_setup_channelamd756_chip_mapfdallocuaudio_match_alt_subrt2661_alloc_tx_ringscsi_donechkvnlockhw_sysctlrt2560_newstatedb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescryptof_ioctlcomreadurioopenuvm_pagefreeehci_device_isoc_abortukbd_decodeext2fs_inode_allocswcr_encdecdb_examine_formatin6_pcbbindcluster_rbuildreapercoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readaudiostartpuhci_root_intr_closeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadcast5_encryptsys_exitsbtryusb_desc_iter_nextuvisor_matchm_applyswcr_processcryptof_writeudav_startaxe_lock_miirt2560_detachwdc_exec_commanddb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getresaxe_attachsyn_cache_insertspec_bmapttystats_initpciprintpci_mapreg_probemidiprobeem_allocate_receive_structuresbrgphy_ber_bugncvhashpool_cache_destruct_objectucom_matchnd6_umaxtriesohci_device_intr_donedcphy_resetuaudio_merge_terminal_listi80321intc_read_intsrcnd6_debugmainbus_bs_r_4umodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_idget_random_bytesurl_csr_write_1SHA1Transformesymfiqhandler_stackcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetucom_cdusscanner_donesiop_update_xfer_mode__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changemakefstypedb_paniccddkdriveruvm_anon_adduaudio_closeuserconf_helpufs_advlockicmp_initsii3112_chip_mapuvm_growcsecreatevfinddevE_ldsa_abs_reselected_Usedif_detached_initral_pci_attachpciide_unmap_compat_intrdopowerhooksehci_device_bulk_methodsether_delmultivfs_op_initdb_history_currmainbusattachrn_mpath_initheaduvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlwdc_atapi_startsys_getresuidsys_fhopendos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_pooluaudio_cduvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsys_fchmodvop_strategy_descudsbr_caatu_watchdoguvm_unmap_detachvop_islocked_descehci_add_qhupl_inituserconf_common_devvfs_mount_printuscanner_do_writestartwdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbadaddr_read_1vnode_free_list_slockcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixext2fs_specop_pvfs_unregistermii_phy_flowstatusselwakeupem_update_adaptiveumct_set_baudrateffs_reloaddb_set_watchpointsem_initialize_transmit_unituaudio_ctl_setmidi_out_docnwritert2661_reset_tx_ringumass_bbb_get_max_lundb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lewsmouse_activatescsi_scsi_cmdem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrehci_powerbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivesys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputcd_pausehashinitttstartumass_setup_transferrd_ioctl_kallocciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsmidi_attach_miuhci_hubd_piixin6mask32__moddi3disk_countohci_confdscsi_detach_lunpmap_page_protectdead_openkue_setworddb_list_watchpointsatapiscsi_matchtmr0_writeuserconf_attrwdc_kill_pendingrt2661_powerbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeplxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfself32_load_filesys_getpeernamert2560_prio_intrumidi_attachi80321_bs_subregionchange_sign16_be_mtsehci_device_intr_closeehci_intrdb_taken_bkptdb_eqnamescsi_strvisbpfwritedoingcachesys_getrusagepdc205xx_do_resetmainbus_bs_mapaue_reset_pegasus_IIcryptoioctlnd6_prunert2560_set_chancomconscflagm_getffs_truncateuhidevprintmii_attachuvscom_cattylclosecmd680_chip_mapmd_diskconfwdc_svwsata_vtblpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreedb_show_regsuhci_reset__wdccommand_intretherip_outputrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modify__one_cmpldi2wi_usb_rxeofcpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_change__muldi3mbtypesumct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiiq80321_pci_intr_evcntip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_cabufinitinswubsa_closebootconfigscsi_quirk_patternsuserconf_linesuaudio_ctl_getdeflateInitlimit0ciphymatchE_abs_targ0_Useduniqdosnamedb_recoverudsbr_activateusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolucomstartreaducred_poolxscale_cache_purgeD_rngdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrylogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenrt2661_intrdb_machine_initvop_abortop_vp_offsetsuhci_cdfifo_kqfiltermidiattachkue_activatepool_page_freewsmouse_inputwdactivatecopystrwdc_do_resetwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initproc_trampolinesys_rmdirem_attachcd9660_vfsopsem_get_bus_infoinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffarpioctlffs_fifoop_pfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimouhci_root_ctrl_abortwd_shutdownudbtabledb_load_countwi_setdefwdcattachchange_sign16_le_mtsufs_printem_rar_setfatentrywi_update_statssiop_startusbd_printBCDntp_tick_accsys_statrt2661_txtimein_baddynamichotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockalaw_to_slinear16_leuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenbus_space_copy_4__assertif_congestion_cleardb_put_valuein6_prefixlen2maskudp6_outputcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsets_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_alldofilewriteehci_device_isoc_closeipquscanner_camsdosfs_strategytimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategyiic_cauvm_pglistfreemidiioctlusbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrubsa_methodshid_clear_localscsi_sizergephy_capci_mapreg_infomainbus_bs_barrierrt2661_free_rx_ringuvscom_cddb_deletegenericconfget_bootconf_optioncrypto_driversiftovt_tabsysctl_int_lowertcp_backoffmainbus_bs_w_2sys_chrootehci_odevdwdc_ioctl_freeubsa_cdavail_startieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portreseticmp6_redirtimeoutenc_xform_dessoisconnectingmtx_init1pci_subclass_processorvop_link_descaobj_pagerscsi_task_threaduvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformumidi_matchmld6_inputgeneric_armv4_bs_sr_2vop_link_vp_offsetsrgephy_mii_phy_autobpf_d_listuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purgemidi_ca__data_startifmedia_delete_instanceE_ldsa_abs_data_Usedurl_caucom_breakpdc205xx_pci_intrudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndwsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKehci_root_ctrl_abortsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressether_ipmulticast_maxuvm_init_limitsukphy_cdsii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeokaytocloneVOP_POLLVOP_IOCTLstatvarsafepriaudio_init_playsys_rforkluphy_cdwdc_default_read_raw_multi_4uao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectradioprobeuvm_vnp_terminatepool_cache_putwi_usb_rxfrmz_allocsensor_task_threadsys_getpidnd6_defifindexipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchfintek_read_regrn_addroutetrr1_writesdactivateem_cleanup_leddb_print_sadb_elf_sym_numargsural_detachdb_trapperradiocloseukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenem_allocate_transmit_structuresnforce_chip_mapmulaw_to_slinear16_be_mtsem_mc_addr_list_updatekrp_req_queueremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_reglinear8_to_linear16_le_mtsehci_device_ctrl_donend6_lookupieee80211_cache_sizepager_map_wantedurl_openpipesukbd_countrylayoutsys_getppidmii_anarVOP_READDIRdomainsem_led_onsys___sysctlaudio_calcwaterarm32_dma_range_intersectin4_cksumextent_alloc_subregionuscannerwritedb_putcharrt2661_node_allocneedbufferusscanner_cmd_cbusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4uvm_rb_removeohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathtickfixusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobemichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesohci_softintrbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfmountroothook_listrt2560_powerhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablexscale_cache_clean_sizeucom_activateip6_rr_prunesbcompressiic_smbus_receive_bytemsf2lbapmap_free_l1nd6_outputrijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimeohci_device_clear_togglevop_kqfilter_vp_offsetswdstartamap_splitrefspec_open_clonewskbd_do_opencryptof_kqfilternclruheadural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockuvmspace_sharert_timer_addpci_get_capabilityieee80211_print_essidroute_usrreqdeextendem_receive_checksumtcp_dropicmpstatcom_irq_overrideudpctl_varsm_prependvop_advlock_desccd9660_pathconfin_pcbrehashre_tickre_resetin_arpinputehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlunix2winfnreassignbufuhci_confdsiop_minphysip_freemoptionsnetconums_matchsohasoutofbandspec_vnoperatevop_ioctl_descddb_initieee80211_release_nodebs_notimpl_bs_c_2nd6_dad_duplicatedfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4ether_crc32_besiop_setuptablesieee80211_add_ssidcpu_reset_addressuaudio_get_clusterpgfindvop_lock_descatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastrqinitloadfirmwareuaudio_chan_free_buffersswcr_compdeccd9660_ihash_slockral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerurl_csr_write_2cd_switchiptimerip_inputaudiowrite_filtopswi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptorudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortrd_root_imageffs_syncuvm_map_submapcnioctlrt2560_startufs_vinitehci_noopuaudio_devicepool_primepgrphashtblcomconsinitsddkdriversys_getpeereidifmedia_matchstatclocksiop_ppr_msgaue_activategetnewbufrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuvm_mlk_hintuserconf_argbufatu_media_statusuaudio_chan_closeMD5Update_intm_tag_copyehci_idonesiop_pci_attach_commonpci_io_finddb_value_of_namepmap_l2ptp_ctordata_abort_entryhid_get_itemmsdosfs_getattrdb_find_breakpointm_devgetntp_tick_permanentwritedisklabelmsdosfs_printkernel_pmap_storeem_write_eepromstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachsoo_ioctlforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readicsphy_servicenull_setkeywi_send_packetin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockaudio_initbufsre_gmii_readregupdate_modifierdb_breakpoints_insertedpdc203xx_dma_startswdevtblf_decryptdisk_lockuhci_initsbwaithotplug_device_attachufs_reclaimrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debugwsmouse_cafilt_logreadsysctl_rdquaduaudio_detachuvm_vnp_setsizevmcmdset_extendural_cadefault_product_descip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachufs_mknodsbinsertoobknotelf_advlockpffinddomaineephy_resetfreeem_phy_get_infopci_device_foreachricohrtc_setcalusscanner_cleanupwi_ioctlugen_get_cdescieee80211_compute_durationswstrategyuserconf_pnumehci_allocxscsibusprintehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctlaudio_defaultiicprobewuscanneropensonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdogcluster_readtcp_saveti6wdctimeoutnchrdevieee80211_merge_print_intvlundefinedinstructionaue_cdre_pci_devicesaf2rtafidxpciide_canatsemi_pci_intrpciide_chansetupqsphy_catcr0_writeshmmaxpgs