ELFa( 4D4 (   <<`(`(`D`d`d_DO! "&@00Q_: 0/`D\@/ XX@0 6QQO @@( @0 P`D  B00 R Р -Lp O`dgk`dmain() returnedDUk   ),@@(TQ 0/tqdUk -`LP@p@D0D 000``@ - 0LP@p`` V -L@P`p 00  0 0 0 0iY -`Lp@P 0x 0s 0n 0i70/) 0 P@0 T X@P 0PX - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,PK K 0 KhK@:@: p-LM@`P3PUOx3e H0 PK00 h0 \8K3 @K89K3  : KKA:$A: ";8A:HA:A: Q-L@K0 K\A:hA: p-0L @P ,00,0 R 0$ 0 00  0 ps,0`0,0 R 0$ 0 00  0 Bphhh -PLX4p`V$ 4! ,0 J0 8K5K2K,0 000,  ,  0hsP)@0D PT,0 0,0:@5;A:A:A:A:A: 0-L@P,SC@LT ` i0hh -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  J?4S0=0ShMK0 p-8P@L@`4 00 00S > S 0 p R  B  hI 000 PHXp 0 00 HB:hB:8B: 0-L@LPl 0( 0( 0h' p-L@`R PUP00SxXP ?lp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ u0TTPPQ @Om@ W00000@TP3038P060 0 308#83 R 00  r @006h < p-L@m P`dU  000PY YR`pp 0-LP@P 0@dH@ @0cP' 0H@ 0V 0' -LM0` Pp @20S3  09P.0  0*0,0K0,0 KhV  KhS0S 08#808#80KhP q 0P00 0S  0P3g4 $Kh, -0`10#LP8p @P@ 00 0000  0 0, |0| 004 P`0  @D0@  00   P  B: -L M0PSp 0S` K@K tePS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0Kx0  EPXL0@ EP0 0 0   i <8 p-L@P@04`!K"@zp -2L M PRl2   ``0KST2`0 0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 3dp0p|14 EP=303@To3 `3`V㏏H0"S3R1  K0 ,pK ]c3 00,0K,0K3 f @4  0+@K*K( #Cc#t003 P3,00,0PQd <  00 `P0 R0C  (P01Ł 0PP8 x+r 00a=C4`#hl 0d@x0S 40< `*  `0:0'8'B: p-0L P@p0`   000s2  R` ^P00 S 0壎PV@p$$LVk$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R < ; ; ; ; < p< ; `< 1 8 0 R 0 0 0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00t$' -41` BpL R > > > T= > T= T= T= T= T= (> 0GS= = = = = >  0 0AMP,@ P l0l pᲀ\0 R    t -L\M4@KP )^03K/P3#K 8#c[Qr Qn 0S3Q   ^2 3K2#K 2["[`0 2[d h0  ]2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@>(K T1   D1`  T!T1QQZ@K&]05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D>'<8$ $;hQC:B:v'N$B:B: 0-LMP%l0  0H0@@0!0@ 8H=88' -8L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- !0h%V0CRt 72RD >0R@2@ 0C 0h70CRI l2Ry 0R @C=@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0x1@@0H@0 m\3 i\001@@0 1 0h1@@0 0 0 #0h0@@0 D C\0 0h 0 0R x=00 0 $ C$$$HC: -MLM1 0 p 000CSp(KBKII  D 0T `0S` @ T pP@VP8K Z8K Y0l"0C4K02K#K t B("(04"43K@QBK0 5[90K 5KY*K YL @ 0 Bh$[4[Q04KD 0 D B0000 <  L @0 Bg,DPt 0 P0! 0C0 0 a0 RB :Y0 R 5[TK< 35K06KYNK YpPt w5[3K RD0 <0Ba#$@D:'PB `@p10C0P XP  XVp W@P0`(,("(8#8 (2S W@` dX0008#88K@0 $K 0 0' 6S-LP` 8SB  9p 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<`D:$ -LMt!0 0 @P  @w9 4QPEuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'|D:$ -0L R |P|`|@0 $<< p0T6 0Ti,$ 0-@LP@840 00 @0@0D:' p-0L M @RP+ 0`0 P PEu8KpUt 000\01KP01K01K0K 00P$'D: -0LHMp$Kh`KD1W0 ZK P.W H(@"(D0#K0K"K0 0H00< 0 04P  Z8{' D: -LTMl p _l p@Oh?` B$Q  | B$8/0 >$?P  &XE?n*T  C>T N0CT R>Tv >TA-p, 0lS X >Tc 0CT 0T  p0l0X 4X. X0S x x\ . 0:00`4(K=T !=Tv =T5 =TP 4XX l 5@ x xB$h=T` '0CT 0TP0= R   p X ,OP4X 0 S <R  R 0CR P= Xp0X,岅 t hp0X `,'P l 5@? < R; X,P gLPpaX [@P <p X X+PX0 \U;Q= ;Q 2 Q;  Q K0XPXPl 5 0"0p  * 0*0004K?4K X;$K NK:Q !0Q ;Q :Q :Q |:Q t:Q \:Q\ L:T D:TF <:T0:T# (:T :TPpfX 9T:p X 9T 0Tl 5D = S @S 9 l0%9 p!X 8 Rp 010   ~,X X0/ H9 XPX0 8R p 101zl 5 8 RB 4Xt8X 0X <08 XPoX 0 Sk !BX0 x Jxp  ! zxJ/Pr !+p0!  x P xX 5 Q;|7 RᏝ@` ]P x @N`K@&@T@,7@4KDK hG$K HKT l x5 0x P(\6 R l 52 6 R  $l6X 0X0)   6 XPn(6M@ V    6!l%0@a a  20C%l 505p0 0S/ 5 p(X P4 R }(5X 0X0, @5 R 45 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UY t0 `:  |@h S h t0 0$30 R0S   S05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hSPx00x0p0\ | ;Pp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 pMX P p X X!卂PrX (2X 0X0, @2 X@PX p0 ` \1X 0X0, 1 XPX0 p0!Pp 1S ?X 0p 1X 0X+P!l 5$1 1 p0{@ LVkD:ii i5i i i iiii 81-71$%Ci8i|6i(iii8i i #A#<,0X ꏝ@ x IRxP X 00"0X 0S00' XD TR!D2 RlBX0 u B0X 02X 0000 X 00200X0 T /RX +002Q' D0CQx >0QBt3Q. 0Q;(3 R}X H3  jX3 s +l3 n h3 @i `3 d XX0 L3  W 3 R 3 X:1>,01 -L R6 l 必 R6 l 0X @R6 l 0X 60 `@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC D3P 83QX Fd0CQd  80$P/ @sR8 p 0X R8 p 0X\ RL8 p 0B2  0lP (K0SD2.`K0K2K02K(2Q: 0Q0SX2K?2K.`K02K00C SKP H @ ~ 8 0 ( ~ ~ ~  0!02K0"K.`K2K 10S: x10S. S08#[.`KK}H!TK0@20pPK&)NW?D  K5KN0 P@T0 R08#P 0H2K.`K0"K2KC      $$'!'#(( $$ p-LM`80@GPP<<0 R0C8 p 0Pxx$ -3LM PR@v"0 0!P$ 80P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 00? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@  (   (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# $'$ #'(( -LLME0 P5 0Rx5 RN ,\`P ; R\1 [0 0@0@(KDp0p P <C42 D@F Q000P@ @tP  6T4 RH4Q [Dl0KP6[p5[p0 [`P ; [1 p0 00pC bp b3 R 6[* RV  RT  RR $[Qy0H# 00. Px$3 P  5[  2 R 2 RlK =P dS w--[T0 0S Sk S2< @>h<@0 fP`-[=  A$[P& >K K8K K *K K 0  0D P 0 0@0@Z+-Z갤[>0P 6[T-Z lKK0 <0< P Z8 -<00 0lK CM@ 0Yp GP 8 ,Z00 @0@C= G(0 2^ XK''$ $E:E:|F:F:\F:F: - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X2S090 R0C4 h 0X0 R0C4 h 0X{ R4 h 0X R4 h 0X~`$p -L$M8888H}/` `P, 8 $K4K JKpP +, 0R(K3 FKxJ@ U+` mJ70P8$ ! 0|1( !! `  P #DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P#[C=C=   6Q Q) Q +>3K ,6$K P3[SP&000  0,< TI 6:@K3K 03K5 P5  [^5ࠃv5  P AM,@%5 0h 00 !R듍 YPP 1 8D  G`10 3>0P8PD "2R:0O  1  0 0@0@@0!0 1Sq@p10q"8  "0% B`&P 0/WpP 1<1202XTJ:J:2'K:ʚ; - LPDp`{P pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=0h 0 0P0 00@ D8 -00 pO~H&$$& ' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP  VpPQ 3Q> Qb 8 \ PD2  3ND  D D 0Y$ 2ᲂ $ ڨ K0 K& .S8% L 0%2 R@ 8 %1  1!Q ʼ89 @pWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1g% c%@PU @@PGD@T 8^  L%6PP@101A0@0' HK:tK:L:&&K:K:K: 0-8]L@P C0 R 0t0t P00h0X0 qP  x +>8  0h $$&$$ 8L: p-CPID@DL`v0 #DB@@0 00 R 0\00 0   R 0 0 0 @P 00C0p&$& -LM8pş@`h5P, p P5MQ@| 0CQ 0CQ $pş, 0R(K4Q :4Qpp4 @T  0{S|㨐K3 000@TI 0|SE:|pH| C K  KC=06KK3 4K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | grpP 긠K  qpP@3 .@T 0S`؀K@T 0`S:pF BK K3"0 0t h- T*"@H 4 @2NT&$M:$M:8d -`Lt2@T_ 1  [ W0 @20  ,1:100 @@X00W00S6 !@ 2 00p5 8PR e1P01 0t10  `1:100 81@@X00W00S0@T 1 * m 8P) !001 P0 00  1 :1 PP~! Po!$$'M:N:v -LMP`p 0P@   "0T 0P  @0T 0P 0  T)40 T0DD @T0 T 0P  0T 0P 0P   0S 0  \v0 0 0 d@@T  $@  0 d -L M@, 0 Pp 0 `  "0T 0 `0 T&40 T0  TJ40 T 0  0T0  00S ,0 `(Kou`0 ,04(K 0-LMx 4 *0K)KtXX R 04 d@N:`N: -L8M0s,0 #PP S  8c<$0  @0 0 N0  T  0 T> !0T 0 . $'!P @PŸ, 0R(K $  "0T  0  @@ddT  $  0T00 0  0T00 0  H0T 0T @0TJP 0  P'LK 0  @ P$LK =P@/  I0T @0T 0TIP 0  PLK 0  @ PtdLK <PV@00 0  0TGi'l AB?PP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0 <$1d -,0L8l02 0 <$1d0 8 <0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ <4hDpd8h\d h$0 R0 R4h < -0L`4Pm 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T  $  T 0pWd}~@ $ pW 0@W}~ $0P0P@0T @N: 0-@L 04 00P T0h -0删S/0 4p 0  0LT&40S  $  0PT  0T  0T  0Td@T T* 0  T0Sz S6`  , 8 l  $ PF P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00|  $0`  T  $Z0P  T  $0@  TZTU000Z ,0{ 0 S0 00  0T  $0@  T@0  T0@ 2P |"|Ÿ0 Sj00 Sh QPxTD Z<8 V, Pl{ 2 R0  0@]ZQS000MQ F000@=0@000\X.0 00D1 R0 0"l(mh  $x0 r0$ 0440 0Sx0 .0 @0 0 l000 00l4hN:Dpd\d O: , O:O:4O:pO:O:N:O:O:PO:(h ";O:HVk <,h'hO: P: -PL `p@ 0T@DD0 @T0 T 0T 0T @0T0 T $i -LMP@pP 0`P  0<<0< 80@` ,0 $ $0p$h  0T 0T 0T 0T 0T 0T` $<<0 pT| <0h -04Pp008@L `T0 T0  00^  0Td $d0 T0@00C S t t ( ( ( ( ( ( ( ( ( D  $0 T0  h 0T 0T 0T 0T 0T0 T - LA8P4pt0`  0  l0 20 Dt0  [t0 0t0 ~Z1000 T<* <$1d - (LM$(" P4 80 W0qWS 8P@U5 Pt5% 0 pE   8߶P뀀 0 X t0  06@(K4  0S 0*@\$%$5 ťt/*@P t  t0S ) 0t@́t/4 0 0@>K0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P0 =2S, 0 ,(4 000 - 0p`L<0@@p㟾P4 p-PL@ᐾ` 8 0 HphͿ 0-PL@ R 0 0 0 ( H0h軿 -LMRp`4`^R 0K0S@C  TP,@ 5<*U   0010#Q Y@, Z<, 10"0 0  wU ,00010# Q#0,0@0S@ pKX00090KW,o謽c@P0hQ<ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `(08 08p090(Ko輼(K<0$(Kob <  (Ko\ ᓼKp 0K\PPP@@   ,0 0  (0 ^ 8t -`P(0 SL4p8@P 00$1l00< @0, 00 00C 00$P202L@0080004 -LMS<0 <0GF, 0@,08 `,00 Ǡ0F0R4 p8 @84j:#:zc>0PP*3 S R 00 = ```0F  0P"0X$0= @00C 00 市`P2p$<\ (K, 810\0S 00  0@P4P  0 0B$@Bp -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@;,0P , h0440<0@ % 10<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`04 08lBpt2  B l—0p \0S <2S ! (KP@T TP0 H0 ,!` ;,8(0!80 s2Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 Y@ 0L0=@S0 R8S?X20CX2Z$pW@$0S 4 00lB pt2  B l˜p 0\80S 0 000@RH<0S800@R:R08. -$HLT H0S$8>0(8 'e 㻧@P 0-@|LPP PPFK[0 -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00y@YRỸ, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KƒV8V!0NPPS񟗆4! !P!P!P!P!P!X!P!P!P!P!P!P!P! !! ! !T !x!7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL!!P!!P!P!P!!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!!^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@dZ=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( R8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0K^ 0N4S= S* SH(U@1@# H8 C4  0U00U  *%U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e ŁT@# ῁x ềP \ .  i#  #<<8XQ:<<<\Q: -L@OP 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!$W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 mO 0-=2LSP 0㗴,@E0hԵ -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 (l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,@`lB pt2  B l•p 0\lH`X80X8 jNP`y $X(`0X8qQ:Q:Q:lQ: 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJW=2 SlBt2p l•p ,4 0S 00h^N -0 L=2S<2S 0-LPMP@0YT0 -LMP40, =Z 40 000 p8@`P) 0 &$ 170<0@ ,0 00C  0"`$PL@0,08`090]<2S(K a( -L@MP 0h -LM@P ` =2S  $K0 40< ?@0(K8p(P060( 060(202( 0(0 $Lpɲ(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S <2S P@ (j$0 0 ,! !0/8 $(8 80pSP (Kx2|" ,![04]P I 090SP < 090IP0 0@9P02>U 0 .P@50E?01P E 0R904 0 @RJ1?P5|@TZv sp8tR 3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ gd_UlBpt2 P l— 40p\dMUlBpt2 P l—p 0\@ tl—pt2  l2p ,@ T,@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  h"`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\VTlBpt2  l—pH 00\lBpt2  l—,0pL \0@ 2TP+Tl—`pt2 ` l2pH ,@ T0@T 004 PH LHlRpt2 ` l—4p1 \lBpt2 P l—p 40\ 0`2xV0`2xl;; R:4R:HR: -LM0A`S@!?!HC 0Cl–0b "!HQ0p4 \lBpt2 p T8L! l–p1@ \lBpt2 p l2pH ,lBPpt2 p l–p:H \lBpt2 p l–P 8p\1RlBpt2 p l–0pH \2R<2 0CL(<2T(P(i<2l–0<2ppt2 Pp l2p ,LHT lBpt2 p l–0p \2Q<20C<2|PXP0=2l–Lpt2 p l2p ,l–Ppt2 p l2p4 , TlBpt2 p P(l–`00p \l–pt2 p l2p ,@%I$ p-T0L@`TP @T :S  @Tpph -04 10@LP  >00x*R90  q0@-P( HT X) 0!"4# 8̓ \0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0@-Q 9SD!D!D!D!D!0@9I )Q 0@ 9I) 0@ 9I)0@ 9I)9S / -bLV@pȐ\P RU00S ʜ\PQ 0P'S% 0QX 0! "4#8<V+*9X ",0( 4;2( +>`P VX ",0( 4;2( +>$0"` 405 6478`:p ?;P L<$+4"2X)540674 8<2X)! 0"#4 8̃ˆX405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K y?c`XW? X -L^P`p@ P@X) 0!"4# 8<^P@+ " "202 0-X@ 0 9PL)p 09l#R 0 㗪lp30TD! 0-LP@@DT0"; 0-@LPD 0 0 9@)0h| -@8LP R000<0 0 8P0,000$0(0 0-PLIT R0009 0  M0 -Lɐ`p0P$ 0 0`0=00000090000p匀@@ 0<@H08@4:8 000,0\  D ` p l00l0LVk -0.@L 0_P hػ!pR: -L M0 4 X, 04 8 P , 0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, 04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@R:R:R: 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0S:R: 0-PL@00P4@T0HS: p-@LP`娩h0S @00 000 < <0P< phުn`S: 0-@LP㋩h0S Ϊt#8 0P80< 0US: 0-LMP~@# 00  0   p (00(0 ,00,0$00$0K04 @ !S:S: 0 -L4 8<SS: 0-0LHPT JT XX  P00P lQp0p0p0:lp0*R *R lQp0p0p0:lp0 *R*R lQp0p0p0:lp0*R P㚘P Q00090)R P㆘ -L@h -@L R 0S0S PP  0S00` R0  00ph 0-@PL YU 0)9  @2u)>0 9Y   @)2@29 P R0 p-dPL `R@ 0S0S  R  CP00ppph -LXM@ %3,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(KT: 0-LP(0U@  0h躗; ";`T: 0-XILPL @508 H 0 48  ˡ$ 0R K i 8 -LM@p`᳧91XPU UV )1X)p 0@`yX`tpi0 Pk Ki֨T: g! 0-0PSL S 0l0*lp :Ph0S 8@0Th0 @T0h00l Rp0p0p0:l p0   6T: -`LpS Q9 Q7 Q3 Q@: Q, @00S"  0R& 0040S 40S4`l0:p0*l`> 0@P:TJ 0Sp0 QiY 0Rp0 QT: p-0 LPsP3@0`l9L:UH D0 20l#PP0l9-%pPU:< -*ML 0wq 0SR !i -L@M܀0P$0  `R00p- $ 0R$ K^@K:JW [ 0 Z0KW K[K^pK]pK\KX @VKX HNKX X>K: i8 -1L MP U$ . ,@K P$ xW! hiV#`V P0 48<S@@T (T P < $ 0R KzW ,  P0 48Q Q QD H ӕ0 $ (,  y 048 <   [Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   ㄕ0 $ (, B4 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPP> i8U:U:48 -LM Xy@W ßd9 "10 0 0 +P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00  !" 4#`80 + 0 S ?04X@ `p XP1X#\   ?04X@@,P_e(K 00P@K00@@LVkW:`W: -L,Mh$V0,0 . +^jV* X p P4K <4@T@T  pPP (0 @  P h@+^  P@8T, 0R5(K @ X)04 8 0S> X)0,0 p h0]e Q@ @8 R 0 S@RlQQ 8 R 0 S@RlQT 0 ;xY,h *0(Kox0S*+4P@ዋ <&\ $P2"0CR202 0S00㼉QOZ:Z:<[:$[:V -LMe\pK 0, ~PP P  d@, 0R(K  8@,:}K]@P @U 0HqP yZP@ 0 LqnZ.K0@qP 1 S  t02(K (RQ 0 @ 0"qDZW/K 4"  @  ! 2  "<K@K  !  Q \1`02 h K"00B@(,"042 B<K8 H0 i@X@ "m0a 0 0 0 /0C B0 0C B0 <K     = B1#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@$ !1H0!X tĈXdɀɀL  h ᴈ " 2|9gP"O$"R' 0S0202@X PYVZ Qt  Q F@ ‰iZ:x[:8[:LVkedAV:Y:hT:pT:[:xT: 0X: 0-@1L PR "RE HT P0S J0T0R R R 0 0hY|)R \0S \0S R`w0 pP X)p f00h*[:\:[: -L8M0pXK@`P 0( dɔ\048 L1 $(T\ 6( 0Rc$K"1   P d X1U8@K `0` mP 0 4 8,R* R R 004 80 0 @00 @ @ @Xh ^04 8,P00 $imarc8\:8<\:CRAMp\:T\:xT:8 -LPvM0,0 ! j%((0"4#2r 40  $yK4[P l ! Xß, 0R(K@ß@ 0nP  X.K0DoPcŸ 0n@PW1 S  `P  P !>KdIA 1 1K01 <Qp_ 0S%40$ $yK! ZPK 0nP@0 @PH048 1 $(Y |!0 {nWX 0rnWrD>@1ZL K 0 0P$ 0 XnzWnVR iN0B  (≆@ ㄆ <100 $0@i\:LVkedA marc8CRAM]:P]:X:\: -LM0  80 _pd "10!P040 Q|iV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VY 0(K0U \ 0P,\ \ 0\0 4 . 8X 0,0 000 8㶃X | hp6lP9`SQ 0:X `@ p lQX) p ` t, 4S PX @p0SP&$<$$$301 20@X  pX9p0 J(2P  0X) p ~Pp PX  X9 p0l X i ]:]:^:]:]: ^:8^:s!t!_:8_:X^:t^:$^:_:X_:_:`:,`:x_:TM!_: -P4LȌ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4p,H3 8/HLH H0LHO0X0L"RE 0SH0L202嶂(XP( s8< 2K0s0S   P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 0L 0L@%@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#( 1@6K0p 16K   ` 0CSv PL4@6L< 2K0L9<# <# XYY8cP@XpT $PPheU@_`W4P @$PPTQU@$CT $PPFCU@0Q0C 0#@6T@3S .D\ (P, 0<R?(K4Q @  P0h0 $@T  PP X 0SB*KL3DDs @s 83S# `< $?(<L  %P\ X A P , 0RZ(KL@K 'X0X #?`@9 8p ᔑ唁ČȌ/0P:̌p ! ; a唡! /T`X 0Ol|O a  .K p 夜q ȁ b?KKAsSO<@  !  ʃ|kK  ഑ 尡 mKcP\  |Q xa X ڀ!LxX Z*|Y{& 0 ATbK~KpWP`P`B2MP`.K \c0`Ap ~QWX ` `p p8a 4q sᩌ( $ 剓0 , \ (|!Q Php@Q Ha DQ Q @h ?$(Yt p [K]KpWP`P`B2MP`]/K g[c@`(!\|Q0T0R Z  0 PV\A 嘡9S@ N?K0@81 4A ~KP`0PU`@p0q , JK( $ x V<ژX9X) 0!"4# 8̓  0X R_ 1X RY  QPIXQ {$axqVꘁ們X)p 8|| U(|!Qy$1xASu少 !""4  ",H1 @ < D! kXY@l0  ʩ!ꀡ|W1AX)p @ pQU0ia:a:@b:Lb:pb:b: b: -LXMd 00K\0 @h#X@ P\P`XI`` ! 0"#48] \<P`^ČZL K DpKpW`0hl@\0oXHp$+440 ,0 X\T@ @PI PU`d]@K 0TK@T P <K0Q@P R$! d@00ST !% \@9 XQ4@V4 pDUDpK(KWP0@ T0 P@ LKYT!\P,X)p dcb:b: p-X9`] \L^_  pd pX9!] @\^P" D_# H L!WBD#9pb: M-L0RP  KX)0_^0\]Xo] \0^_4 8<40c@ r,5@$,##Ƞ#\$d$x? 9:;P=`>p80<@ Kib: 0- @0L,}(0 :0 9 0\*X:b:!`!d!@-X)@ 0!"#48 <9 -,0LS@P` 0(00  X |ph0S ppPX8p  0 (0 b:,c:c: -L$M0K$"`+P=X)0K0P 48<@0 ,  .  8   0XY@y40 !0 "# AV00@1X R#X y 1X R02I *(KXY 0! "#48Q8 =02A 0O0 K  }P  80Y! 0"4#4 8<S 4 X)p Y\c:hc:b: 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U,!p!X!!!,!\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0,L 0  彳 S:R:!c: -LMP@`Չ)q0X@T) T !!!$!P8`@ XBd K QHQPV@K`pK X9T P lK H0TKXY( fb d K ;V| x 0S @d K P 0,Vd K x R0 S\ X0  |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0k1 X Rw \  (KL XLKX0S JpP D T| 0`` pfP\ 0 pZPD00| 0 K`Pp\ 0 `<PL K  R 0L H0  v 0K0 @0 @ D@@D@ p t 0 ##zdK\ X V02* |KD `\`p| \ 02 Dˠ Pg` `WdVAV  D@|0 @P MP   0 0 0Ex\|R6ņPU 0 0@ 00l 4匐l*p :P Nc:$d:c:c: 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X RM1X RI0K! 00P00 R$ @R 0S$0SR4U |!4!!4!!X!\0<&p 0,\0<' ɄK0\0<%\0<p 0  @d:R:c: -LMP@`$9q0X@T( T H!!X!!X!X!!V V T)0X)p 0\PVX`t0p9 0 $ ̯ Ki7Vtd: g! -X9@] \L^_  p b: M-L0RP KX)0_^0\]XPE] \0^_4 8<40c@ o1v,#\@$,##Ƞ$d$x? 9:;P=`>p80<@Khd: Q-L@ t l0 t:09\0  B)\:L L0X*x:D D0*:< <0*p:0 d:!H!L!h!!!0!!d:-0 4 8<S, -LM X ?P@ D0HL`P0 0@ /P 0   { (K000 0@H0X)p T0 0(0b: -800 P`p@8`L2`(  (0@(@h p-h0LS` 8@T P@Tphd: 0-4 (08PS 0L(0ل@0 p-(04`SL8P 0 ( ń@phg p-`0LP 0`tTXp3 ^P0@pPqPĆ$@T R000(0 0 <P0 R 40800/t$@Tᒆ[phq@! -2L@P 2S P P Bt"`#pP Ps0S0 (  R,(00P2  -LMPpP$`V R000(0 0 /0 0 00  h 00000 ,@ 4$ bR00S400Y80 ,"?1SAO,!0 T8XH0@0 0sH 0000$00 00 8PUA p$ 0 0  ,0 $ (<S S 0 080`(K400  0KX00K0 @00 ,@ 4PU p<0< 0  @0s0 84`᫅ld: p-L0P  (Q ッ@phĄK`P 0 @0<08P `q@0ph貄 DB!e:0e: 0-LMK @P 0 "@P 0 T0<0LP0ףP00@(@@K0@Te:L! -LrM#P@L K 0`, A A PPppzKFPLs@ 0ZP$.K0[P1 S02(K01SSx  r 0@P- $p`AT !PrrU@@V@Y rP00S 0"0 _ZC, 0R}(K 0pPp`405 6478<sc r\`!0p@0@` \ D y/K_ATS @T, 0 48<S (L Kp`  L Kp`L K`z`xCp`rL Ktp`j0 YC p``L K0`Z$娬iLVkedAP]:|e:Z:de:V:e:<8 0-L, \@0 P S  X) 0!"#4 8<90q P002 Q " R1!P0#2  P  00-P0 L'0 0) 0@ QT8XH@0@ `:*808 \:X*000 d:h*(0( |:*0e:!T!!T"!!!! -LrMt% 0L K@, EPPFyKxEPP$e 0*YP @T $0 -YOBL K, 0 R(K.K0zYP 1 S L K\@ 0Y%B@L K$02(K01SS L K@ =q\@1@P`0LK h@PX)LK5406748 <00@4P!(@,P pX  8H0  T1X0 q@m0a 0 0 0 /0C B0 0C B0 @p X = BP0407 P!@! " # 00123568 9 : ; < = > ?  "2H0"X p48Xy01`d99  hɆp   |. p @ 8p00!   08   BCh90X)h)(0*+48 <0# #Ġ#+)*(0-PY 4pV@ P-p*p@W $p\ӪL KPZ piLVkde:edAV:Z:|e:hT:pT:e:xT: T80X: -LFM@`KO_Kp@1 , @K\ӂ Ew 㸳@! ᳳ }WT\Q, 0R(K|ip8 -LzM@`TpP@K z6 K肏K,uPU @ @uU@ -LM ,( h9i)Pj 4k8|WN@ P`?< L#?1SDOpP3400  D0 ޝ`P P0U|r@8@ VB K QFQP>I봐`X9pPKK l h lK KQ t p p(` ̂Y ʁ K cIH K  \I8KX 80K0 @ P Uʳ 0K@  Yʣ 0K@  P l0K EP6NU>E ;|0 x ? X \@0##@ K D0 SDڴ`@   1X R02 X R PU  @D  RN P Q ! `Mp)90 K~Tt [D^&`@P\ | K ` X t@K00TPˠ PPD@_\ dKt0KQ d `   PK`P`P ` T``T` H0SP  tP tpP} L8@P uTt 0Tt "| K PPtPK```K` @pPW| K tPK`` @psPG`| K ` @`dP8tKT  | K  QP%t0K| K @p@  @>PtPK``| K `` @+PY \f  (KY@ R0S@ PU`V@\5 X%Y#0dQzdKt p uX \P0##@@P P@ P zH^ P`@P ` tK| K T H@TP`@P ` P )  0 0 00X`W^OFK6p@0rpt T tPK`| K `T`ˠ  @@@`pPiD\`0@X ( P* \- ; 0t0KT@S   @G| K  pPD`D0O\ʗH^X Y PPU \^@K0@ŸP 0@$ p t Tt@K0| K ```T`0 [ P`p(P Pt@K00| K P `PPD`VL`0@X- ^/ Q2 PU5 tK+T0 !0000 | K P`DP0OUH\XY ^P Q R PU\HPH\H^*Jx븀X 0 0@ 00l 4崐l*p :帠xy y(rf:f:f:f:th(f:Pf:c: -L MXɐP! 0i"4#8L8 K00STڀ 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V d"H"0"""d"^0>& p 0^0>' K^0> ^0>p 0H@T `9`X Tw@d:R:f:f:f: -LMP@`w9q0X@T( T ",""""""V V x)0X)p 0\PHVX`t0p9 0 $ 6 KixVtd: g! -X9@] \L^_  &pHwX) 0!"#4 8<0S039b: M-L0RP UKX)0_^0\]XPE] \0^_4 8<40c@ o1v,#\@$,##Ƞ$d$x? 9:;P=`>p80<@Khf: -L@00 TP0  H t:09\*808 X:x*000 :*(0( :p*g:"""@" "T""8"@-X)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ X)! 0"#4 8<4  D @  ?< 80 ,00 @@4;T$P0 T a\0P@ 0 dkVTn 0L H0 TKpP0S[W \L0 X 0X$(^ ,K &X y908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Kob: 0- @0L,(0 :0 9 0\*X: g:""!" -LM  0f谾#&" -LM) 0f谾#&" -eL`Pp< (00p04S80,0d0804p 00 , 0@07< wɥ&((0"4#220&$ 04 O 0i<(g:4g:WEV&" -P L d&@ ަpP` 1TI t1T) *`{T1T* L1Te/qA`,10S ` 0 `P 奮`P0T$ Ъ0 00" 0`0 ed@ 0be/DOd 0U %40$ ( `drdAhdsd edAk~gd&" -DL!88#!fP1 倥p" D0020p(P00`4Q!<00@aT@!0   H@<00d@0Jt@ u oݠ0 <+0400 @9t@ ozuH @d<< 8 8-#TLL%p`P 0@3 ٥+ᯠd 8 8-#L@(PPp 0`pP ᔠ0S  0㈥p0 pPd -L@o0⡪X("0L00 -p`0L cP$  c@P P00 `(Pp 0fP,0X@P00 @# iusd`ddXg:8Fi@g:`g:800S SP 0Sd -0L -L@\p``hY# 10 0 P 0W hCg:g: 0-PL@0 00hu -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T P0d 0-`0L PRT  0@ST000@bT 0d 0-PL@ bP 0 @ P00S0 0 0d -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0@PP@ 0RKp0T h0TP  @80T @(ܜi'B&B"B!B$BB B(B%B8 -QLMK 0K 0SB$   p-LMPK@` ] TCJ |4QZT00V0S 10C x 00d80 P0S0SPd@ P P 0S009dg: -H L@T00 ((0 R00@!ddhg: p-L`P@P @phP , P @``00p phg:dg:r -`@L0S P@T <0 ,@Thd h: h:,=% ";g: -@L ;hj 0-DPL0S 40@T  )@T000dd p-L`zPP @0 0` @0!# pg: 0-XPL0SH0@T  #@T000dd0@-\P@ 0R R R  0R RT@@\0@0@0 d -LM< ,=%0Q CAhei:,h: p-`LQ 0R p 0 S0\ P  \ 0S@@PP   \ ph 0Gia0 -LE X -LEH -LE H -I LE -LEI - LE -L P -LhMa0@K 0 Pp 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ lPKP@@ n P O vP @a P  TH@ Tʺ,4 4 iHh::p:Xh:8lh: P-L n# 0Pr뜟;h,=%o\,=%Q0 cLVk,=% S,=%P fQW+,=% fQ(,=% fQ(,=% 0fQ5$ui,=%& 0fQ*xi,=%X& fQ*,=% p-<` @fRPPTL  +@Tpxi,=% fQ+,=% ,=%^,=% fQ6),=% -LQ @ , Qh:d -LM`r0`@ 0 P# PP P 4 0RpKTH PK DP7 P1  @T; P k !0@ 0K\ 0K0   h1 R`1T1X!P!@10!0@ $< @ 00@@J P ) @KKUP00  00@@ 8 P  00 0qx嗙) P hU K2PLM yKx ip:hhdhhh:h:h 8h:h: -0L0M0@ 0 PPg 0@^SD幼 0H@K 0p SpP  堼G   嗼>  0@^S匼P2p/-t h lh0`*`l0tP8孕i|k: ";hk:k:k:;tk:k:k:,=%Pk:h(8 0-0LSP@t   0hx d -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P hhhhhhk:k: -L@P P hP  \4dP 00c0Xk: p-LM`KP Kp @@560  PPP0@S00S@ P# K^P T 0S T U  5 T"T  0 4T 6 :00k:k: p-LM`KPKpF0@S@ PK T00  00b0 0 60@S@P 00k: p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00k:k: 00Cs0 -(0L @Rhd5Qd -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RDߺ@T 0a_S@ Thк48h8k:l: -L(M 0sS  P `PLKV>  Z a0@S( K$ \R0S  0S0SQ+0@a$0Lx U TA00 01 厺(KP0SK }1 ` +|!0S PPB`aTU Up0K8 0@ A00cP H 0 7,U`&0S@  @ 0a0C0S0@SV P0P000 R  a0B0S(0K +00B R0:S 0:S_0PE$0L000C SP0 ZWhhl:dP" 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0hh p-@@@`08PcL0`000phhh 0-@QLPJr @TZ0 0@-L@~S~X"Y"HX"PY"|Y"Y"HX"Y"HX"Z"Z"HX"Z"["HX"8\"HX"Z"HX"<["["HX"["HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"HX"Y"xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @N hhhhXd`d\dhTdl:h -P@L@PpP`P0P @D@PPP P  00`hhhh0 00$hh h4 P00 0 Q4#5ddh h0dd0hd -L 000hddd -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070S0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8I0F0hSp P@:\P_P 0?SCc"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"c"Dd"P c +@<P*@.P @  dhl:h h8l:Dl:Xl: P 00hd -(@xL0P 00@$h hh0ld p-LMPP`V Dxhֵ@8@ҵ0 ,$0ɵ`xdhl:l:l<%;l: -SLM@ 00S S h0Pd  0^0?l 0e000 P  0 P dl:l:l:l:l:l:0 0 `R嶵dld "; -鈠刀pL`Wt0@0VW@@ LT0g0C `pW` ?ptdldxd -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(A PU @0 0 S 000P@/00CR 0  0P0X 0000@0 (0 h|dpdl:l:lddtdxd -DL4M088 S, 2PLKHpKPKTK ` 0L @@ L (TQ 0P PL0P ״P RҴd P0Sl0HH, 0R (K0@,庴$PdiOd m:d(m: ";Tk,m:t8r<0  4 40pQ 0hhhhh40,0, @pQ0 hhhh<04 40pQ@ 0hhhhh cR(0$0] B   0 0hhh -8@LP w00@P p00dd 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S 9T j$0f00dd 0S00h -pL0@SSHP S 0S i q`0 Q00 2| 6S Q _0000SX|P 0  i5ithh -PL`eHpd@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8gt,c 0Q/ 2 8S* 0 RT T U 0Q 2 8S0?00 CR@@D6TA`0 U\ 000D 00CS0u hddhh0m: ";h4m:h; -L\  h - 0L0S h -L\  h -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(Khd -L\h -LM@PP` \p 0KPV 00@0)V 00h 0-t0LM R8K L@PD0T 0S@ xP UP 8ddd -LM @K< 0S0B :00A0 R 0 dd -LM$\  h -LM$@0 0h -L\  h-0   h -0L0Sh -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$did;Hm:,m:8 p-L@P`P 0S ppp3p - LR`P; R :R0p0E@2S fP @T:00E ` RZ p|0"P@0pS@ hP WPT:00E0PpdTm:h -LM@ 0P  K -LM PR@ ` R :R0p0F@2S P$ @T:00FP RZ `0P , 0"@P0`Sh \0 KV@P(KT:00F`0 , dTm:pm:Dz" -`pL`@2 RP P @T$hް0 dm: 0-LX@PP " 0 S0 00 彰0dm: -Lp`PU0FS to訰@0@S S P 0@S o荰m:m: - 0L@ hOTT p0\ dpPb`\ 0 40WP$p$00h2gkT, 0R(K #H0T5 l#0TJ+i8 -LM8S(KXp: -@L 0  0 0h&D: -scWDqLs VP40 :> :>N/!10CĠ0@F ÅC`P  V:> :> Oh 1l Sh0!1`0 1X0 !98Pt@8@o:vܑ""H"""p: -OL( (0y !0z!hzꀐ"" -L M38 S8<0 (K@  0@ 30 H#T  0@ d#$pP :  H4 Rv g 0 0@0@3S 0@  0@ 30 H#T @ 0 % d#$pP4 0 d#T40  d#T d#0T d#$ 0 |#$ #$ #$ d#$pPm0 0@0@ \#$Pw X#$00 @0@P`0 0 B("(@0@R0 9^ !8C00-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝhhh81s s080 080pdd; 0: 0Pკ@-44 0@0 0 @* @@Mdhdt8 -LM   0| h n1 ^2V UF40H0`1@0P 04 O0tt H y\@  ;0S9@0U5:0S\ \ 0S 0S 0S0PH R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00K:P0 H00@PQ -L4M  $0 0<0 @K;   1KB Kd -L4M0@ $ @K <0 3 Kd 0-L M(0@ P b$p!0S(0 K0S   00 p $ (0!Z(0 ; F p-0L@`P5 PlR00l pd h00l pt x000pl0P d0P t000pPl00l pd h0 t4l/Pd)P 0-@LPO 0h(p: p-0L4M"`@l1Ph ظP 01`l1D ϸP <LK( 0P H0 t  Kpp:d 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 0d@d p-0LS@P p R R`d }P0 <0p`8rP0 S hP p:p:p:0 <#<0@0  p-0L@ S """ "" " " " " " " " " " " " " " " " " " " " " " " " " " " "" 吙"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000pp:; i$ i -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\"""("8"("("(""("("("("("("("d"("("("("("("("("("("("("("("("H"h@`T  ᮷ 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`Θp@`d0\@`0pd `㰐 @` pd@;q: i$ i0@- 0P840 0S )06AT 0FBP0S0 400400P!0 S80 08F- A 0/,K@P, H@00S&0,P 0LޕF 0,,Օ$dq:4dd@6d(q:Lq:q:pq: -LM 0 p-``P ,  0 QOL 0@,0   $( Z PBZ K et Gp -LM`BPNop d1S00 ` -L  p`P`B 0 xP` M0 ` &94$0`R:$0 -L8Mx`$, PD p(KpPP5 Up 0@ 0@@'p KW@D 0pPl0 p0S00 0H0 <0 L0 @0 80 0,K/;+pP,0H@ ❳P#0SG S S; ,P 0,0 dY,P 0,0 < R 0 DD Q0DT0 X _ p,PH RR   0d Yu 9z30`2oLQ, <@ L ,p H0Sl0,8@ H ,p X@ A@ P @ d 9@0P0L @0 18@0P@ 0 K0@0p Ph 0p f [ 9]g3]@<P 0P84<  0AW0r:0@ 5/0 @// -L@@ -L@5 -L MH@Pd1S p K0 C1 0(K VpP ( ( H 00S@ 0S0 S%*l0" KP 0S0  R*先(p(0S0 S*[ 0Jp<p"[00b0"[000"[00b0Pwi -L Ƞ,Ƞpp0`0@ SP:@#R D3S PD300C@#D3 IP4S8cP 0 00>P0 h> -<1LM4@pK(1pP@!, @᮫00B`@ d+W, K zP , 0R'(KD| K0x t |@ PIK WPd| K0|@ x t Pp P000 eiPr:Hr:x9 -LpM40Q|,0   PKA⧪`dA$0h 0 @ 1|0 !x 04 t 0 4p 0F l 0 0S0h0 4 h @ 0d 0LK0`0 0\0  0X0 0T 0P  h  K1 P0`P , 0Rn(K01 P0K0 @=10 @ Q0`K PK` ` ؀ Ȁ 0 P `P0S` 0!00  K 0 =`P000 =`P 0!  0=`P 0! 0100 嘀K  P`P@00TP T   P0P@T P`diPr:9 -"LPMx |"d0K, d .PP )D, 0R(Kd0 h Kd PP`@K4  \K[KZKK(4K[ 0D K xRKYPKXPKHP @P , 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y 400 00< 0S0c<0la0 , LB@>@:@b6@y,#h+#*# p-L M@P0`   0K`P0SKp -LMBPBp f(` 0@@P/22 V/*@ @T**0S 0 PP: G(P 0@P  R0S  ߧP @''P -L4M 0 , 3SPp%]P!10C8S1< R (KBB (  0@iP 'E01 1\$ @`L 0 Sj*I  0GP_`\ @0SYt SLPL L 1S D  84 41, 0 S  4@@:P 3\0 @,`K0  P\00SP2S@ H `< @ 4@ 8@ R R7 < 2 S< @ `4@ 8@ RY{  wRL 3R@P Q: 0R_*21C   0 @@DP a@  @@@DQA L V L 0@ c0  00K4K8KP@0 D0 0 80 1sY Q40000b0a1!1H L0SY D X 1sB Q40000b0a 1! 1D@ 0  0H0 1s0 11s* @0DY0$1  &HD 00" 0D00, 8D! &40!1J40! 1F !10>0>0 1!D0 4K 8K00K90 D {PwiddPr:`dۣe*# -LrMuD, LP  ! 1 P 儀 K`P @0pW `PS&d00T , 0Rg(K0! 0B`PL0$ 0 0$`P P 0  `@K 40`PP5[S `C[ BC&PD 0@`PC[Ta !a ^  0S0q.(K !p0>00b>0q 1 ! l`z q0G 0gP p@ DqpP( K10   h !t.  . a0 S2Q>222>303h0 5T( 0! 1 1 hKBP Z pD@h0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l Q!lKR 0c!d d hK d0KA PH\3:h0\d% * d b 00b$1#[0d0 Z!0Q$*"!B00  000 1#[0j1 hd ` /1i9ۣe*# -LHM@aD1V@$0 p 8Q$K 0wP P $} K$}Z0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 ,Pwi -L@P @1S<@ -L$M (18 @ `@ 0S` ;P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S' T L  0L0  T LL @T TT D H 08#8;00 0 40  8 b0 0)   ,%,K.p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 0$?< +$0 0` Ȍ. qΌ@P 00 `jKp -LM pR`$K0.>0 0`. 0 @P`0 F`P0@ `  0`?`P0S   . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW &-P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?\"00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@P00L? @U""`!B  0P?"`p p-1!1!0@ 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp*#0+LVk0 LVk -0LHM,0 0@ L0 T0$ ( TK BP T0 AP P $ K@hr:r:xr: -L8MA 0R<0 0 !N0S $0` a1(K *0!@0P0 `PX ,0lx0PUM + 0@c 00 0`Cp0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp P& P 剂PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ <` `F<K (K,d(H$Ft ir: dr:his:s:r: -`6`L0(0 S@0P 4`  "100 0c4 0 @X 0eP00e0,0p(, 040 0b0(K9 p-LM 0 00t/t0@T P/0 S$ `D0 K0S/@Tx*di*dt: -LM`@p/$0S $PP0 oK$0Sp@000,0h/ t: p-LM0@SxP✊/ 0R: `  40CK 0 BQ *xh/(t: p-L` 00 ;4 00c-@.PPp 0-LM@,0P00xt/0S h0XX K0SD R00 0S008hD/i*d0t:*d -QLME hp0OO$ Bb!R^V )ڀP@p/21C Pp, (P! P&/0S 0xx J0Sd X00/ RPpPpU ~~ti9i*ddt:*dTt:8t: p-@LTP00U00S p0Tʄ 41Cc00C?PpH0`FTp 0@@+c<< -LM\0ϠBl3 1C 0Q   00 R(0 0 0  K KMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` 8Kp< i< <i -PbPH0 LS@P RH D O $2P200S/ U 0, FD00CSD01 RGU000,0 0@,00@0UD0 P0!0P00S000iVp,0 7D0,0CSD0000 R/0 0@0 @02L!0HO~D00CSD0ʳU L0S 000$00 @D$0(@H2~0 0@0@40 0@408@LVkei0h4i i 0-,0L 0, ET 00CS0@P0S +,0, @10h,,i iee -,0L  , \ 00S0H0 R ~+404 @,0( 1h,,i i0iiee p-LM@ KI  0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`Td0@AP8 41Cc0A0c<< p-lQ`LP ,0"  L1 R* @00CS@0,*LRPp0@0S0 0S0S 0MPRR0@P `-0S ph-@00CS@0pU000 0@@0+0S0S (0LPdRLVk i<$ij2g2 -L T'x0P l l0@@@B1\0\QT00SA<<0 R@h @ Mbt:Q0p `@a@ @0 @P0` 3P @d (K ჼ@κ>0`0`,K@0 @P0` P 4,0, }Id -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,1P8 0,0 B0R,0 P8  ۺP'00K@ (K4K  ͺP`@Z`J,K , P0 ,0@T0P,0 ` J ᵺP'00K  㫺P -L M"0(0, `PP 0pWy W P8c (K0  0 PPL0$0! 0@;00 0 PP1 I 0  0PP J@0 Pp0 ,K KPP;, 0l0b 0 RP0Tq@ P41<  T T (1#209P0 pS00S 0S T P P @ 0S* P0  0 N8`QcvPT$1 !SP#P3R0! $0S UbP`DPwi\dDd -LM0X T2 0\" 0 P2 mpP (KTJ,` ,X"c0? 0 @ lp hp p d | <ʟ8" 0K < 02 ," ">K K Kq 4r q q (r $2 Q0 bP P" 0@ \b(L'b<? `  RLB LBP0S 00S00?  R? 101 0,1 s ,P X2PU Hr , R 0 SHPH 00@`d,K 0` 嚸P00KP p?W8pGHr W0S } ! 0H"0 000100L00a0 !0S00 pq 1  !81 P p041 K>0#6`001t0,!0. "&h0d 1>0#6l0(!x $1|0P00H"1cL@KD2 @ H  KL2 $P = 㶸`P1 &IQaP0 \aP" 0@5L'<?  `p ?Ppp B 00 B0 yTFO @ ",aT0S0# X00 T2C 50T"0A@N@1T1b`T,00 Q0Q `0  P`0 00 0  T",0d0@0@0@0@ #L' \oa 0P"@dT2( ,0S KPr D"\2 K ( PfT,0  { <?01S# L R  S  1 3  1S30D 0R K  101`D Bp  T2@F"@T0000000000000`80P@50  0 000 0 00, 040 P4  X, K`T",T24) 0Q.0Q+`*< K4K X@@Ph18KP& 0$ 8 P'h8 <00<040@4 408 40$ 4(00(04  00CS 04 <4 f,W <4 \82PidQdPwi4+d$6d0ST0  Q 0(0 R 0 0 0 $ R0 0$0 0$li 0-,0L@P=  R 0 0 0 ,   R 0 0 0  0 0P1`10CS`1LP*gPp*`"0;X"`L`H 00C040`, 00C00 iiiH+dPiL+d -,0LP@`DPL L00$S$0#L0[/00tPi pP ,Dn(Qi3  -LM0pS00  b  $@T 40Q 0 r @Ti P,q! (0S00S1`Vb ,0; S V5   ,400Qj 1(K0  >0,  (00S000S 1X,0,400\R 0[/0(K400  ,0   ,l400Q/ [? (K$   ^& 00% 3P{ 400Q [? (K  P Q PH ߵP  @ t: 0-@L84P,0S80 80<0@=<=R:= @0SS   Tt,0A@0$  1 10ST,P0[/@,N ,1D X 04 ^P0SPJ ]PE@ R 0TP 00|0S  : P n PRt:u:ili0, Ã0ɃQ #0@S00*0,&0T0a  88!>0 C6 00 6P@40  04 0P @@@PP  Y0 0cC61p00@4 0ii00S00#00!P0 , @ka 4`(cadit+dliId`+dXi\iu:u:v: P>0 à 0Rl PR 00S 0000S 0-PL @~0h p-0LP`@V0D  Ppphq+00  R 00CS0 LVk -0L(!(M10 p  `@0   PP0S (K=+@8K" 0P* p38K+  #8Kk+ vp38K+8K1+P LVk9 -H0L   R@0 00P00LVk -L @ hgGP -L@ hY A8P -40L   @+PhhLVk -L@ h\ P<0S8<0 -LMbp<0 P @2Pp8 p (K)0 Z @W2`00Dp004P,P0Sprp4P 4 10S 00<000 00*  4, 0 00S8<0<0<0 Ve>,0H0\40S4 pLVk$ui!CeT!00T1T!RiU -@L 0@ei -LP00,P0!00 @\\0$@\@T1   SD !1R.40S45 , 0 R8#8[/Z0W 9@z, ,  !03P`R ᢥ K, ,8#8[/0 Z @SD,  [?P  @0`|@$ 84,m+d{: -LQ@Q 0,  10 KP,0  B11!< ,IX1Q1Q 0,  10 %P,0 -L Mp,PQeR0 Gb Y (1$@a,0 $ 1O10,0 1,   0S00ʅ 0 R9 0,0 A 4 000 $00Y00S @T T @T,P B10`Sx S S@. ~T (Kor40S 10S (K W00 00SPA(Ko裤 R1P R ,0 1 P,0 ,  @\,p34P00SV0P00S@H @ Aℤ8#8[/0;(Ko*NHpt, 4 y A3j000 v Ad,aoAN,@ d,0K W 40S0PX0S ,0 D0 ,@12S201Ņ#iA6,@".,P ,0S@ X0S@ 010RA+d,h - L N -x0L@T@T ,0 ,0$ 1  @Ti -LM@,  P$`0A s  hd\`Q Ki!00000 10! !1 1 0U1 0!10101 K+d Pp-L`P @T U  ,0 `@Tp P-L@}P  h -LS`p) X1@TO @T 404S, T00Q0S 0P W f@TX+ R ?P% PU PU @x 40S,0 R  0P W 100C0S6i -LPp`P P U 0 R Q 00S U U U  hlP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @`P  0S  `P ,0 0P  U r R 0ig 0i b0i @B$$10CS$10$0a?@i 0-LP .@$J/@|0$10@i 0-$0L$!PR @$@0 -`L$P!R pff0 @ ! 0 !1@ A T101D!0R1M 1P 0R 10P0+d -L M<< q4@0 ,J 0@MAKi$/d{:@i p-L`P @T @Tp @T R0000 0  R0000 0  -pL@` P,P W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D00G{: 0-LM0PS Q@ R  R 0A@S0@ 80SK` P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( ̔^ 0 f0 0 0pf0@ fW0 @P0S  $ % !LVk -LM1 K -LDM 0P@, H0 D@ 3PP #0S CPU0L0 ` P`P e`P`U`L` pP `#P P3P @1`,3 P3P  "P`Vj p=KB 2R20L g"E@Se2P Pp1e#,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0`TV @ kdT @HK WdP A @0 B C  D! EFG@@gEW00`C,00, 0PR=(KU 0`V Pp P P@d,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0`TpV(iP,dLFiXFiX,d\,dhFi;{:{:d9-P  0S 34\^ jQ0S :P00 (0LVk -QQL Mp`1Q1 $0K`P) @$ P$0( $$ $ ,0(0,@$0 400$84$<8$@@<` K(K`P l(0@ (d(T u(0l lh  0w`z -@LPp`dT  0R U T  hג  M-PL0 0S R K P ⼒ -PLM0  0S R  P  K⦒  -QLM@NQO `PM Z: @0C 100C0SA,0L> 0  0R>,0S2P U;P00 U"@#0 @@0pP P( K0E0"@E0`0@P Q(K@@,  ` ?@@P -QLTM| Q0JS-Z@P |P 100C0S,0  ,0S0JS @ l@ P00P0 `=1X 4 @PHK`0 \@ p80K lhK8 TP h0 dP P` L ?PZ Z ZD< x x H@0x|p0 p t 10 0!P,0 A eZ,Kt ˑPfp00KT d  @P80 l80KhKP `@ \P X 4 h0 L PN0 RA :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 P2V6 0S@10S @T000Z8, P ,0 0T ,0 50 0 00 (K Z(K00 t clu@ 0 0RA P<  | D0, :P ,0x 0^x ,0 tt Zpp U | <0dZZ|0700 -LMp`P&. aY   0@ 0$@ 04 0@80<@$ @D 0@H0L@P X\ 0@(0,@( d ,,0@ 00h00x0000000 00…04…0-Z0 -01=L ( 00 5/A#b 40=9 =X2 01A !P Y T00 <0@1A80[1! !1$1$0S1(1$0S1,11001 M?3!C/ 0 0 {aF Nva ra0S`00`00S`00`01 0B0RS) 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  >aY X0@X1\A0SP0@2DB100C0SP0@1A2!/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S00CY|0 0@P0T@0|001 0B0SR 0 08 K0K, 40/08?@#bL3c1!(KT X0\ ?A3c 0X"\00@d!l01 A w`7Mb?B; -L$MRL0 LH < < Q`V pW&V (K (3A!0 Hp3Q, D  & D 2H @@ 8 4 T2 10S, P R( XV9$9$9$9$8$9$p9$8$,0 0 0S p0 S,0#<0SWE40040 0P <QW\44 @T8Qf1 @8 0 R @0  Q @ 00S 04 R @,0  @0 S @40 S @D Ry LuD,00P Q QDT 000QD@ ᬎP@<  fpG@ < ,0D D@ ᙎP@ <0 0fpG@ <0 H0S @40cSL  30410L00LVkii -LhMP o/p` _U| X0@00( 00  00"0 ( 0 , P. 0 0 R& 0@80<@00CSn=$>$>$>$=$>$0 @ 0$@ 0(0 ,0@004@$ @D P080<@,HL 40P0T@<X\ D0`0d@Lhl U$`X x0@p0t@0 x 0|04 0@0@L  LQ ` ^0 0 KmPt0O0@pPK`2D!0xP`  R 0F 40x10 00@A40=9 =1^ R0 !(K$04 t!$0 l! pX$ <0@`1dA@0h1$X01 ! 0@1A 0 ! 0 $L0ST X@1AT01AQ $1S5 S SX 0@X1\AV# 0z000000x0 | 400gD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !nX D0@(1,A3018 4!3D1( H!01]P0S 0@1A4d -QL4ML0 Q `oV RL D  D  @V< (K8p34 o oV01o?#TH @0 p TM T8  HqX8Y0!0  L0S 3#L<P7@T P8 8  8 @T 0S D R030#Z0S 0H4 4H@ 嫌PDPfJD 7@T , 8 ,0P ,0S 10S S <\*0  Q% @T<0s~6@T 0 8 ,0tQ0, R 10S S <\j40 Sg @Tsp\ D R030#Z0S80080 \ DP030#Z0S80080 0<\ DP030#Z0S80080  RP80080 PR0Q (0DP030#Z0S 04H @@ H, P ,D  f, D  JHp\ DP030#Z0S80080 \ DP030#Z0S80080 \ DP030#Z0S80080 0<\ DP030#Z0S80080  RZP80080 PRR0Q (0DP030#Z0S 04H @#@ H0嚋P 0D  f0 D  J4 0H @H,@ PH,D  fJ, D =4 0H @H,@ fP ,D  fJ, D 4 0H @H,@ MP,D  fJ, D 4 0H @H0@ 4PR0D  fJ0 D G4 0H @H0@ PG0D  fJ0 D < 40H @H0@ P0D  fJ0 D 4 0H @sH0@ P%0D  fJ0 D HeLVkii -LdM 0P  PH U00 0(KS񟗐V$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$W$V$W$W$W$W$V$W$W$W$W$V$W$V$W$W$W$V$W$W$W$W$W$V$V$V$V$V$V$W$V$V$W$V$W$V$W$W$W$W$V$0BMS c$b$X$_$`$`$_$_$0_$^$^$^$t^$8^$\^$8^$@^$TX$8X$8X$_$0b$TX$pX$ b$a$^$]$]$a$`a$D0 0O1T1@0h,s<< -H@L0S 840$00  /dLEi/d/d/d -LMhQQ-@ P P@ K0q p@P0S7 aQ @0S`K00, @P0Sp 0 p0S |`Qp0d0 L,`0S , 0 /d/ddEi4,dLEi/d/dAI8q#4o#0m#(j#$0T  d#,:~:4:~::d:\:l: -pQL 0 Q0`V) P0S" 0S 0C8S 0J@0J0 5RZ0Z P0S`V>0Fi -0LS@`p3 0S$0S  0PS'0U 0S PPp0S00S0x"0l"0S T!p0 0!i!D/d::::: -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000!,K4K^!0FiD/d:$: -LM0r,@0S 2 M0S00Xb 0 Q `\ P 0,0 A0S00W ``00 @XQ ` M!Y   <1\ 0S 0S U 8CR0S00 S00 0S\ f",0 tM00CS0X] T2(K`@ 8CR00 ,FiH/d~:8FiH:0Fi<: -@PL` pP  0hTV0 T/d -LM08`, J|pP4 ( 0 $ 08JE00C8S0?P4Ky08Z,K << p-`@L PP  0ph  pT:@-X@\F @@0Q:XP @ @0R:Q:& XPXX@XP @0@ R* 0R X0S @ Q: X0SXX@ 0R 0R 0RXXX@XX820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;O0$TP7p"p -LM, 8 p0 RDP] 0T<0 8@ W<Z (@<K4 04@ ! 00 ;4 00@0(K 4CP0,PP`0 @80$"S/ P>< c080 4K s= 00B0 S??( K Q02\ 0A1@T (0 P @  E=P- @TZ \ 080 U=P0.S a0B0S8 a0B0SW0B$ZiXFiP:;:9 -L MPp`Z* ((0"4#220 $04 D,K#P 0 @ (K, 0ͤP ,0;P 0t ` ,0 Ǥ,0<  0,帤,ڍ p꤀:LVkedA:Ȁ: -LM`00PK  0 I=P 0RK00[S  00C0 S00•0SLpQ @@Q <P10Kid9 p-0LM`@K Kd0 ]PP"0 K0 @@0@0  K0\S QT0 QL0 QD@0 0RKp Ddi ".8:_-:9 -PQL`. 00S`S%p0@T@T 0S <P00SfP020$ 0440apCWPE@8Fi -L@P TYP0@T @T 0S$K@TFh:8Fi|: "; -LM0x,0 ` P@T $0s (0t @TU 4@K;x ;P RVX H;%D00<(8(00000S[ 0#4PP0 7@PK$88@#D0a'$BC< 0KD@P VPPpT00S 0S V 0Sh 0SO @, 0R(K R 0S(0 @ b;&P0&0T0U0SuƟ0s0Sh @pPP0೼0  " 40 $@ 020$ 04  6 %ş00a6 0qW 0S" |$ 0#(("#4@!| ,40T,((0 "4#Q r  H0R<5 (p %5 "88 #$0a0""0p 4 "88 #$0a0""PpKV 0Sx |  @n9PnQ@;P 0u03V0STU@E( K0^*S@ K0 PP 0S$ 3\#   @n9n`:P X,0S] S7 @#002TPPp㸀K 0N?PP ::Pa 0K*P 0S \ @ X|@T@T $0s (0l@TgA P 3 ((0"4#220 $ 04ă\ l `@P 0pP@ P`:39 9P pW (0 P @ 9P @VPP|@ Z`@P 0P@ P`iXFi`FiPFi\dhiDdHY::<:HdLd:$t:: ";::<:p#;t:ā:;:Ё:;:@::D:9::/J 0-P@L,00S,0 0h` -LMp P,00Cs,0P 0K,d 00`Q`=Bl0 B1h @BQ=9A h =C lh l0Z00K`0d@)U /PP`P`80 0@80<@PPT`  (w(K /HP`P`00 0@004@HPL`@0 0@@0D@c?B؂: -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0׉  0щ@pd$RdDpd\d -|0L0@Sڸ PR 0D00  0 (0 BR HFihFiXFiLFi: p-0LM`@ T P@T $0S |(0 0 (02 0RKpd0K KkP(0,0 K0w(00(0 :XFii9 -,@Lm(00(0: p-LM(0@P; e 㜸P7 X``00 U@0 000@ 0$0 P }P 020$ 044$0$0s H ``@00S xUXFihFiLFiX$HFi: -LM`D 88#|p 0 @P,  !00! 10  @, a0 ሀ<  R `U 0O  < ?0 R0Q4O0@ @P Q: U:0`)p@0@P@8 P00, 0P 08 0Up`,@P 0 0D 0@d (K< (0R 4 l<%;;>%P:\;X:x::::p: -LdM\@ <0 r  <( 4"4&, Pf< ,$ !$*,R]04!48#8S T20Y *00!8P#QE 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X " Rk @0@@T(PKT` 0 ᥔ50 A$,0@(@0 00<@9000cP4l $0 ᑔ@K0H0 K 0$l 0sH 0S S0S 0 48#8,C(R;;S@TPlP P;`@ G?E?C 1* ZW: R e 00 R0SP,0R0#03P0S<08  , 8 0 0@ 0  i0 0H cH0I 0Y40\@"* Z %0 6:4 S R!*0, q 3P R . D000D0 P (K 80@< @D <0k@4@< 8 0 , @D@#40 8 , x,:-00 R0  R 0 Q R0S0S0000 00S0Gia0 P00(Gi0 (Gi4Gi< 00b 0P 1 Qp-LP4 1Q 0Q  p 1Q 0Q0 p0 00  0  p` 0 @a*T0 @@pP8 4 0000 00p}f~fvtwt@4Gi0Gi -@L 4 R00 0S00h4Gi -1Ls@ 000 800 <0塾 00@x/d0Gi4Gi -l0L RX@0 D 800000 0(Gi8Gi0Gi p- L@`nA@P <0 S ᫿p᤿@p0Gi8Gi -1L @PO`p\ 0+@`P ჿ 000^  S 0El@Q@1@!T V`P0Q 0Q`]#`0Gi4Git: Q0-L@0PA 0R -x0 0 PR0 R P P0000 0S0SU RU0Gia0,Gi$Gi0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP' ( 00 S\   R (0c\0 0lS0P 0 \/0 0%-P( 00 S00SP (0c\0 0lS00@-P (@ 00 S00S@ P (0c\0 0lS00 P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0S000 Q0-PL <@D40HP0L 000x|  0-@LTP ($ @T0|: -LM0PS`p ppS0pS(`@ $0X@T,L<D H0W 0S0S0SdP (@K0ꔄ:̄:؄: :@:d:::ą::܅: -LMpX,  $`,@V P,  P 0U@XPU!  0,@02$` 002 TV 0@ 002T , `F V 0PU -LT0T 0 pf<90 jfT9 p-LM@(@K`PT0K P  0 fKp$9<9 p-LM8(KP`@ 0  @K ` fKpD9T9 p-PL@MT0`0 -fph芻H9 p-LMX(@K`PK P 3T0P f@pKp49H9 p-LP@` 3 T0P=pT0Pp -LMRp0 S`( - S& S ZQP1@T (  ( P0S( P0S @0T "0S (KXZQP0z03Q0SP P P P X *0 R  X XX/d -L MT0p (@\`X `0 .001 P\@\001@P$<@0S!  0A@k  f (0X 0_ (K `Y X (0T`@R  X  0  0 AD ꜆::P::: p-@LTP` `< @`T@T  @`T@T  }@`Tp -L8M⼢ ( pWaWW "22 2`Vkt0Sd 40s 8Kd" X X P@_e @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e8  @@@Od h P@P_e0 H @@@Od , @a W `V aWX T0 `V( 0R"$K L 0 g8K & qx pi:Ī:,A;:/d:k: :(:0:8:@:::::::ȇ:Ї:؇::::`::D:9 -0$S(00P 0@ p0Lf 00# 0 (pT0` $`0 `0 . pl 0 Q0pp`X0 0h,0>0S! ! #P11"p"l00``0SW\60D D0D0D 0 0 G0RPGiT[i`9/d܈:/d@Gi@QiT%%%D%:- \ 0Q|@l0 \i -L MtptP`@F ` 0 04`V pPKHe \i:9 0P \| @l0d \i -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U    PW \ 0U00U <000 R jiZOheideiTd/d,Gi -RLhM  !l @ |@ , pP@ P t l PT t%PP00mP d0  t h0 ` \0 tp t p 0@ZSQ3%3%3%4%3%3%3%3%3%3%,4%0%3%.%P0%3%0%0%0%0%0%0%0%0%0%0%3%3%3%3%3%3%3%3%3%3%|.%3%3%3%3%3%3%3%3%3%3%H.%3%3%3%3%3%`,%3%3%1%3%3%3%3%3%3%3%3%3%P2%0%.%3%3%3% 1%.%3%3%81%3%h1%T.%3%D3%3%1%|.%l,%3%3%\3%3%3%t Z t  P@W00 S}  zM, 0Rz(K> mh@@h@ h   `@\@  `0S @`h00P00h ,Kl  Rd , K2l 51:Rg D 7#A P`0l@0  dl@ h d 0Rl l000b al  b``P^h 2h0 /h@@, 08#X` h(h  %h0@" 08#X` p 00Bt@!0000L Qt@ p d0 t*P 0@ \0p `0 t0 Pp p@!00D0 0 \?`0 t hthh ^t0+@\@ Y0PCK l XP C0K`\` th @ h Ht0lPh@h @t0 h@ h  &BP l0`cl0  c*,K @ 0 0d 0QP` @Dl@ l@00 d0 P0P` 000P0S  Rp @ !  0p h@ h  h@ 0 8#8@L0 H@ 0 L H h h0@ 0 尀n0 i @|Q pL0H@0Z `Pu  P@ l@2A \@QLK<@00`!0@0^S!0@0^Si,:::::T9:p:^<,Z; PW00 S   !0@0^SP@W00 S   !0@0^SZ l?PX0 H@L0CK @F`P?X0  oHL0CK4!6^ Zg PW00 S>00  St@0?`0 t -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  y K0 K( p0 0-LM@TPK 0P^40@ R +8x&8/dhei --LMP. 0 ?,0@ R  KX/dhei -@L謈; -L: --80LM Q0 KPd --LM 0 K --\0LM ,0 0 Q @@ 0  0@KLVk p-LM`0@< 3PK0 t0\ >3[P @ hP >a 0RKpiX#;\9 -p-LM `g 0@PP Pᣯ00 R0PP Kp(Gi -p-LM@ `DP 0@@ @}~,0 R0@@ qKp(Gi H: --`LM0PSP pAO d P PL0 R DI,@ 0@Lhei\: ";/de -@0 LH@00S S S  HhDhHd:/d: -LM  0렉: -LMP`R,020#00S !R b1!#88P$H*0pK@ WLP1[0 1KLP  -0L0S  c1 #880S$H:H1D0H1, Y0 ,h p- @LTP`Tṁp o @! 01 01ρᩮppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0/dL;X#;: -1@XUL aU_!00UCUڨh#aUʐ!2px@0sJ `0|8s0SxH%xH%xH%DI%DI%0!0 Pq0 `@Aqh`@@! 0S0c!00c10 Rڄh|hph0s L/d/d4 <8:R%S%$S%4S%4S%4QT"(1 T0`!10 }0 0c0C1 0S/0cd0P:^0hj0hg0hc0 ]@d8"FpR0 LJ@@E8B/dPPtQJ t V>PPD ,`@PP t0S ` >PP\ d  >PPxP -(KAd Y 0 0 ` PK `@\0 d x  R  >PP0SX0 T0  0Kⅿ,0  2X R0 T X1e6 T X Q,` 1,`X1J 08<10h0 @J\ l0PPy0SLQ# 0KJ0 T0R= 00S?,0XT cQ b08  B08 4 8 40 0R$ 43C" cbh ,0@@ 0 S 4PT@}JFl h0hP&U 28KArh ,0X S00@eJ.ɚ;iiʚ;Q<Ȑ:ii -LM0@S`p ,PK a=P KPP $PK P=PA p -L M0@S`p ,PK 6=P KoP(0$K#!B ,0!$0  p -LM@tPPA 0> `fgfff0  jijiR  Rx0x0'' Q Qx0x088 RA⭵ -0@ 2L 0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qjiji p-QLM@`@00CSꜜ%Ԝ%%%%000 PJ@Kp-@h0`0X0KH02 0僢 @円jijijijiji 0->L@ C㭆0PT;:h0h0h (h Hh D00 8 P0$0 0P值0jiji<% 0-LP 0NᕳP.8CR0 -@L`^ᅖVpH 00RUV hp t0`0t00mH0U 10 XH ᦗ ᢗLVk<: 0-@LPt0P0t00h莗 p-LM@@P`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP Wx0d 0-P<Lp 40d#"B @H L00b 0H >R@@701@910\d 0-@<Lp 40#T"B PՕ R00 0S000h0\d 0-@<Lp 40#T"B P㳕 R00 0S000h0\d 4 0p-#Lp"B @`!r r p<0P80<`㉕00@̖p0P80\d1d1d -L㯓pH  P``0O0@d  d >V0 H>{  0@d 0 d  H0 P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d H Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LH PH>SB >jix9; p-LP@t0`   U tVp0 Pp 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP ’(`$pK @P $ @P` @P $ q @Pt0:t00>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? RZ  t0 ! W0N>N2n @ :t0\ 8CR1t0 :t0>%`(pKⰎ > PP ( PP0t 5*0t V.8C8Ac Q.PPQJPUZx9: -LM0`P0 ,0 8" p4b t @0  82#34Y  G\#0 R|  VR8 0H0XDVT V(ڠ0@ "?0A@V' 0>H  .` . 0O0@d P d p`l?ʨ0H0X VR  ^NSP)0p`FH0XoH0@X#82Tt0!0t01H R`1l#OK ዛP@4Vpp4b ŚH0CKH0@X\,  |0P| 0y w$0!s1Fp0S7   0@P< T  4QK, 0 R(K Y 4 Q 02R#M #}HL_4K  oi0dLVkx9ji0d Fi0dp9 0d p-L@Pݐ` (Q+Q%t0 >;.t0.}<ph p0t#40#"Bp0t HQHP 1(Q HP\d Q-L@ t00t0t0 0t0 0) P P  -Lt@  0R'0 t0! 0)P P ÖxQ  p0̌#40#"BH0t 0t0hjiji -| @0S00L>0 Q>|  00CS0 t1tTdi -`pLp=0 㨀夏@  0@D  D 9@P ✠% !,t 00S t PWP|@$  20P= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X+ | t p 0@$  $ h0 t@0   th0@t t    0R40,50t o9 pG0 #Y!   A0GS p0S P 0S 0SM @T T   0t@(0 h0S&  .H0Sqtp  0S 0SWt W W@ p p(0 S|PP%PY T 0S 0S 0S >08#8S>>>t  ^W0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi W X@0|S W 050;- (0 0S050,| tWtW   ^tɌt z Tx 0>(NxW 0S MtWW9 tl 0W4tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S  tt/C W   t}\WˌtxXop0̌#40#"B0t )W}p ^W~p > R @F0Sa&| zjijijix9\d p-LM4`K@P0t2Ɍ0tXPt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠@Z40 0S\ @w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#p8\ 8 0#p  0S00SW#W00n㨠pᗌ@ k׍0 0S, |0P 4 $0!41@0S  b|"2@pPu =(0S( ᫍ` @P%0T: 0TT X<ApP<0S X` T 0T 0T 0T  T` 7h1@/ b\)s8 R ᨳ8{(KT =  S| V  !1opP 0PCʡ#W  ] 0%>0S8\, { 8 ʱ8ᆳ80S, 8}0p$#pppLVk0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0e-H0P R 00c!0R#<0e p-@L`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@ p 0-@LPṇ0S US 0S\ a aR QPb0bU00S0 00h݈000 0 -@L`ኇp^P V  0 PbU0Pbˆ 0 b PP 0eS0 1S00PS0eS0 0PSᖈ p-@LG0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0ep -PL`V@-Q@)pQ$ 0S`0`Q@@  P 0ay0 0S00`dd0Vp@hQ  # -@LP p>~vP 0SBd>rv000 p-@`LP >vV`0 0 0P  pUB> v -pQLP@p1㔆 Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W᫇ R 0   p-LP@L `R4 R0S) 0 0 0P \  a 0 10 0 P000  0lp0 #0 00  V0Yp -LMp0S" 0S 0R Bp$K@@KP@K $Km%00  ,0 0 P ]LVk,0 0 0S ] p-LM`P, @T \Q Q 0 S ,>1Kp`]at -Pp L,0` 0 @T  [_ 0h] `^` -Pp L,0` 0 @T  9_ 05] `q^` p- P,0L` 0 @T  _0 \ `P^p`p80 P0S0SPji -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUji p-`0LP`U @ T*$04@S  RPUph葬ji p-`0LP`U @ T*(04@S  RPU}phtji -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Km賋 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ TPP 0㱫40h譫ji;d>dxLdX3drimiejimi%e%$ 1S!P@h2d.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-T!Ta0P 0cS@*81841 (1 ^  >!("(R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00(isi|8dririe"!B >0>\P 1 0 SXQ \0\"!B >0C>X@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  `0S   D00ccD 0b1  `0S  0  b D P0 0c 0-@PLtl1!dX H@D 1 DP \ TXHL d `0(0 ""> ,0 8#t@#d\?1:::::Ē:::ܔ:::ܒ::D::x:::@:l: -LpP`A @A1 00100 P1D001 DGDPDA -QLM`  p$R KPP VU 0 @@cV@1 `d0 0 VpP  똕:x:`:H: p-Lځh0`PU @ T*,04@S  RPU 000phjiji D0- 00@ 1L0M0@0 -`LQ@ d0d0d `1 01P 1 H0S L DP1 01P \0D@c0Umi: 0-1|00!L B!1@ P 8018U1:11jili 0-@PL KPP@0h艂0 0-L@;P@|0 0-L@P@0SU 0  00 0PP 1  `0S9 0S P00 p-@L`TPtF@P h 1018D0 001a 00@0p'pliji -L@pP`рW P1T% 21C 0f1UPPD# W 7 1D 01 0P L0\`XpH0d@`@P @ ߁ ܁@Z = Ձ@mi p-PLP@. w`PC  R'0c00 01  *1! $ DDM1D 01 dP`P1 0@ ,@1 p0 r17pD L@@ႁ7p p-@L`/TP\t@P P 101f0 a 100p[pliji -LM@Pp `QP P R*P`bU1f0Z P 0j0!: D@D00`0!`01`` 01dPd0 0 `0 P  vP&0!0g00,0 pZ 0j0 E0 PPS,00< -LϠMϜp0 Q10 K0 p`P} W0,0 ,@K,nDD0@0 0 0e`0!`01`P `0d`1dP堀00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O RW1! 0  00b\! 0 K  Pd0Wp00 KW,(K, ʚ; ::ԕ: -LM^ -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0yPP" 1 `000 0X0j 0    0S 0S00P 0PX 4 -LM Q-Lp@`8W 0 0g 0 1000,P% 1 Q PQA @@AQPQ100D00 0g0 `` p`0:0 0 ɥ(isisi -L@P   -P@P`\LpLP <0@T0hmi(<2dli -@ ML 0@00 0@p崐崀崠`0@ @P#5  0@PPHp`VpDD ᛣ(KoL:li9,x0 00S@ K] 0;$ p-LMQ@P ` Q Q KpT $ 0 0LVk -QL8MP L @ P8 L 00 00S00PD 00D0 0 D  D D]U0 0HP , +8#80; D#Pv@ PU D  P R0008 p0" D0 00b0!RR 00b00,C 1P00c0L0S P00P0 Uk 18SYX0 !DX` Q 0 PU0 ppR000 U 18SYX0 XPDD 1 D ,D  D0<D0 U P0 S Y R X!8S< 4 | X0S| 0H @00PR` <`V 04H 0aX,0RSP 0h0 40l S D  40T 040 H\ T 0JH 0 j 00 0 0h h0 H0S T R0hSH0 D 3`P 0S 00#W00S 3S0 P 0PQpQ00SPQ P0 S Y R 1SX R 80Y D  D  P00S  Q R D 0 ;&8#8 +[@vi 00b0!RR 00b00,C 1P00c000P0SL 80 \ 0 R `@yv4P ^, )u@ ,PPh 40l S=1DD D  T ; P040 M< S< RUTXU+ 80 0S <5  D0w80Q 0 R ;$8#8 +@$v (K p a 1SS 00b00,C 1P00c0H\ PHP 00THPU WpPP0 R4*0R:D@. 0Q+0S(80$3S{ U 1S 1  1S 1 R 0 P 0S\  D;#8#8 +@uY P0S 2 80L\  0LP 0 0;ᆐd  02P D 0  8P( UL IDXUDS;!8#8 +[@Xu3WpppG0;DP P Q!,~P P0P0Y0S UP*Uh0SYD Wppp 0SpPx,0S\ 0D000@000;H0;9#LVk p-LM@`s0P8#( p00 0 0 5@ L0  0@tKp [LVkH: -LQ@ 0 0S P <=hڻsi p-LMP\s0`BP- 0K @S 0 0("8B?BS 0( ,1 6F!9@P 0S 1  0T@0,00dtKp@T @T  @TH0  0A@P <\:LVkd: -LMSh1p0 @ `VO 0SL 8CT)@ (K`r , P0 0$ 尀 h P000   0@ @A @A@ 4p `@P 000,s,s00P+@LVksi -@ ML  F0@BKx:si-40$ 0a0bP  191# 3S 0 ,0 00P0P -L(M ,0 S R0 H D 00`p`W0S   ,P R (K0' 00,0#40 !H R  R0000S 0 R XQ@?0?   #4 iP0:0q8  K3SK  0 , ; 0X07 0Pb0c UP00 [S@  W0@8 s(?8 #8*  0?  0 Q P:0O0@/Tʨ 8rhH0S, K<  ,@T \젠PW0c0 X00Se ; 1] 00S ,0S  V@KdH {H P @<0P, 000`pVV4 R000YqW@ 3@ 0P ,  0D0 r4 R0000Z,0 0 00 X00SR =gjV X00S0X@@ T @Pd ,0 s 3Z R 0d000X00S ,@L06⒉h -0@080L06⃉h -L ML H32C0bC^ (K#0 0Rx iP 0A0 <C_,0 A@@0@@D0@D0@0C C< Qaq0 @P(0 0??;PXP ;  a0  @ 0PX 6000 0C Z ;miQsiLVk 0-0P; 00UL@0 CP6q0hl h60h苈 -pRLP` 10^ V@ @@ 0R 0 `0aR \^<P 0 0 T`pV`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $  :00 -LM @S 1 !@ C PK =  0-0@0LSP S TۛP 0@000aP -L@AP  0S 0& 0  0S -P;0SpL`p3*V@ ; 17p ` h pP U@0S0#S0`l -LMp`$ K@P$0$P 0S  00CS 0$xA9@ K(K 4 @P $  00CS 0 ,N  @p0@P(0@@$JA -LMp`$ KaPP  K(K PP $  00CS 0 X $0$@  Pp0PP(0P$ A p-L M0`@ K 0 !PP* 0S* $K PP0$ 0KPP Q $ R 0S R $  PP   00CS 0 PKp$P @$K  P -LMp@ KPP%0 SP 0S` 0`SV  e PP!0 0 0 $0P  00CS 0  @7P; 1V 7PB  00CS 0 p-LM`@ KPP x0$ P 00CS 0X@x -L@M\ `, K4 0 lPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@npPH0r 0c0Qp 0Pp8  08 R !A pPJ80X0 8K 7 pP@Q& X" 4PU  0X05! 0305   P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0Pp4Pm(K\,?H0S wW #W -L(M0`Sp @K LP02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp (@P8 P(@P`K0P,0  0,K0 PP$0,$L K(0<`PP<  < R uU #U U   6o0$ b 40 0@408@0$L0/0@PL0P@, -L`MDKPp V@P8 P(@P`KP0 , <` R@Y AX(K!<4@P hX`8儐KP -L(MP 0@ @ $K@ KkY,>0d -LM@`4K p#PP (K8K PP 4P , 00 0 0000008 $ <048@0 8PP$0S DK PP, (00(0, 00CS 0& 0 (00(00 00CS 0 X84PP @K=0=080 DC=,=040 0{=,w=0d -LM0pP K$0 @P $`0A?AS  00CS 0 Y=%@K $K0@P 000  00CS 0 $P t@$@P0A?AS  00CS 0 $$@ )= %= x2 0PoPV@= Q ^00 H0S 00  "0S  P=8K}, 400bS8 00Pc<0PE0<0 ]U!pW!0SR0t p!{z0<0 Ut0S< R00S1p RG`]00700Y]`P`80C6O0@P `0@`Pd` 0$0 0pd 0sUot0Sk40p Rg8 0S 00jyLVk uitihtiptiuiuiuiuis: 0-00LP D0#4 R21C 0Q 0  0 00<000h00000\@=^$ 0000h@pd$RdLVk - LRpe 00Sx0L0 P00S $0@PQ XC x0 0@x0|@,P `00 0@004@ $ 0@00<000\P0  0l  l ]00800;6pP/X@ v@uah0 0@h0l@a@00tiLVk -LpL0PS` 8@<@ R @00 00;00` R L00 h800800hx -1LM tP@@A\`1@D\, ! ?@1cR c@1@ ,0pW@ $/P`V20S` >pW' 0P`OV 00U@/R  Fx,oI]UQt0SP0p RUP` P`uitigfff8<uiptitihtiui -SL M40 0 B[ , 0`P $D$4 @ PK/0( D0P40p<00\d  P匠倐儠00 `P@ PR00 3`4 \v,\(K[@38 , Po00P@V$t0S4 Ÿ>0#6` @P?U# t0S2 ?UEڰB"0bx,\p` w00@;00000T@2L" ^7<"0OQPM "@0P ?UT1!0Q 1 Q mwA!0) ND勣,Z\pzt1 \ 0n !@0P ?UʌTUvT "PQ@T P `}0OQʗPyT0p RRt<0p R],\p10 P埬$ui!Cep,d3dtihtiui8<uiX:uiuitiLVkyi uiuiL:tiptid: -L@ 0P  -LMp` 00 & [ 0PPZK` Tp P PP 00 00 8000l xw@[T P(KD@0 0@@0D@0 0 f[ꄙ:ti -LMp00  Z00Sx0LP Z p0 0@p0t@$K0 0@0@00\9 000P(` 800@(, 80<@3 000tiLVk -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW (K4K 0H ,@K@2 PD,04 @r,@ TK%P<  IPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00a< TD&I0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /00xP`900040K  0t8p X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00~R XY V qrruuXuVzrQ: p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0B00C0h虖 xi 0-L@PBUT004^0P0T$0 0   R0 xi4d -0SL 0R& 08 p P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS &&h&4&& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cXQ t0S\  0@  0S @ K  `V $ (0@(, P$0#0 j0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P &&&x&D&8&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'4d4d -LM40 1\00 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 40Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PULVk -L M((@ $8 0@厖K :/d xi -LM 80@ `%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 $xP G 00WL0$  P WL0$  0  R  0  ,0S L0$ r p$ 20:(: -LM,( 0 080 R0 0`(40 S P< 00  , %<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  $0Sy 0Sv 40 ,  00,P #"@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "}P, #,K0 plW^ ,P,P00 S SJT30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP{,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN d T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@4 ?@p #pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @pxi@  -L(M0,0  p0(40P 0S 8+0`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq P8 ``800(K Px8L0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$㒒0`0K4 PP 0PK@4` H0 D@ 8 `8lP  00d R8C `?`00PS8ZxiPwi0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R Pxi -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00K@pdHexi 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0xiyiD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0yixi -L@p`\ L0S XPPU L0S \ -L M0   K0 P Kx'-2L?0\ \ x 0S00Syix0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMD0P,4@ ` @P@0d0(HL@Pp8<P@ Pp K萚:D:0:: -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T@5dě:5d̛::8:H:P: - pLt ޴,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z BZ YNZ  el i -L M$`R @0"( Px  0PXP 8@0H @`0 ,0 ,04 00`KP `p PX``@000p @0 00 x@0h0P @0p0P| YϊB?0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L ꌜ:`::4:x::̝:::L:\:d: ";l:|::: -pL@T P` 0 `@S pPQ 00 R 0 QR04d4d p-0L@`T  P @T DP pH0@Q @`0(0S pp4d4d 0- @RL R000 00@ dP h0S& 0S0 00@P0@0hP00S S t0d 0?x0 R <0< Cp0Q@0t0t0t0!Ce5dVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0哔!Ce: 0-0LSP@@000CSx00 D0D d0S0d 00dP@0t뜞: -@LBD@ 0tt0P \@ 0P0 PT 0@hC0SP0 P0P0T00@Tyixi -L@p`Pll\ 0 @@Z_P  -L`pOBh@PT! 00  R 00@00$ =|C0WS]-Bh@PTW 08 h0S dC/h]CȞ:: -LM`, 00 Y B0@!h0S AC, 00/@PCAl0@S\h0SY/CAd PR U@%Up007r00;00@Wd RhP UP @Up 0SP 0SP B@(KP 0SUR Hz008000( 0^@ BT iԞ::: P-L l00Csl0 @  S 0@0lh]O: p-`LV@P00   R000   pl00l0!Ce@-Q @P -\ 00 R 0@V i5d -1 RL PpU. `PU 0 00S00` A@VB;W`pGZ`V Z $G'P0@X PU`( LVk3d i'5 4:(: p-LP`\@0^0$C! I p\ 6P @0  0S p@0@  0S pp$3 0S p p-LP`@`T0  F000%VPpX& - L@0 110 -LM\@PT`o T^dP[TYPW1 L0p`X\ PH\ 0S d RE@$T@7 0\ 000   P00V@@T@!0400P 0400 R R 0S 0S $1 0\7@1/@@\` @Pd 0S ǭ$0 @0400P   4 $0<$0ji p-0L@P`    eP$0<$0p7$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiLP0x  KiAKQ0PU 0S0S PU-P $f/@$ 0 00$ 0KP/4d4dti -QLMp`0T@$KW00 P@ $xW -80T 0CSL@80  hQ"80S@0 hLVk -LM8P@U08040`pI<40#I8`9U2 V$P7U 800CS80 0,0@40, 04  KD0SX 0|<40 Ki%[  0尐宐 嬐6d8:L:d: p-40L\@ !04ph[ L0S 000CS'80 S0 @0p>D0SXp0S P\QT0T0T00T P0SP0 P0P0T00@Tph?xQ 0S00 S1 x 0S004 # x0Q' P`Q x 0S0 00RV`V 40;404;40.0x0xQ&$"x:yi:::0qLVk -40L @ x 0P Q x0  R0 00R8 0r03P0S 40 8 -80LS ; - 0RL@  40 <0S 00S 80S 000 000CS0,0LVk@6d 0-80p 0CSPL@80 0 P 080S@00LVk -40L @P`  P<400!ZP@08#1pQ  R8P  _PP 800CS  R80 |=D0S P R T0T0T0 @00@0>8P RT 0 P T 0 P 괟:yixi -000CS1!2?01L`P@p 0 00S 80S1p@T @T x 0S @T $-x Px0Ppx  x0Px Px⻬T` 4 +4 40;40@ XPY00S    ,0 0,0 LVkyi -LM1 `00U0 4 8 ,0 OL ȁA0 ?0S0 " 0`<1 `RD!0S9 P@UKPPUH PP RT0T0T00P T0 @  @ =00S ,0x040@0@00080,040P80@(KT`p 0S 0S =l Ʌ0 0 `0|0 P =0E00yiLVktiyiDeyixixi`i: -p0LM@Pp0 $0KT `P00 $`0p P$  $``@6d  , 0- 0LSP@  @-P0@,꼟: -`L@T& pU@ PPp0 'P  LUp@W 0X $@TxiLVkğ::: -L(=LՌH0Q P ,hʌ$hnj $:hei8:D: i -PLM4 8 \ 8 04 X> 4000 |P@/ R, ( L0S30X@`Y6:P,K,pP T,@  L0S YX@$:` pP P N(K0` @G0T04 b80ph0 R \c0` 0 40a8  p0,,0p " 8- xi5dL:yi -0LP@U3 PU0 `CpP "+@p P 0$0 p0 00$0$(0$0 ⒫/0B0Z 0bYZ 0]@4d 0-p0 ML@d@P@XX 0PP<<0< P0 P K0hIPH K ` 00SP< PP8 0mPP1  00Sb  0?PP%40 H<00<0(K  0,0@0,0(PP0S (|0P# S 00l PJPSPPKn 00 000 @ 0( PPk  0PP@;40  00 |@KAP 0@p@ lP PP -LMPp, @P t 000(K`H0 00 F y@P00H00\ 00 @P C00, @ LVk -SLM 0 `  0K0 @Pt0 P4 @P 4O ,4 W000Q4PA(K08 0@P*4 =80 404K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,xi -LM0P SJpS"P@?À @$ K0D0"D0`0P=PP K$K( ` P - L00S 0Ex0(  40àL\d -0Lx 4 40#"B ,0S -\d 0-@L0DPS <00S%40"!B 0ui$Rd00CS# t's's' t' t' t's' t's' t' t' t' t' t' t' t' t' t' t' t'(t' 00 00 $00 00 0-@Lx 0 .$ àhL*PPx "88 #$x0000\d - L -LM`px@P= Q R1@P000 x$ 0#40 (K@P  x ( 0x #40CBD * 0 @xT x00   @( 40940t00(  (0x `40;40\d -LXrP: 0-LM0x 0 PQ%4@ Q XGr HL 8à L8d:$Rd\d -L M @xP P@K - Lx0$ "88" #$*qp: 40  x 0 p-PL40@  ` x0 x0 0 `"p 40  x 0 -LM@P0 x0R  R q40 H 0 40`8 V& $KP8 (40sb  f (0P40  0f 0* 0 `$KmuP40  (40"!B *  r 0S 00S 0 R 0 0 0ꈡ:\d$Rd -PL00pS( |h@`T 00  R 00@00 j Ꮏ^h@`T0S   0&q븡:: -LMP`L x0R  $010 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX @PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P{p , KwP ,80S$P3ᘐBC $0S40040(0 @  0* @@d@P @pd i$RdDpd\d -LDMX @`P 00S S p 0SP;X@00 x2  $ R21C"0 @T `@ K0PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ81C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000( jzizi9nm9Q<@:0@- P$@ 2 001^   R 0\$0T0U00S 00zizi R0S  0 -S0L@ h 0-PL@ P 0 0=h0 -LM@pL $0P PK,`K!7   4 00     S0  00S K$ KY PPH$ #$P S $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW .Pm z V XT0 s0^\ S0 0S0e U Z -LM@0 4pSP4` x0s $ h hP(K d0WlW;`0 00 , `pdX01^Y0dp$00W 0, r 00KPPX0 G2#,p t0Q= x0000s7 PdX0A1A ,0K.PPdX0A1\0080 Y `X ,0H `0Cd04K 函PP 4P JPPX0` 70bd0t40dH80c 4b4+p: -LM@H0S` 00S` IH0S L $00  %0`H0 -LM0P4@4 x0s` S0p`d R#*d0X  B2!0C03r T0Q` 0`P0$0dP0i/d 0ph봢: -L MxppPQP@ D0 "@@P< `<0#0 0AT@T 0S$0W0V00S  PD0@`(KT#00K`P'= w0@,#<`k00@0 ` `8`00 P$p@ 0Ml`P 0(V2D 004 0U 00a x0s[ ,K 40KP,H ,P ,0 S ,0 T ,0 4 %,0 4 %,0 4 %,0 4 %,0 4 %,0 4`, 040 0 0d04 x0s? 4S0' 0 000`Q% D @c@0Sw0 40040S x0s``1D @0`0d0!55T000 0 p80K~PP X 802d0,0 $ (` $f`&LVkzizi7dТ:آ: -,0 L;P00 c @SPQ0 `P20s H<Z0@0P10s%b,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@0@4 , 4@ B:{i(:zi -LMP p 02@$p  0 !P  0P:0RT0S$pH0 X1$^D   !T00T01 01$pP0S5:0nlP]`P00W0S W( K,0K($K ,0ܵPP$px~H 04 0 0, $pᑰP K$勰 -LM4p`P4K(K 07@P$,K(04K壵P,(0H R:S 0S Q0S\$KXPU,O -LMQ@`PdX 032`DnP6"\050@0 0 PcpPX 0\ H `X H0N a 0PLpP 00 -LM$@ 40   -LM04`<0  <0_PD p,K8 K0PP40K,08KPP.0, H0P*0@SH0 @0S0S 0 r~P 0, H0 @0Sữpᷯ(KUP0寯<\PP0姯<00<0 -LM4p8K,K 0Q@P80K,08K彴P30P,H0P *@,0PH0 @0S\ 0` \ ~P d ~P 0d`p\(KT0S<:H: -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04Kc`P-(\0H0 R (0S  @000 A @D\0 0S (D`P 0\ 00T00S$K( -L M, ( S0 S0 p^(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 pP@,H0 @ 3  o}P,0x 4qP0 40X`0S( U$ q@0S (0y,姮 (0K,p pP(S0 `@0\p,p\ W,,pT:H: -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K|`P00(\ H @H |P |S0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SK[D  @  D 0 @ %P: ,0 @D0CS,03(0\ C(0`P< K0 (4K A(X>}`P0K40<K`P00\ (H @d 0(K0墭0ϯ`PL R S0 `, x0s P0H0  H L0,`@0P,` H -4LhM0,0  H x @00 T |  d 00 4| ` dS0t , 0tR/(K@ 0Pt | ĸPt @40p@ * 7K0P Pb P0t0 \ X  `\0 0R   S R\ q T `m 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KPB`HK@0PK)@P4@PHHPH 0@ s 3S00S9 \0S`lp R PP pجhh N \ X ʬV\ `lp R0flŃ2l Q 0\0"'t V |  m0t0 N\`\ 0\`S  P X0S@H` 0 0  (H@7K 4{Pd(pd0,0`0x 4r` <0SPZ V<` PRHl v 3`x0s00 @`Rw T 00R00SS  Q u  0 Pt d`0S  Z Rt ` <D0KyPt p D0R |0 0;0x tZ5\ X d\(p\ 0B,00.S  R R0.St`R <` T d`0S  Z R= ! | 0  |  ᦸT0  u  0Pt |d`0S  Z Rr  | m0 40@hQ`K0t0 aH徫t@ ]P t Y` <D0KPhp0S T x 060D0| T   d00S  0PPt 1\d 0A,0l0(0p0\;0t #x t0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t}060x 3P0t@ 6t@ 0x (P060 D0t i9 00  $00 0-L`P @P004  0 0 -LM0K@`FP00 0  -LM"0K@`5P0   -LM`B`0$0 ,` (  h0PSp 0S\, KRU   0%P$  $K['|: p-00LSP@0 0< 0S  `P  0P ph0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z 1yBZ ,y e| (y t yp -L  p`P`R x0`@>0Q `< ; $0 :$0`" -L8Mx0Pp @P (KPڈ7 U@  0` 0``@ =T$0040  0@P(K@ H H :'@P x0, P 4 0R   V P<;`, ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T 80D 4t0LP QT 3R 0D 0 D x 2tQ0 08l0l00P S@CXP@l0 4p0w0@4 C`\ d0wd @0RX O@@0 40,0P 0 R,¨0,0 |QKP00B _P< P P@P$00104P0010h0 0`b删 x0g"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 嚭@Pr,0H@  wP 0|0,00 +0 ,V0,0 yX vPD vP, vP i:ԣ:ܣ:9 -LMDKh p | , P`P$ # `0S    `P$ -` 0S`P W/K-`, 0R(K`KZ 0j`PKKZ 09ps @0,00C 00K(` 00A`PP00S` !x  0 #40S` P $0 lm0 0 z` V$0P 0S`V`R0 0  00 0 0JHx0s00C KP3  &`x P 010o00KKZ 5v0 d1 `0 0 d'` dV [ 0%`0吀P 밀B_ZvPhZ vZuKZ Y_vZuKZ v | u+i@pd9E0  B40R+'`'`''`'`''8'`'`'`'`'`'`'`'`'`'`'`'`'L' 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (080<00 08008d@8d< R00 0S00@Q 0S!0?A01,0000@Q 0 S 1 91 0-L M Pd @0 80/K0 p-0L@`` $0DsVP4%(P%(P 0 0"$dVp:(:;4: -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @P 0@0@H<tP`0@0v@ẦB 0s0sVH:0<0< 0 < -L@- -L@- -00 LR@`Pp Np0V a_Y -LMPPpWIpP 0@ BpT;6pPᅰ( 0 rpy p-LM80@SPP Kp `K"0 00 4 0 00 000^\ S0 0S0T0XV 00Z0 -0@,LL0 'Pwi -LM0 ,0 @P`0pS( d0R`# :yL, 0Rb(K謐K sd K`P 0 !0 04帀KY0K00 x L` H` ["0 00 ,x0 "0.00  K0%`P0  0 n 0TKV KX0K90P L0NKP K.Y0[ 0Y0K0 RK%0-iPwiT9 -LM0 ,0 ``0S4p( d0R# :K0, 0R(K@K 0@PK@Ks00 xp !0 00 x0  000 `X 0H `0Cd0 PPP埨d@HrH@ r H 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r P d KP)  b0#80 [ `0#80c  @0S 002y TKV KX0KRr0NKP KLY0[ 0Y0Ke@ PK K 0H YKL @ P P0  0 X 0"8,0 RK!0KiPwi`7dd9 -LdM@0 P,0 H L x7`LL 0L^|0 `p IH0U  HP>LƟ, 0 R(KP L0^\ | !PL x S0` T  0S x0Q 0 0 x0@x @0` 0T 20Hp0 Ppt (0 d p,L | L) ``0P 6TQ   \  Zt0SHpxPf0 R HK *P]HPp Tt t   \ t R S0oT\atpiP\H0 Ht 7 KPJ00 0 0 \QZ  LKLPX x X \l (0h0 Z T\QpL L|  Gx 0@00L) | +0 .R=| tQ H(00 \0 0 PB `0S p | qT R0S8{x H@w BKp7K pp0 ,0d 0( xp pP BK p0SLxl00h 0( 00lxpP 0S | 1L}|  +L"`\Xd x2p 0@P Q | Lp^x  0S\0d 0$0XQK |  RE X0`@T9 `X H `0Dd0PK pP'P $4H0@x0ps` 40  0x0s $,$8  0PͣpP L@0S 0P吡L $R R~R|RiLVkt9:::`: 0-P@QL8Q0h -LM@p0`SP40s0s 0s$0sH0sL0s (KP0s@0sDq L0$  0R EPD!88S(-S0 0S00 00 y L0$ y0  ,0 s 0,0 0S P0 S 0, Sp 00S~ S  0P(0s L0$  0R P \0  0P00S 0  (0s 0(00Z0p00s 0000^\ 0eS0 0 S0 0s L0$ d 0S P]00S 0 S0S000S0S0S0 0S0 0(KoS0 0S0dYx 0, S jPsnL0$  -qvP'DA0sMg00sz -LM0(@KP4p`0 004 0 0y 0000S `I Pj S0\X240 S0 0L004 @ 0 0400H@ d 40 Q0 408 <0,0( DS0@ 8D04 d0$04d \0 00@L0P@ 000 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@0! T0XV t0y (0`T 80[\ 0^bS04 0S00 0a0ZU0m -LM@ 0S4p00 0 <@00 !!  0 0@@彽Km -LXML T 0 SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QTRPP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L MP0UCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @ڣP,KP8 K0PP`0K,08KPpPUX^OTL0$  JP 000E꩞C -xLZM0 ,0 p!  pAl! S04  KKKml `0S! T1 Z 0@0TTlAPd h  T!20 d1 qAh 0 d1p2` 8#8Rx1 Wg@ P L! @@tA l!P pt!d0b0a1 KV Sd00X\ 1 եPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@P K81RKUP @儁@08!H| cX!X! 0S 0PSY Q U0x p40 40Ȍ \p@04 .1K`XP KK -K-[0008l%#(@Kl0S/:MKl!$P %hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @娝`q\!rKV 1 R0dA0d0l` p0T!00b0p1d P Qڌ0 0C, 0R(Kx0s{ 0@t! P1 LA 0X!MKeX 0@@@`a \q 04 00,0S<1xSX `H a0C"0n2O@ T04 .1KXPM-[(0K 01BN@0@`1 \A @XA k @(KV "l\{ pt!d0b0a1 KV SX\ d0pPa80 `2| PY1Q U P!PyA0 0x@0RW RU,ڒ0KK,-1K>l-1[!0008#(@Kl0SC:MKl!)P % 0h!`@pR d10CSd1 `hA@hA PUfx0s@0041 41 0U.1K U0KK,-1Kl?@嬜KV K>KXnK?VQD @PTA 0CL0P@P\ ] PXPV X8 UA D8 0L$T40l@Q  ,0T0\0(KY  LP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RLDd0S*d0\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0Pppp0 <Hj00@p00P`Sm 0s] HT\ dP`0iZ! /L d0Rp:LdP nPt00 HT 8\ Q,H0d 0S* 0(L\0P00T \d H0XPRH 0Kd0 PDP\ 0 T0MQ040J@U];0s\0STT\ 20SH `0X c51 a0 QVP t P $h@0Sl0 l0p0p({i0  0- LP X0$ 0X00H0P8d -@L   000 -QLMP P- K@K00, P0S0H@K00, PQ0 QT8dP8d -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0ɸ RW@0D0P${iDpd\dp(({i -pL@` PP <@p ` 0 0 0e0I${i: -pRL PP` U @W@1 gpWP`I:0 g0  0- L@p6PP@ A`@0S @ :0S 0S 0s $0S0 $ \W(i -0R,(SLpP ` VA  AP B@TZ,@(PY .EP uZ,(@Y 0-80LS@P0S  R00Q0 0008m P PP II:(: p- L 0`S t0 PUPU 0S 0S&@gqcpp${i -0L@pTP) `0S0 gPV 0R`@TV 0S 0@S S1;-.${i0  0- L@`1;0PS,6Tw 5T <5T, 5T 5T 5T p5T <5T b5T 0T 5TL0p0P d5T :0CT .H5T @5T 85T p(5T o5T ;T 5T0S i54T0p;0 /4T 0T0p00 0CT0p04TQ4T $4TP gpH4T 0T 0CT@0p00CT 0T~0S{ 380@Sp sr0CT 0T 3Th pL 0 P0 0T0\0CT 0T 0CTR0p:0O0CT6*2T3 2T0 pDi0S< i0S52 0R 0R 00 p (H0p0$Q0pp 0 P 0p00@S0p@ @ 0pD00p0=00p0S0<0@p0 p 4001 @p- 1  i=0p0<0p0P1#<1  P 0S0p 0p i0p0S0@0 QpH0T :00Sp0T 91T p0rpP080kB @~fwBfB{BlB sB@f@nB@wt@|B@vB fB@hB yB}BzBjB@oB@pBxB@vtT8d< $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@   `0 @ 0  y0$0pP` #P0Se`Q\`V0 0 0 0 (iL: Q-Lp`V Q CiQ Q `QE ?*00@ T=r 0iTP0 ;_r17`q @P ``P 0iT& 0Y#Y#  wP ` p$w Q0 0Q Q000000` b 0 0i 0 -LCMq0  0 $ `B @R` P52` P`$ 0R& K,IK J/K0_`P(h 0Skq(`81(0@ R0#1K0@ (` i90@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'|0(|0(0(0($0(0(d0(d0(0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S RT8d -LDM@dKP@pQaT@D` @0S񟗾8(8(8(8(8(8(x8(p8(4(4(4(4(h8(4(4(4(4(4(4(4(\8(D8(4(4(4(4(4(4(<8((8(4(4(7(4(4(4(7(7(4(4(7(4(4(4(7(7(4(4(07(4(4(4($7( 7(4(4(4(4(4(4(6(6(4(4(4(4(4(4(6(6(4(4(6(4(4(4(x6(`6(4(4(5(4(4(4(5(4(4(4(4(4(4(4(5(4(4(4(5(5(4(4(5(4(4(4(4(4(4(4(5(4(4(4(4(4(4(4(5(4(4(4(4(4(4(4(5(4(4(4(5(5(4(4(x5(4(4(p5(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(0 W*W$ KF$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ 0P:01WgWj 0P:0Sc b0lS] \P010W:0 $("0P010z0S2 0< 8mP 01ff0S 010c][`Y01@S0P0 K10D`J0 K10DD`B@>0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000t8d,{i R000  B ,{i0 R0 8dx8d -L$M@0Q0  %2 @00S@0<5  0RK@00CS@0ʼ5@ 8#8 % 5 2K4 K ii 9 -L$M⠡0P(0 p8#(`HK908#83K5X @T@T 0S 0Sᎅ@T`00@T! V 5 8#8 #K% ( 0R"$K0HK03Kx5 P HXP P XDii Ld9 0-L-`@PQ \0000  `00`0Q0hZ8d -L` p\H0PU ,0S @A@PUh;ji 0-L,0P@T @T0h(|8d 0P c X\ p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P -L M<@KP`p \81,` 0 P 0S@ 0S  @TKT00 ,4Q h8d0{i 0- PR0000 0@ L 5 P  0h0 -LpP@s58!`0hP 0pq@P 0S@0S`x@h]0{ih8d 0- L0@SP 00  0@ 5 P  0h00S0 000000 p-`@P LP 0Rn[ ph=P:-Q 0P P P-@0 H0 D  p-0L@`T$@T [P 0 RP U 81 SPUpppl8di$ 0-H0L@PT $@T i[P0000l8d 0-<0L@PT@T 0R[P0|8d -pL#W`P,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ ZP Q  ZP PUP^ -1LM@ T$ P$@T ZP0SP 00P$ 0R! K@`T SP4pK`gZ 0Z P@T PEUl8di9 -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK`)Z Z 㪉P@T PEUi9 -L(MP R0P,0 1Q  R P 0 0S0CPR PQP P, 0R](KP0@l1ZS RLKO0  YpW60cPU   WP@$ 0X@p PEW U`0S <Kⷶ >X @ Z UP0 0eP 0@ *<KY  !P PEZ @P Mi|8d9 -LMЀ0` V$ ! P0@T PPPU4pK@T PU `aY Y P $ 0R K i,{it8d9 p-@LT`P@@T= YP R000 0 0 PP 0S R000 0 0 *00CS00$ R( (080(0 0$( ppl8dL 0L0 0- LP,4 P@ @ Y 40$    0$ (0@ 0l8d -0LSPp @T @T %YP  `P"  P ]Y@E0/SWY09S@P 0@T$@T XP000@p 00   00 ` l8d 0-81L0M0Q@ T $@T XPP @ T(@KNX0 (0K'K@P <Pi@PD@K l9X @P <P@U@P 0RK0l8di:499 0-0P@L0P S$P$00 K(P(00 C,P,000 - L@ R! !  110C0C11f 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 fH0T0H0P U -L`0pPUPU 81W5 @T@T 0 R0S {WP@|8d p-L M8`KP@ wW(P  PKph8d P-L`Pp @Q Q P k@P 00 0@@@\ 0\   dY( p-L`l0P@T %0B8R#8 S51S@T0ph|8d< -@L%(h -5@05Lo%`0 hec 0-5P0L5@T mb@T  R! !  110C0C11e 10P RZ:%0h p-L$M`00 (0P@T@T 5 5l8!#8R KH< K@TM 0RKp`i|8di  9 -LMX, > 1`V@ `V; 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P P㜑 |8d -L0LS@  ~PL  $n 0L0ah$ S(<Q -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V VP VP0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S t8dgfff p-L@`P PP  R 5p@F p-ppp p-LMK`e@PP PP xPPyP  -xL@\P dd P 1S D1 RQD P %0S 0R*0P 0Pr0A!R<10 Rm"pW00R:R*  oPH`P !$U /P$0000O7x8d8d8di:ji: -L@000  0@bah|8d -L@00S0 0000@ho|8d p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@嚐\0@P `80S ph000 0@@08d{i{i p-QLU` @ 02ph-p -LM2pS0 +Ue00S P, h0C00 0(,0  ,0(@`(000 0^TPe0 05U0d00@0a0 p@B  @0PU0dodY( -L M<@< 04 PT/  i Kh\e:0{iZ( -LtM␫PU, `p@ p;U h;Ua \;0SM`P <;U} F``, 0Rt(K:UK 0UP :UI P` :引U G:U nP0CU0CU*0CUX 0U 0CU \ @ 0 `5 0# `05 @X`Pd````9U N0CUD t0CU 0U{ 0CU`㰑`@ C<9U3 <0CU 0Ua 0CU~1`08U 60CU6 0U 0CU`P`P~ȕ`Z8U[ 0U 70CU~`PL1Sd  `{D8U 88Uh41`0p 8U; 0CU]n`P+N`P& Y7U v70SEU`PLPK 0K`PC_Ov@8#` N 5 ` ?8#&@h5 @[5(2Uc 2U_2UW 7US1U@KO@ 2R@ 0Kd`01` ` [`n@g,8#[&l P0`81w`0@ ` `Vg` C PA`0@ ` `VR` /PW@P`>ii$ii$zi i$xi Jii i  9i i i i$i i$~i ?qi Ti6i(KiFi@i i p-PLz5(";5!2"1!`,%" R 010  0 `  R0 10  0 @T" 0 R 1S 0 0S@T 0 R0 R404 140 0 40 sQ1@ @2A$(,0@T 0 R 010Q@TY@0 !ph40W(A( A(}iiSk|8d8dTijix8d -0LS@ S 0SQ 0S 0Sh< XPPT 0S  MPP ꤕ9 0-LPP) @S& S 10 01@T 0SX10P 01@T@PP@0*u1h8d;:HH-0#" A0: 0 A  AQ0A0A{e 90@-PR@ 0 0!\!""0"!0l 9@-pR` @P@@ 0 ,>#!^ """!1#  9\ 9   -"LR@ \0700"R p-@LT`P5 T T O Op/p0S 0S0S @T O Op3000 00   00Op@Tt |Ol xOp@0^  0@ 0000 0dOp8d8d8d8d -L M@*PK0pK `P5BT+@T(  1OP +OP00CS0 R07004` 920C2 OP2 0C2 `$K  -L M@pj*K0K` DPP*0[P$K00[ BT@T  NP  NP0007 @P"  N N00 p2 S0"00/B 2 02NP202Y4PU7P -\ \:5S0d0\-P41P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL M @42袌@42teQd 0-2L@41pSl0 P4e 1d hfP0e AN020D 0hu$( -PpL`[81W(0 58#(k 0.   R P 0S  RP 0 MPP  MP11<<88#8#8110 0@0@00@0@0@t04 !48#H) 1# 5 2 $3TT # Td 3T00S 0Sj \ib MP i\a㓉1 2T& 2Thㆉp2@P p$0Si  HB@ D0RW@ 1 00Sa@`10`@  @ 5y5Y1@P p0SV AtI|1@P p0S7 \A0S H1R0T4OZ %_`P  ; kp?ZH00H0?\L0Spm000 0@@0000 0@@0cZ000 0@@0|8d{i5݆{iSk}ii -LMp@AAP`2@ V[(KT 4 P:  dP 4  P \Q p3 QUA@@@P R+x((((((((((((((((((((((((((((((((( PPo 804 0C@800-/@4K L@.K  L뼀 h^PP @ ἀ |ZE 4K v㲁@!1`R?{[1017@z0.K -P㘁@k.K 0juP 1  5  ?@T= P08!Pd 4 P\ 0A@@@0!0 1SQ@P10Q!00@  !0@ 0 0@0@&@@ 0]Ps  0@kl,d:ʚ;Q0X0ᨁ0 Qp-LP` 0CQ :R  R R /pt0Q p%0CQ05@@05oV (00p0h0pp2i i H( -Lp`P DP 5AUp 4 20S00 0@0@0O   R R 0,Z/Q`@ D0RH00H0Z 7LQ`{Z40 3A0 D@ 1 00S၁@10@  @ 30P` @0S |P`0@ | 0 OP`P`000 PP\-:Ski{i{i̥: -00L @P {i p- L`@EPP(  00,0 h0%0 1!0 Td0f e ^D 0p4@P p:\(0({i -@Lh8d- 0  \  \ 00SP \`0S S S 0S 21C 08d p-` LPP0#U T @u T0000 0  zTp -P`QppW@L qTo 1R& 1RP  0Sc0PS000000P 0S 0S PP P oP>   R0; Pp`PP`p XP1P!  Op @P@U00S 01 @P@U00S $yyPP00SP P0PP5i 6i( -L@`p  PP 0` pP0  0+: 0-L @PP 0  T+0P P 0 P+:8: -pRL` @PPU@ -L  0P +0({iL: 0-dPL@XT f  @ T0a ` u{i 0  0S-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p p@- `P0Q!U 0Q 1 !@ T0 0# 0 0 0#\pp0 Pe -LMp, ` 0  ``0S@ T00 R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !]PPU,0S@ OP@@0\à@-0@    @ @0 -L` P@@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`G0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0eeX(((x(( 0-0LS@P 0p 0P 00h0 0-0L R (0Q0 R0PS0hU) @P 05G 0X0X Q*00Q8P 0$[) Y)ji{il:eee{i:: p- L@PT0`0 G00 00 0P0`@p ;P@){i: -0 LR* FP -LMⰒ`0PPP@R@T%T〢xx2 DF dFQk*0PSh 0RS BQ:`aT"0S`1 pqQMP!``08Vp9WX00S0 Pp \10P0|F {FH1, K0E,0pS: ^!Q Q\ 0e 100 0  DFPpeKF 0 00`0 R 0e1000<C(>0N S{ieeH;d{i 9Ц: -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R '  00CS 00 ^ڿ0S  \ R0S P P  0S'  p P @ 0St @Tz  dlEPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S  N'p50S  Q0A 0 >\ P \00S Q  00CS 00R 0hd 'T'p0D0   ( 00T::,:x:::{i -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @2PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R@ V 0 0@S@ @R4 00T00Sp@T" 0H(8CR0P ,0 SPO 0UM P^Pp@T -P0UP08#x0S5 R 0AS0AS R0 040 BP8 k ` 08#800 4QS 0 00pSo0 S 00 0@RU| Q 0 S R 8CRQ; 0 Sf PR 0S 00 0 P@SP PEUp@Z@ r@Q R#3p0pS 0$%P%:Ч: Q0-L@P0h0  P  @ P00T00S00T  RhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"ey7 p-L@L0`SPP P0  hpe - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H>$H`UT0D@`fPUV00S@ PU P80080>dLd -@L `P pP 0 0 R APPU 0 S 0:: S cAP0 Q 0S R 0 S PUX r0rS f@P@P T 000 RAPr r0R Sr -Lp`@r00S *@P @V PW 0P 0 R|AP @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@=#: -@00L] R000 h0  p-@LTP` X0X bP P 0< a!0S00@@p7pL;dP;d|i0 |i - QLp@`0P& S 0S-` XOU` T.(<(T(T(T(T(\((ش((Ե(L((ش(T(((T(5-` PG @ @` @ '0 ` `r`"-` 0S* ykc`cc`W @T8`0 0 0` @^.]Nc``P`9` 0S  0`,: --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 ?P P  ?PW  0QP 0 cP Np@TW 0 cP N(KYXp|iʚ;0 R0%3 %'T;d|iP (0 P0 QT;d |i 0-L@PP P0 A0|i - Lp(-00 R310 P0 T;d |i}i 0-L@P0P  00<0 R  R 2SX;d -\L`pP@P 4 #P P%U0pS*T;d,( -< LR@ g00C0S 5 40 40 r040r040 -0L pR㐀` PP%U q@P P P #P4 #P 0`S* |iT;d( Ȱ-P2 S R 2 S,00CS,0 R0000 0 پX;dp@-@` 0 PU1! \ *0 00\: Up lp@> 0-L@0#PP ">"0  0 %?0 -0LSP' @T=@T >P,00,0@Tp, "0R8@#xT0W0 㤾`P >,0T0r,0  @ 0``@00 ``pX;dP -`pL wPP# 0@T \ x0$ @TP0S 0Pl 0S |iji}i 0-l@LTP#l@T  R 0 0 0 R 000 0 0  0S0C0 6l@T0,|i8: -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0! } OP7 pP `l R0 0l ` 00  000l,dp,d,|id: P-L 0S 0C 0 h能눨: -@PL) 80CQ840Q 0 x Q00C0M@P` ]<h 0 hzx|i|i::: 0-L MdP@TX0T$ @J@0@@ 8],00K0T`;d:,|i|ie(Ȩ: -p0L @R  KP 0@ 00@ R 00`;d|i P-LPP:0A '`P0  !@P ̀Pp  p !<  !<̼ɼ`@P0P  80P($0 0o_ |iT;d|i -LTM0P,0 pKt D <@lP 0P @P 0 @TT!` 0p0`p 0 0S Dh<  0lP @ t,(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p D9< 0l0  d 00h0 <0S 0 \ @0 X <04  |i -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  pB@P9  @0 ;W  ;dP 80S0C80$0d040, ;Pd T00X R XRX  0;M -Lp`P-@T 0 R P@@P@@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q `44P30Q  R 004PPP 00 q4 -LHM`ǟPp, d @`P/`  000 0WQ W W, 0`0 dƟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK;,4X0`0 - , @P7`  00Y40 ~100l0r0Pr 7`   @PP 4P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h  P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  y007 P dP ` l @ 0Sh0 k l LLl80l0r 80r hX 9  P iP P4040774040TX (P\ =40 hPHdPE ù ` /P` 4`40 r0 X0 0 T \ 80S\0C80;TQ]@0S h @0@ 0<0 0 S l w h l o g00C0S540040r04 < <4 r0 i|i|i 9:: -<1LHM$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V 0S0C0hPUpW  j(Kl@KD90 0h  r p,d|i,|i<: -LHMpPU$  R 0 0 0 R000 0 0X  `V 0S0C0|PU R000 ˸ Kd@KD80 0`  r |,|id: -2LxMP 0T0 , 080 ppQ` ` @KD80X0h0 p dP  0_/NKl  T0K IX`o , 0R(K _? NKl  T0K .`PT@T 80@ 0CR80 @0S  @@P 0<0 0 S    T0Q%0S" OHP7` @ Vp }P800C80 @0S PZ )G0S3`A`PT@T 0 80S080Z| Gyi: 9 -LPM`PKpDd 7d@ d0K\ T 0 X 40 r <`p@0 0WTd 80SK080dJ -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKD47xpK t0l hp d T (K 7P,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@pKD6(0K#x`pK8 <@ l hp d @` @,PP 4`P0t03|i |i|i -L M@ 0tj%6l0l Q  0S0 QPK븩:}i|iji|i: 0 000 p-@PL,`6T*^1 @0 CS  @ Q00T0#Sp p-P`0Lq600 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` PA6@ TXU00  S@2 ,0S/ 00S 0*0S' 0T P1 bP @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 05 -LHMlKP D51pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0eP 000@TT@ L@ `@ pW(K 5d081 0rl0 0 dP0 00|8d -L(MP@P`0AS`(KHK `O5 0`T<0 H D 4 @ T pxP H0L 0CPS ((@((L(D@ePAL``L0P2<0@ X < : 400hS `300  `L@`U @%T e0P U`P  ``0 pBK K ,0K21C0b ?A1c0|i(LVkgfff -LpMⰁ0`S( @2 PKD4< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK"4"0J0KP  HK5dp 4 L r0(0 080<0< 0帠 0cP00000$i 9 -L M 0@0 S$($((4(XP,P @CP00S?X/ , @@  ;4,Pp @Z `Q 0 70 0BR0`0 FPP+p W@00P0, 0 0(KP,P dC@P00S ; C1@CP@,P P@,P B 0-40L@0PP X 0WP B8000a0h400400hLt;d 5Z0$00  l0 08! t R00 S V&  p00tlK` d0 hp ^Pp  504 000r x0  0 l0 08! W4 0 0p0p 0Z}i;dt;dd;d p-0L PRp,`P @5d081 0`0,P0z$ $0 ph}i;dt;dd;d -LP ^@P @00 `p0Z 0帥,嶠T 0 @0 0md}i;dt;dd;d --LM8P @ 0U, X0 T@ @  0SEPP 1 0S p2@, 0R(K `V0S+pWV V(p RP7p  0Q?H 0\堠 0X4 X00 V e\W @t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S?000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#p 9P0L0Q00P0S>S  j-R(((((D\ 1 R 9 p-0 0 t8LS@`) p8PS ))x)4)x)x)@)x)p):0 00CS))))0:0p080p080p080pp8S 000;08X 0\<0<0`8 8|"R j-41 \ QL 9 Q-L QQ20@ST)\)d)l)t)|)D)L)7P"  P P nP P,$`0 lH U: Q-L QQZ$P> 6P? P? PG 0@*S)) )))))))0)))))))))))8))))))))))))))))))))))()HP 0P   `P lP`@ 7n: -LHMDğ0"}@Pp`,0 . 0<K ,p h h0S]h  h #0S: 3 0d8 Z ?0 "0Ql0 @l @0Sl0 P P 0 |d8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q0bC:@: -!L0pS1`o Qo1_AP 00S   R` V0 00Sw + 00S v7 1v7 ^ V 00S  ^Q 1vGT@# P 1v'R! 1?0Q w1vGrT@k8: k),0`iK. h 9\:j: 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0,)00 @ C0jh -X@LQS QN Q` Q`  V`!0S6  %pP VK  )z  P<, P PP@1 R P48 Sp8嬨4S UpX %00S`8<`8 J4``V0 Q2 RP`8<`8P 0S8X p ``PhjJ -@LJQ+"" R222 h; -LMp 2i 10:u +*!P0`00` VP O0S IP? 0 `0`+  V P`AP1 R!  0@!0@)0XL1 Rd  d 10b 00 R"  =2pI,I0~1V7 1V7 = Sd 000 0SH 000 0S, 000 >S 000`)hVp:j;d0G:0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫d8>-  0?/ 0 ? 0/? 0/? 0 2"<#)`")@P&)))))))))))))))))))))))))))))))  `8 01S]="!B10b%= 00 0 == p-OLTP`@@T 0R! (P V (Pp -LdMP,!@0|  ,0 p` m(P.xK  々 rK| ^(P&lK r LKn0XXL00 0C 0 x )0C| P, 0R(KxK  Q@lK K` i\)(): 9 -LM 04ab 8#8$0(S( p"hc S( 0R+$KV#NK %0F898#8 HPK1  #NK 8K e 0i, 9 -LMP0a4ḑb8#8 0S, @!hc/ S, 0RW(KVpfN@H$H"00 G'@D@H$hOK  !("(0!08#_ #<" a0b1p ᥄   Br@ 000S0 LPK 㒄OK <K ㍄ Y 0  pb ?iH 9 -LM`V, @ p& 0PK0K`V0[ 0p0K ?  : 6K 2V@@K A, 0R(Kid 9 -LM`04 8 $#8(0"(S$ pP# S S $ 0R, KOK l gQ1OKVB QWOK 8PK Q it 9 -LMx0Q@4`KPp $0 ׃  ' ^&$ 0PR Ki 9 -LNMPPP$ `pVOK $  DPK  㛃$ 0R KVOK y Pt pDPK k5 }?i: 9 -LMO`TPp@@T 0S G&PP Z00p8S  <H ᐦP @P @0@0/@D ?@,0o@ -LRM`V, h l p!  p2 K0!(KH@^K Q `V$ 08 p#Hhl!z0(K@ ?p ;  7YK 3VL@K. , 0R(K i 9 p-`8L`P@9 0K 0 9 ? 0R>:0 "#A10a%= 0 00CS/@!) ) !) ) ) )0!) ) ) ) ) ) ) )@!) ) ) ) ) ) ) ) ) ) ) ) ) ) ) )!)0 0  0)S0 SCLR0S 4p1S]/phph phph  048# @(R"!B10b%= 0 0 0C-LSX")0")P")0")0")0")H")0")0")0")0")0")0")0")X")0")0")0")0")0")0")0")0")0")0")0")0")0")0")0")@")D4h6hIhz h -0L0C@S 0#)#)$#)#)#)#)#)#)#)#)#)#)#)#)0#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)h$ Q 00CS#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)g0 -OLT` @ RD0D0D0?@ D0H F$ŤOT^p:$W 21C! c%- QpP@  $$W h$ -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>Y3l080S* @4PK = r$ X K0 80VKW0K0  PK, JK(vXK   BD@Kt #P  1`p唀@@, 0 R (K\@ >0>3i 9 -L(M0p,0 @0 @00P K080 PNKO0K  HK݀ BKـ ' PK  B Y1P 3PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   #   Ꮐ 0 0  00 0@0@<, 0 R(Kx> 0x>25i 9 -LP@y00 0-LP 㣣@P @0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @1 OK- IK)0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K#Y0 0  J40` ᡪYPK 0 0# 0Q`  ᔪ 0 0# 0Q  `冪l00 l000h@p `lw, 0R(KAK ;pK}0 SG0V0K`^^Wi 9 -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *0e2@P@ (  R0P0Lj\ 0T@K 0P S  b K @DKd@K @ DK @0@00t K6PK5@Kԩ0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT K⒩x08#̠DK#8t K@x0 6K50K兩U|eP |  @1Py 0jR 07 0R@ @ Y TKT KXPT0Ed@E 0TEP0#U 04@K|0 /TK !PU0K}0A, 0Ra(K; 01P0 0. >0>e0 $ 0S0 10PP ;01P0 000S 000010PP 0S: h>0h>200000 >0>&0$0 0@ h>0h>0i 9 -LP@ 00 0-zLP 6@P  @0 0 -LtM 0  ,0 00 1P   .P 0 R 0 @ 0S p-0 }P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0x>.. x>0x>.mi, 9G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ\ 98G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00\ 9 -LM`8`p 0 A|P 0 031C0SpY Y`85`8  0儏|? 0儏|?>M0,0P:0,: 0  ̪:<(id?) 0-LM8@SP 88 R 1S00 08hh -L(M@p`QLA)$A)@)@)8K00S0,0K00S00,0KPPK0+0K)0K*0K  0  g@ @T (K8K  z2K z8K  ~z2K zz8K  tz2K  pz8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t0@-@PX@ 1 t -+P 0 BjR 0 X 0S X hT yX00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 /dP@K8#8  l.X T@0pdXGtTP@\  0@a0g T@! l09\ dX\ p.P@ 0W 0pU` ,P`v jX RPP B;,1P  t\ @PK 0 * 0l \ e80P[l04@K!T0X P^xdK0 l0 !!t\+, 0XRd(KE pt>0>M+| $X h00Sh000d`,XX.hE ;X+1XP0 0pth>0h>&+X$+X V+lxE⠐2pp>t0>+X+ X 0S:t+X+p@>0>dKX *X t*X@ p@th>0h>*iD 9 -LP@00 0- LP@I P p8S0 0 1!1!0 0 -L,MP T p L +0PH0  T )PH0 0 gR H 0S TH < < x00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? LT< 0bY[H@0`pD @0 D@b 00gT@! @)D @   dL0Y@`p @D 0WpD  0VP:+Pg PgY P P U`` P   P L0CoP"88 IL0 1; n*1PP P0H@0 k( P+P3 0 0 0PLP!0<T @ @0LH 0@P 0$$$$ P @  L06H 0 0 0 T)H(KP Tx>0x>)H)0H0  ;H*H1HH P0 0PTx>0x>) -L,MT pPP 0P,0 L T0` 0R<@K fw 9Kbw  LT *0PD0 T r(PD0 0 BjR vD 0S D  >wD0 @  fZTPITD@PH  0@a0h T@! L0H  dZH +P@ 0X 0Up `3*Pp? jZ RPP`` B;v)1P  H P@@K 0 2(0L f@0S"T(, 0DR,(K ;DR)D1D P0 0zPTh>0h>(D(D PTl>0l>T(D P Th>0h>(ii\9 -LP@00 - @LBיP  -L(MP `0P L ,0 0H0 )PD P 'PDD 0 iR 0 D 0S P@D P ZvH0\ 3\H01D0, ,400<@K30 Av 9K=v  HP0eZHD@`P @  0@a0fT@! @@   dH0Z/P`@ 0V 0`Up 2)PpN iZ RPP  B;u(1P   Dp@ r&P%@@ 0 ##Ƞ#\0PH0[D 0 0 0 P', 0DR3(K00 Ši(P 0p 0LPx>0x>'D'D ;D)(D1D P0 01V@L Px>0x>' Sit9 0 S00RSS   -0.0RL >@0#200   N000N "" N04\0N`8 2S0S 0> 00>0S 0> 00> -LMp8@S P0  0S00 =$   0 p-LpȐ@\P pd8  8S 0S=0=p` 'P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00@0!0 8Sh@`10 hH( H(> 0-LM@KP t P P P K0@K \t tP00CSX)X)X)X) Y)Y)99 0-LM@KP qt SP 0SZ)Y)Y)Y)Z)Y)K0@K |Yt ;P0SZ)Y)Y)Y)Z)Y)Z) 99 -LM@pAP,0 P0 Y 0 0帡t:P)0 Yl:0 $("10Y_:`A8!#8S,0 P `A @~8# P, 1 PI0SF  Y@: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:/0{(00*0s0\ 0>(00> LW0\ 0>(00> J 0-\PL0@  0S0 -00Q 0R0;00 - 0L S`0 $"!@21C0d!P2Sp 2S? +t022S  Q ot02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi2SVㄅd5S @d5@P%0f T0@f@d0d5 -@L7hꜟ; - 0LSP@ `>pȐ 0\p``> \  8S 5hQ!48 #80: - 0LSP@ \>pȐ 0\p`\> \  8S 5h#!m48 #80: -L,MPpP >0>(Kt8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*0>00>H0S 0SD0H  X>0X>PL 804$@0<0> @0Q>q @Pl"0002 R 3 `87`8 `87`81Q3#5Y51 R\ `86`8 !000 o5 \1\TA@08 #880(8 S808H>0H>UH` 2SD` | SyR0>00>s+@K q PhPf0Sc0< S < ]< R [P @ 000t0`86`80D < H @ Lj3;;P:9 -LM@pPP t8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R @>0@>0>00>;$P0S`88S 0 0  000P  pwPPxPP p-`LQP@ LP   pp 0@S  p -LXMpȐp\x |0  (Kt8S @P0"0S 'PL>0L> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR0>00>+@K p lP0` S ` l d p h ` 0>00>l0S 0SpP 0 S: R @>0@>|;DPPx(0BS @P# P 0P>0P>aR8 tX 48#hT> 0T>00x0\ xHPl h0xp`86x0= d0S ?` R ?E(Bx 0 :G P 0xdL KbPx0d04[SC +x0J ox R oD"x0<0| P0T x 0|0 c 8xp p \ 'L K#Px00`0\ 0xx0 x7X>0X>nȗH0  4[S *d@0 <0Q)[<0@#[ #[  0@S  ^ H 80S`8 ^( Q& x aP7H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.9 -LM `QpP@! D>p(0RD> KČ Ƞ,Ƞ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 mX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*0>00>xQ 0S| R 0p S`1v'R!4>04> t8S `\ Q8>08>`010 / @ |0PP `P TPp(48R# 3  p0S  00>G+@K Dn P<0S dP 8 R5S30lSl -d8 WO x t ` | p l h d X 'p8S `8 hQ ?Ud R ?600`t8SP8SMt0XS ,1 R `86`88X t 30( ; 0 Q(5*13lP:  6 7`P P`86`8 L K P00dPH00@  <008 < [ L KPh@ 9j -LMpW( F`(K(0S(  Q 0  0@`W1(PU  @P,  PfjU; 1P (0S 000C `b 0@P  `P J(F(D@M: -LMP`, ` |2S  @2R >0>o p(|00 @R|0@ pVZ D0P0W0SJ`8 1RG  o 1R 0@? @P 8SV4 p`!1R8@0!0 1Sq@p10q!V ! 0 0@0@/00@0@κ R, oK*t 0!pP 1<100 @0@00 @0@ꈎʚ; -@L 04"48#hV1ھ 0R p PP # 9gg@ 0S1#@P>0>0S0S DlK`F>0>mIꪪ -LM` 0PSp :@00S 8{)`{)l{){)"PP>0>#2K 01R0S= 0F0f8#8 $#$"K  l00 nPP  $K2K  k,K  k2K2K  k,K k2K  k,K k0SFKꪪ 0-@L&P000he -LM`p!28#8N8 ,0 @P0M(K2>0Q 0, S PU @0 0@0@`00 S0 00#  _P00  XP4 U 8s 000 @4`?`@T 0S00R0@P]o,?=Ÿ ` -LMP p@@T0 T*   vP 0 $a8Pp@* 00|  `P@0 X 0KP(K(Kot8Sp8S P99:p_) -LMphpV80  PU=0= X P  ㇩(Ko@=0= < 0R40  DU=5, %02=5:0S@@TP0P  40 S00P 0 <0S t8S! 1T0#28#0"=00 40.  0S=0= t8S 80 0 08 phVa < 40R  <\l \KR>0>Fp8Sp>0p> t8 S@ 6  TT T 5P  1}@ 80(Koet8S `' 2 P:8 SF >0SU0  0>0>0 0@X0@F(Kd8  8S0 u0S u 000p8S+ ))`) )`)`)̂)R >0>Rt8S ' P =0=Rt8S `' P8 00# `0`S `8 ( 3 "0@. >0 > >0 > P P  `8O 0@K0@>0>v  P>0>m P  F2 "% ,0 (Ko[TPT>0>00@  POu0S@u0.0C0 0S 0 BQ.0S*@0!0 8S@10 H( H(0S 80 5 X 0U  % P>0>O K 1 0Rx |   00C00 3 2C 0%R &80  0 P) ,0 (Ko P 8 000 @Y P 00 0QP8d -  jLMp 8#800  b1*"*RX,  P`M @d20\`, 0 d%020/,000bV0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 00  <   - 00c:#: Sʲ00h:#: S>0>@gV@{< 00h:#: S  0$KmE -0` L p' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8hy -LM܂@` p2 0 S/0  9 280  $"" c("(P54  S0  n `8  <   %80  040 2(K!0S:1  &8 480 c1 Q051Հ5Z8  C PbV>00V.H$H x,0 0D8PS`!0@ 004 0C0- :0,40 0 㶊Pd @@2S  P(8  0b0 %,0V0 <   | 04 0b:#: S40 (KoRD0Q5ŠdF%8dEu ''H* 0S00\ \0S0S *%SS-P\2 ڰ\- ʀ\# \ d>0d> \ 0\ @\p\ \\ \0f20W -LM, 28 40 cV>0@p,  Ƞ,0 - 0 0cʠ,ʠ \Pʲ 0j:#: S< 0bP":#:SXP`M @d20\`  0 d%020/,000bV0804P!e00c08#8:#: c ʠ B0Რ,ʠ840a@ 0d00" R 0 0@0@,(Kob, "00  d50P00 d5" Q 0  ?84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L !f 'f0:0;  B0 [0C\%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @e' e:0 0;p.p0 0\4[BCR8-S0T 3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0Px00x08Sx00x0bd -LM⠟?\, p #?\ =t?\ h?\/ \?\%`85`0& 008/堎@P 00 `?\ .>\ ]>\( >\ >\  0ᐹ`, 0R(K>\y x>\ 0\I >\d8@ l>`㳀ᴁ\>\0 EP>\ H>\ @>\>R`P>P@  P1v'R!{ 1?008@9t8Sp8SJ 8p R 4`=\ 0\ =\D=#`P80 \P=\{ H=\D @=\< `P = RV d89 `8 ;4``8{<\ <\ <\l+27`k<\ <\ <\\M@K! t8S"9 LKM0Kd! 7`NH< @R`hG`E;`P?`Ș  0S774`4``8`83t;寍`P-@ HP`8;`8p8S t8Sj`8  % ' 4P4`:卍`P d8 0S`8 <4``8`8^<000=@00Pp0S h:l`P0SS0`021Cc  6`PpW@P``8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0` R6`t8S' c``8`900{`8`#500(00rt8S4p8S@`f@8`P`p8S] 5A0AS2`XX( t8 X( SX(  <8 20C$(ܳ`=7幌`P7MK! z5`P1M0[ SN M [)LK^c4`""- 0`7喌`Pd8@ 208S74``6儌`Pp8!S `84`20`8|6q`P0S `85`8 c4`06^`Pd8 W 0S`864``85L`P^@P 8T` 8S SX S` 0d5+`Ph+`p8`S >`15`Pp8SK @& P@ PX x0 `p(R  `8KU % b`ro4\) 0\dP# P @P 0{S`̠K|P 000Q@PT 0|PSP:|`E  | 5`P CP  `:8pLK:0; M0Kjb`-`85`8 4`# `00CSN@` P R4 0S1 R b0a ! c%- Q n0S0000+0ac00  -4`P `P P R @ `8 B<4``8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?`84`6`8 a`z`8% ;`8 aMa`l@0Qh 8p Q4`c0` 8iii 6i(i8i4LVki i8i$i4i i5i iiiiii|i0p0 -%L @ 0S 00;P9 0-3L P@.00C8#8S0 l0 ` 00C8#8S0`8d(6 `87`80d8 p8S ! 0-3PL@.008#8S0 P`(0R00`86`83 `87`80$ 0000d8 i! - 0`00 0C00 Lp  | 00C8#8S0 X@P0PA?0Ÿø000|RP]/s!x 0-8LSP@B ⩸⧸> )Rxȕ10# 1 $80C8 R  Rx |   000C0C00 10xP RZ•\ >  0븫: p-LP`d%R @0@S d% T 0d50`V0Pp 0-p8LSP@h> RR u0SV 0S 4`8Dp1 RR d1  C2S Π0 9S x "101000 Rx |   000C0C00. 10xP RZ•\ >  `8 080~80  B u /j̫: -pLP@ 0p1 -L@h -0P00p00 0`@ X1\A00x|L B =0SS0 h\J \0<0hP -LM>Qp +X1`V>xX!^7 9 S02 @")("( > Pxȗ1 2 10S'  2S 00 08`(0C1|200 0mmh  |j -PL@ p[`g \[ (\V @[0S  \[00[0 m( $> a0$>[@ -@L`Pip# @P @Ph螐 -LMhP08pL# @PJ 8S9S7 ႐00 01d>J0>X@, W(8R/0V 0S`pQ  q30 t8S 5Q !₮0 p%0W0"! 8 S 0 o1W 8S S 8;SR 8S S P 8S S 8S 8;S: : -(8LR@`(8R p-PL㬎#M` @t8PQ phHp -LQ@ 08xP7~00P2~ h -LPp`k@P mp0S  0S 3 #0S R@Ӧ:0S  -LpPR`O@@D@咏T8S h芏 0-LPs@P <0p04000w 0d 20H00P: p-@LP! Z02 8  PD < `#  808phH7*J* p-L@`2PP<>0<>   ''Z8p p p p-L@`PP<>0<>  p 0-@PL~$ hZ0p1pP 0hM0 } p-08@!@1L<(84!41(8 $1Q( 1@(0 1Q0`0 >B|}PPx" d8 p0`B k}0P0P2  V pQ h phKXXbPLD]P))|@));d D)xL*))p:9: 0-H/0L000000/0P  `8 00000S /000000001d(  < ` 00000000 P  RY 0<0 p-L`pP p1vGT@@)1@$R@ p0R@p8SFF `(t10S: :  )@R :0RE @` 7$ /0/0@@ @@)@@0SS S S@@/0< @@ 0 S@@d8   P@@p @@@@@ 0% ' P`` @;P@ -LM\0p-4K , 80 Y4PK`Y @'0' <0 P/ T \P , 0Ra(KX@8KyP*`80`8  [@TN 8KjP/08 48K\P T1@!P@T P00P <媫0@   0`!❫ '╫0 <叫!⊫xXh @ P\]8KP <w0 4i;:Ȭ:::T:m:l: ;94: -5LP@h`80`8p@w [hXL08 !'p`X \Xp8S`8 i'00'09@ :0;LX @@- 10303`8 03`8  㛳 㗳  R9/ ?0/ ?0/@ d8  00`800Np }E=:0:  +9 d8  |r000V0Eu% WN @0= =\< 0`,hd< 8 x: -L$M☃5 p$  `8||# t0\8#]S`8 P0`8p8@S P`GS08>U@ ]8PSPV 0RU`@V(  Hp2`8 0108p(R9 ~  1p8S`8  9S(gPX(0S  0X8 0CX8\80\8b$ 0RV K X8  DK]`P p 0KQp$@U0@$@E`P\  v7 S1 0K $0RS1\ t{38\ 1v' R! P:壴i:\;:j9 -8u^p`LpP`Vo`51G0T@ `8 0  8p RhQG8 p` -L@ h p-LP`# @P E0S8;S08P@" phر -X(L@'p8 S`8>00X(.`8>5 . `8XX  P0(0(00 (00\8hk茭:\;:j -0p( @RppTLP`> T3 T 00SX ㇉ p@|PƊU. {000徊0PS S R  'PHRK 00S))))W 0S00p8SX FPPX X 'U[[ U2S  R RR 'p34 P'p3~98d -p8LS`p 0 X000A@P6Up8SSPP [[ |U2S  Q0p8SP 0.RP P PP 0.R 0.R 0.R9 R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQp8S S ` p0  08#Ƞ;8#Ƞ,40`00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@j"9*00 40 ` R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-d8L P@+  0 0S$0 R 0  0S%@0!0 |0SxP@P10|P @0u0S 0 0S0 R>  000P0 p--0P` 0 @ 0 #4L0 % %T\\  0#40 ", 0#80 "$ 0 000p "$ 0-20P0 @P@D@L S0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ Sp`0`  0-0P0@PT@#@L S0 0-0@0@ LPS0 p-8L`#X@P   ;0 B 0P sSp -(Lp"hPP @  K0 B  0`YS  US -(L"HP  0 0 K -(L"HP  0 0 K -LhHPP&$x 0 $L&  p@帀 -LMSPp" +@Kp S0 0  R00CS))))))l))))))))).@K R00P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pad8 R(K00P @`  R00@`  R00 (@"h  R08#h&4  0`@0P`  qR00`P  fR08  #hP00P00P{ SR? S0C0P 0 0R  CRP =R08  #hPw 2R00 (P"hi99:ح: -"0L@M+pK0`P 8R R00  0d0C09 0-00@0PL00C0d0C00 p-@ TL`IPP T000p; h1ph: p-0L` P@P 00 P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L h@ PP&x 0!0 &W(0C0"hpp 8# #80   00b0 0< A 038# #80% 5C40 -0L `KpP( @Q" e0 f0!0C0 03008##80’2 C40  0#40 b -R0 R S * S )SNȠN4 Ƞ,Ƞ0 ;NȠN4 Ƞ,Ƞ0 [ -L[ R`8p p\L@`:Y 0<U $2 PP^L 0 H ;0\ 1 #      pP4 `8P Ud8;8# 40 Z 0 #40N : ;[P[0S@`8%1 -`8 0  00c0 00  T0   50  cd0  p0  08#L 'PP  -LppPM?0Ā` 9QA0+ Q00 0 7@P )~0 S0  00c0 00     0- @=00 8PLpm0  /0 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000[0 S@W003 00c0 0p@  W003 /   O{  -0@L0p0 -P`L:0[2` pRppQ@@\L&# 0< 7R 0  440\ 1 #       IpP pP @00 岀*O &O' "O 㶁V#" 3#4!0 `8-  u[@b p8S0 R5 [0S*`( 0 00`0c0 0;: G `( `(`(j8d -x2夈 PpRL[``pP: `@@\LT 0<P 7PI 0 E 4 40\      `P1 @ 8#  ȕ 3[#4 0s: ;  p8SA 01 RD [0S5`!* 0 0c0 0(0 )`  7(0 7` W` &C 0 R oj -LMQp`x PX P @ @PP`0!P21   M M' Md8  VV?0B 0@005p8S> @0!0 7S㸧@10༧'0 5'$Kp8S  PR 0"A稠p`*pPt0 00d  V 5 @0 @   P bP99$:: -LM@ P 0iSS2 0 S[@Px>0x>! 6K  vM pP|>0|> `8! |2S3"[R>0> TnW b00@(K00St))))08`(I0@0 PH0`U  ```"[  @Px>0x> @0PS00`7 < "!0< S2 08# < 21C0b10"R`08#< 0<<0021  ,2  "[2R P < @ 1 "!p8S})\))))))ptP(pPM 08puP00  L' L0K L`8  1  0@00p8S pT00' L0K  L  L00  L0K  L' L P0@0p+x000%W]0 |>0|> ꈎbP: -PLAAP@`p Ql2 P& 0iSS"`V0 pd8  0S 㲁!1RI1 01ހ07 0m-@p10!RA@@10A!00@  !0@ 0 0@0@5  ᩀ耮: -LMpQ@P T000嗀@UG ڰUJ PU| Ug >P0>U  U 0U("(`P U9 UH( 0`Px> P0x>U `P 0 PPX舄S`PH((8"(#8e`P p8S ("(G`P 5 !h0 0x("("`P 5 !U0 00`P 뤮:Ю:: -LMp8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, d1S* 048#8 (0 >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kki -LMp8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR >0>\1StP>0>80   00C8#8S0 \ 00005 ! ,00 x0:: -L,Mp8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 X1S*80 H P>H0>8@ H P4 H(  04Sa b04S 044.J@"!Bb%= 00.D 00 , D LI8 ,@0P9T@H0T9F E0@$@4`D0@Ap#DPC 4 p0> 048#8 H0 L0 kPa b0cP4epX:d d`0X8 %< % *0PpX`*: 0X&:0SR+@K H jP0S0>xX1S:<Qq L c<04  0Rh0> 1 S p ]O Wx G P' 000p8Sx200Sx2 5 0S00Khj0|2!֙ L00@@p 0Khu<:: -LMhJ p8S, DJ, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: >0>X1S*<9   @B eP0΃! lPKJ< P p@P  @>0>@ `F48#8Z0 P a b0cP4epX:d d`0X: S 0PpX+: `0X&:00S0S^ PP Ro@K &F P0SP  S7 P xأQD R 0S>  Q 1S `@2 pQ  0R  00 0    P^  KHP 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1% t \ş0T 0 PPk y  04S#  | ,P r@K gE IP0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O a1q刁x1PQ E  Px3#  `VX  0R@@"!Bb%= 00 0 0 LI0T)P900T9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 \`)  X)0@ D  P@PU\ `0S90 $("H0D8S021Cqpc%= 00 0 LI0T P9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  X)`~ p\D  P@h 000  L0  pQx200Sx2r0|2li>99<::;9 -LPMtPpPP, `@p00CS, 0R2(K!00 0BτlK,JPp `P>0>00`@ CpQ 0 R 00 0`婡 P5s ἖$0 0&i9<:: -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  >0>(K\1Sa b0cP4epY;:d d`0Y40%0>Ox t0Jo wBZt L00 <xx X1S>:&iA9<::9 -P0o0@0@pL0P 0 0@0@WM iLC0bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' 4'  4 8  cpPh>0h>0S0S1S 0SRpP   0S   f~  z v r n -"0LM'`K0p?0P0@ A A 00 0C 0 "40040 "880 "4<0 !D  yAD9 -"0LM@'pK070P0 `0dA `A00  ZAG9 -"0pLM0 0'PK00`@ \DA @A00 @  1S0000 0A J9 p-@ TL`~PP T0 00p; 1ph2LD: -L` pP @g @|2 0@! @P0  00S00 00$(SS"(08#( 1Sy 0S08#(s "40 0@ C Cq0CB#4Ac B a0b + AP tD!1RG@0!0 1Sq@p10q/00@[0@@2 Bu0S00#$ @ ◻0S  0 48#800 0  DPs d㾛!1R|17@01@08#(ꈎ M-LM0, 8 #X40 0@ P( Z c @ {;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ؒ0 F $Kd: -LM` pPL Pc _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!⌒ \00P 0#40  002<8#(#< $K0:: -L M0 0S` 02="!Bbo0% Sp 0 00  0 8P,  ,0Pc V?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "40 02N=8Q#(@08#(#0:: -LMP pP> `c _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kin!` @004 Kj@40<:: -LM0 0S` 0pu0S^ S0 0S0    P l Pc y1BS br8>V?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D  < 00cS3 (0e)$ 0 0%  ?(Ko"!B10b%= 0!ѐ0 0;@ 0@s(K( x "4F0E0 4D0 "88C0 "4@ 08 0"f0 0C(8 0"2 * )>*؎)Q`8`888`8`82 S-L - `86t `800Q> L@  Q P0 R d8  `87`8`87`8p8Sd83j 0-=LS  21C! c%-  @PPd8P]  =S  21C! c%-  PPP]0p8S S S g0Sgg0S - L@ R' '  770C0C77 10P RZ 10P  R(  (  H8H80C0CH8H8 RZ -LM8  8s8p 4 8 ? 00 [`p, ZVr Vo P\X00@  X0T @ V 80( 0, 0T , F \X 0P;  0T5 \08 p8S= 00 S0 0F0Z[0[`٥ Y00[` 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\@ 5S40040 0 p- Q` `VLP0 0C0^S@0 0C0^S@Tt剿T`PP\䁿UDph|V 8xV@@$qTp@:;į:"; -LMtX`U@pt夈 TC@*\@*<@*@*?*U U:([0Rh5+ p(5R'E@Ѝ 00|=:;8p0\@GPUP5@0 <*`844% 50`8 080ESA*A*LC*A*0ESxB* C* C*hB*`80`8 !: ':p᥯ [: >  UC*TC*B*B*B*U U 0w! p8S S w S SmP# a@P 00 0@Pop8S 0 8 R' '  770C0C77U 10P RZ 10P+  R(  (  H8H80C0CH8H89W^ Wf00 0]5[!oP808M RZ0 0<W:00 01p8u`8, 00@ $p8S@|1Q Yⶔy000 p8m000 0t8'⟌0 m@# PiP > R >C0 0Anp8000 p888ƾ: :0:;H:L:h:p:x::8dȯ::9 -LMpX ȠU@p.h, :U t8VS/ t>0t>t8VS`8(Z4 5D8S808H>0H>t8VS8S< 000 508  Ȑ000(|8`]/  !ȗ \000b 00tZ P[pP  ''80 0  8p p hpPD:::ܰ: -LM@480 0PpX 2S  21C0d1 0"i褓2S  cR@eV@d5S @d5@P0e T0@e@d[0d5 -LMP@`kV>4 @c4p  ' 0h)mꫪ -LMP@`k 0pS0C 0 S hm*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2X|0/:0O00 `ᘓp  85I* 0-LMT0@+;:0 ="  7P 8hX p-@LPgk2`0S2,0,  * phl -=pS  21CA@c% PL` Li8 T)P ұN @X d8  =S  21CA@c% PP LY8N @0P T9X0   hxL* 0-LPk@Cl0h p-8LS@` p0S8P000P 000p 000px -LMt8@S`8 p8S `P XU0S 2P 㝱pP 0 p JC7R ?7 0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 0- @0 0000 PL 0PPT L5H0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HPnP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PKS*9 -L M0@ (KJ 0 @PKS*9D  tQ 0 S"0!B 9-<JQ !0 S090@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00<9GD  tQ 0 S"0!B 90- P0 K꘵: p-`PL @HBTP4<@T(ph7 5Pph0̵:X#;n:l;ĵ: -@PL D$8 ,$0 hе:ܵ::: -L Mp`L@0\48 0`P 0<<Q 0l@d@X߹DdH DٹHK,ҹ:$:\:d:l:t:::::: -L㠘@0役T   X峹:T*ض: -LM0,0 uP2 p0@ 00@:K =2K00<0<Po:004K P  0 < K;0K1<1< K 0, 0R(K壒i8d9 -LM @ , D 'P5 p 81@(0@:K 0P2K`00 4K P`  @ D 0 < K;0K1<1< K 0, 0R(K Qi8d9 -@< ?L0 <0 g* -LRHM `p00 p@ΚPP 408 0B S800 RH TKQ `@KDM 0\0 0 X 0T r `e p-PL 0`P t0@T@T 81S1 00  Pppp|8d 0-LHM@T# 80S0Q 0S XPKD 0T0  L <0r S80ěK0   40040": -p!LP`[ 8QE H@T UTM \ 0Rq Ÿ0Rm5BbcPNʠ2 R? BPG Q 0 SA 00C00Sp0 pp0004 ^00 000  00 81@PP_" 㕸 } 00C0 P000x\Q 40040 R 0Q0S R 0R0 \00S0040 040\00\0 0P0  00C0? P000@0  ?D!( -El,d}i(<,:8d000 0S04S @@21 @U +U((0 0 R 0YuhQ  Q 0S 0000S6 :S00(0 0 R 0YrhQ  0S 0R QW zWw 000 R02& 00-0 R<~igfffTi8~i 0-PL@Q 0 R0S Q 8BPP  0 0 000S  0e p-PLA`0 4S`  0 0S 5@ 0 0phuap  @@2 0 @8~i0S S  P0 0 BQ0S 0`000 RP0S1 Q -L$Mp0@ 0 _0`0CS0 a 0RK R000  PU 0, /0K$@ K6gOi2i 9 -L$M0p,0 P_ȡP0P 0Sh@T @T 0S000`> 6 jO`PK 0 0@Q60Q3 0S 0h 0 0R h 00h`0 \< K;K80  L K P  @R000 m6N`, 0R (K6N`@噉|`@iTi1i 9 -L@L0Q 0Q 08!P,0( 0STi -0PLC 5p<0\`L0`@T- 80@T( 5<0\L81 S^V0W  ە0 00%  ЕP 000W  ĕ000Ti 0-<0\PL  0@LP 080P 81^5 L0R0 0\<00 R U 0P ㌕P0000Ti -LMP , @p^TS 8@<`K1S  PPG _,0S 0,0 0 Sd14,0,0,0\0 0(0XJl0$05 ,4$R( 000L0L05PS*U , 0R,(KP I0S !rq h_HT5PSl0S(0@K@0 [lki i 9 0-@LPT00!R00P    a? 40 ^E 0PS5岐0S P 0 l Y0801 0 4)4 S*KPq1S@40 |P @0 00 080ᾓ9(K04  00#0l0H  dKP@xBϠt, u`PUPE.10C8#8S1}, Sz: 0AhP04$484# 80.P P0S P10  t1t!08#8,0 ,!XJ,@^9PUPE108#8X1,, R): 0AP04$484# 80Pm@ 0RPO @0!QJ 0a긁긁(KoQ000 @Xk fTi`i<d>de -LLM `XPP$K40ppWPl@KDh 08 (0Kd < `媆P(LL\(P<0 0P QPM P ?dȭ* -0LP 0d>d>d -QL MP@`pP $KQ0S S *P% 9S` ``g븀PP# `Vᎈ`0SP| [O@fPЁ0 4pgPPKd>d>dih>d -LMKpp  0C`$#Bb20aD c @ Cn<(4"4 KE.Mb -LM0@ p !P@`04!48#8b[ 0@@K -L(M0p,0 PP  FP   0S A<, 0R(KU` <p 10CH0 S0 0QP QL P- P L0`S " HPS PdU`0S S@ U@UT# DSS    ' H04"40`8#8 $ #$ ! 0`0 0`0H LL1P <R1P0PQ 0 0 Q L1PU0PU 0(8A圀T<Q} 0% L0S SsDK]0 ;0K< K 0( <K80 布PD  T00T0XAOP  0 0bL0 0@L0P@D @P80S0C80<@Ể<< ziTi\i\9 -PUX#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S |"000  P 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑa(0 (0 0b0(U]! 0U0 0P0 U00 UX5 00 01D 0NS<: 0 0N 000Q 000A ("(04"400  0>0>00>0o0S 0("(04"40 ;!YE儡 傡i:: -LM@P  $P h 0-PL@,P9 04$48# X04"48# Q\00AQ\<0 h0 0QST JQ :<0h QX0Q:SX0h腁0T0T0>dj9 --LM` 0(0 @04"48#XdUx%000$K 0$U$Q  0pP %000`P$0000(SEԤ1 0  @AQ9ܿ***l*l*l*l*l****l*l*l*x*T@uʲ1#U0 0UR 0Sd 0)S   21C0#10\ 0(  3 R UU0s S#0# 00Q xdcP 00\  0S 05 LP0  010000K 0 0 0PZ0V2 R1 | 000T@Ӊڰ0002 R |2 R1 Up000T@p1_42 R& (2 R" T#U  10UR  00 ,0K, 0(0e,P 1 Ra\KcT񟗮@*@*@*@*8*@*0*(*(*0*(*0*(*(*(*(* @&@$@"@ 1 (0,P00000b2/,\00> SCU00Ua`P000  001 L0 08i>diHd>dT>dX>d`>d>d>dd>d>d8* p- LM@T`@PK0`0P@ 0T PPd@PKs![0(( b!("( 0P0 xee>d -L0MȡP@( ` p;l0- @TT P<  0Pl0l0`@  LK# 0L ( 0RB$K0 Pl0l0`0 Pl0l0`T@Kk 0tP`HpK ټ0 H0KG K 0 KAKBKCK]HpK ļ0 H0KG Kwi9 -L MQ` 0SP  K ŸA0`>aP 0BS X*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*x****\*l*(*(*t* * *-P$R 0 P`bPUP 1 RLP  0P Kia d 0TA 0 @%b`PV8 ,A0S 12 q 0 pb쀟P0S L@|M  0U  0P Ki5a x 0 KiaHp0Sa mL@`MWi$?d ii@i ?d?d?di\i?d -LM1 l, @P.P #(00(0, 0R(K0Sxs(`V  0R 80S0C80Dß00 0 00$0 Ly#`V KK㶻d?d9 p-` 0@01PC e BL 0!0e 000e00 000p p-PL+U` @ κ0E #10`pg?d -@LP``P @ 0 0pD 00 PL@⣺0U: 0U0 *00?dg -@`LPpP 0S 80S0C80H0 0 ,`0}P @|\iTi -LMtp00@K`P 0 \0 00K/ K,` bP 0RK<0V ui9 -LMq00@KP` 0 7(0 00K/ K,P bP <0U h1 R 0R V1<1 0% 0RCK1  0S' 0S( <#<U0Q 0Q 0P8!(0R< 0S 0S <#<U4U8#8U4U8#8U ti?dTi9 -L(ML 0 01CX@ (@PT0D0 " Tp XpW00W0SDTR 1T gXP@TD0S 3 R(KW @R0W`B: ㆹ딓L  (aP < {000T TH3 R ` VH 3  L0(aP 0WF* ~ W@j<K O:[P; [R 0S(9 ["200 "S9 K .` 6TY L (PP 00 <(H0  000S0D0 w,`K@ 90[0S SM S" 90K@j L 0!P00P0i:0[; [0Sh@ L0 ^PL < :0[0:0K:[0 A0K :0[0:0K9T6@L  ("aPL0 (4bL3@j 0@j :0[; [0Sl 㺸L `(1aP :0[0:0KL0(P*@@j @j >d?d?d?d\i - @LTp l` P R0P00@ [0U0C0 $R000 hL ?dlii -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\$i?d ?d\i 0-0PLP @000P0$i\i 0-LH0PPT 0@0C0S0\ 00 0T@@P 80S0C80000hIz$i\iTi - 0p 01 cQL * 0  0Q  0q03R0S %000h尐d%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q Pb R0<00 ",#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S d 0-PLXE 1@hT0 R*0hF\  @00C@0F @00C@0Fi p-P MLDŸD 0 P,Ÿ, 0 P Pz AnA#!B30b0020aA   R1P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:1 1R!D,@p"("(0P210: P   Kphߴp02wh0`{(:li0:iHd ?dTii$i`~i9K9o@:iD:@iiP:?d?d8: 0-LM4P [[@[0[ P@-K0gX: p-LMP0  A0d `C PK  0S S S Kp !K 0S08# 0S  0K08# 0S0![ 0-2LP Q 0 H0S 2020 Q 02020 00   !@0 4,48#8b2<20H0S 2020 -0L`pH PP @00 0hgʚ; 0-PPL 0S@ 00@S 5x350ht30 p-PL`@ U  U# U -p0V 0p0V 0 Q p0 R0 R 0Q<00p V0p00p0Ti -0p01`CVL!PQ`dVPQ Q@0 0S@@0  `d0VpPh 00 -L$M(`V, P@p 0ES*L*H*t**-@0S , 0R(KT 0S @0S 4R 525200T 0S @00T 0S00S0SD0  0; K<0K0 <K80 uPD  ,@ D0 0 l00@0PP 0S0 S Z@ @P @-@" --L M0(0 P l0p`@ +00S** 㽼@P7& q0y0 ` x("(04"408 P 0(0H 0P PAQ($KQṹ`0P 0S 04"48#8QS0S , "\00\0"04 40\i - QL`P0@+ 0t03Q0S pXQil+ + ++++ +`++ + ++8++++++0c [T{ mp i 0`S1 R 0SN 1p-p 0S1 R 0S/p0p(0,pTU0 p V+p:81@4 SpPpP9 ;Vpp=0 V8p( ip9p|0 Pp8sV 0 xP P 0|;0y`[ |8d0@d4@d(i|:p:d:(i --LMLr, P 82U r PUF @0 l0li@(iTy R 0S8 RR( R 0RZ#  !0e@P l 10S@0  ,K 0F@< ,07PF,P|0,0 PUZ$ l 00S@0   ,K 0#@ ,0P \,P X@n(K0R 0S 0 @004  B4 0 ;@Q(i @dʚ;\i -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/|Q Q V# 01V 4 #tf٨4<ը (ѨjDi@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20@jBN|1S(  S < t0b? S Q Q c|0@ P1Ph0P |20Sh P(0h S1*(0P!\@d -L,MY0@S5 S Q/ B/(K(0 40 H <0 <0*0S`` P PP.upP7 PDP D T08 # R; ㏷1 7 (4 H < 0 0 (0 'Y0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S <# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800bEY 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q<F@0 H  0x `@  5@ |0@ 005(P0<@@0 `= >0?@0 , 80 =^400q  x0 0 Y Y 40 c("(04"40'Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 < 0S;0H Pri p@d?d ?d -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 㕦<( 4"4!<0 ㉦ <(4"4!<0 0 6S-t02 @0, K`P 0 0R r3 (K 0aS0BD 0a0bS`3 P @l0l <0 l0w0w000030S S,0S H 000 0㴱PP 0 0 兡P Po ᚰD@D0t t 0S "2S1 `0 R!t0:t0=t0Px T0lrX1P dRT!00 00100682 4!0 "?08=Y000m:Sm: S7 100! 00&?0YD R1 0cS!`S? 0@L1PAWC.P % 0(@0 @4 Y <0@_P |!080!P00B2H Dl0 UPN 7q ѯ<@jp@d<@d A-L@J 0\:@T 0c 0bS R@TL߂0D L1M0L1  l B◠ 00C 0萺: -6| 8SLP@p@T  0S  /0 ( 倯FyV%  0@S1 `0V 00000 U |P l0  HP t04t0it04t0j -LM`0 yP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@ xM000e0     0/8 4 0 W  1QS P R0000 0$ xUp 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000嘮 0a1 勬0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s b R0000 0  0R j@j --LMx  0 , p0 x K 1 0#2S S  1, 0R(K 0R p /:Wd 0@`jTh`  TPP P 1 " Z@@T T( h0"=@T000L 0S ( P   t0KP/ t 0R:0p  R 0S0s 0S0S 0s R  0S0S0S 0S 00 000 "101 0h#21S  S R0 000pP`eUh` P<` ,  H $0$$@X%4P,̂&.,%    R R > 0P0"!U00: UD 101x;x tPPc ` Mh`h``h` 0   (0 r!0 00! 0O0@0@e-h``e h` 0S T10cS`!0bS8ڈP  `1R 0R 0R6 S&02 ' = #P 00 0s R |0@  @|1S_ SP9A h@@ 0R0%p :W PPE UP  @@ / 0S PP * 9R  $    <(4"4!< 0  <4("4!<|0 00 0 0PU' R 0S:DQ * \   P1 0#0  @@@ 040\41ʴ0S 0K0( 0 PoP |Q @WX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \} Q 0T!R 00bSt0c^0ڼP !R 0B" “ N1ǁ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1DZǡ0h` h`6VSʨ@ 00c0a0PU0U00D0O0@0@ RP 0R P UὫt0 0t0 P  00cSP10cSL U =? @ 0(prPHKd`K⁜~\ \ 1P0P 1$ h0@s,$0 ?0 8]T70S @0PP0S*Q  T10bS00dSڨ@1990l0 lK  Q101P 00cS10cSV  t0K/Pj t@ 0R0%p G*|K~0 @Pt0PP th0O0@0@ t0;0@ @KGKH@K0d@K@\K 4Kc@KK0 P  P ( ̛ Xț 0/  RC02,A@T9 P 1@TB 0RI #3Rʴ@PHKK 0 @Ppn0H0KGK D d0KKcK0`0 &K  `0A@ji@@djD@d 9:jPPLdj3djH@djL@d8@dБjjH?jp@d<h@dP T!00bS0 @PR00U0S$ Q0SP `10cS 0\1Հ T!h`V$P 00cS0nS 1S:6S P (PwPU tPQ U 00lS0R00[(@6S7 1Ũt0 U@At@ 0 0bS000~"04"? 08R@t0`0`SS1R!P1Q!681S 1'0 1h0@S4@0L0  ZB  P 6 Sʤ@,#00S]PQh` VgPdᝩPZ 8C(RT R ʤ~t 000t8C80CSBO+PN+O+PN+PN+N+,N+T 0bS R 0bSQ0Qh0S 0 0R@P0U000H0^0 Hጅ t0Ńt4P3C+R0 |1S S  @hA 45@5t 0S t@ PVzL5P3CR 06 0 ( 0+ v 0 006 LP -0 00cS@h` h`@6S  " S ʨ0lS{ڨ|&6S$! 1S !10cS000`l/0 P  |0S)08\ @ <10cS$l 1S 40\'@0?0}Q A$1Tg'P1#0Q  !S |P l0  HP  x@ V(0b@? 0t 0p!0bStŨh1Vha 0 0bS 60CS񟗁^+]+`M+TL+]+68C( R0@S0S $h0K @t0tD d @0CHK 0hHK 0PP { p 0DPu | &*@t0t00006@Cb  a f00 cR 0LJTT10P\1000d 06*@0*?08Pt0`0`SS1R!P1Q!P1 00C0[\!00bSTŁh/0  0@hA |;\c@ddᄥ _@P`@Ph`  P  )P 0@ 0S0 S@ FP101ch`V  0R H1 0c0cS000S 00cS 00C0b0SH00@00卯L10L1h`8#P 0 0 Xh`~4 cALP 0R^  P0n aS0V0000 @@h0|OP0@U0@| |P l0  HP  vt(> R  X: 17 0S4 51 t@0 @0S |0S P,!S0b.S:h (10(1 ତ =@t0ătt ?0Sto lRntP? R  X] 1Z 0SW 5T th0P@@h|/0 U @ | |P l0  HP  v0  `t0ătr t0t t0ătd0tt Q f @0fP 0S|5t O0@,#sw ,A(Af0 0R0 |0S}8\   <10cStl( 0Pc/00 S |P l0  HP  u@▷t 0p!0bStŨh1UhQϥ0 1R& P40h#0?0NF ? 0  t0ătǯt0t0S t0q@tN2t NŸc ᆣ&h"c RNt0Ńt 0S9 @T*Pf 2P3CQNT P  1P3CANI T 0  @t!t0 ?0 P,N0 @F 0<00 f  @!608#868C8S ڨ  1'0 1o#P0 GP!P$1PM8a0'0 !<\0 0@\0`@<J$!0, 0cS Pꠣjp@d p aX pʃd XXp I r0 S X Ro0!0bS>0ODH0@)H0L@DpP IX00S; 1  0X0 0X0X0x ῢ 00 0x 0S0 (p% (t00t0ᱣpP HX00S 0X0 0X 0P0Px0S Bx0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0O 0`#P7P` 1Q!0\ ap7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ' 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S Z|< U|1S' |8 M|( HK0 :0X! 0RKphXPT -00|, %| }Lljijj0j9 p-LD@P`P00T00S 40php -D@LPpT Pg 40 T0 00h0W0ktP 7S -L0Mp0<`K@ 0 `4KP$i?d*@p+jw+ ?dD9jp+ -L$M @RP` (K0S0SK UU 0ES៕MU UH 1 R VB 0S pa  0R:` 4 0 ,dp+jx9 p-|0L@P@`ªP 0`V GPDtph蘪T0 Q`(!10bQ 0 0`V`!p@d@d3d 0-|0L@@P吪P l0GD F0S 0hg40 \! 0 `\!0@d3d -LM⠢pW`, P P0SR@ Q㖟K"! * @P 0S:QR K /#@PW2[S S' @, 0RY(K gW2[\ SD S KP <KL0KW X DP @0 5 <K 0)P  VKLK0)@P @\~X# @ 0  0X0 T0 \r/ N@1T0 @ 1X0  KPP T1rD| W[0Q00 Q 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P l0@<4,80W0P00z @xPIUo>l(0S@P8 PҽPTၾPO 0mql0 (0(0  w x =,Ad0Adj:9Ld?d -QLM 0S K0S0S P0@ SAP T \  0 0HP$0P @0S   0?d*jԩ+ -LlM( @Qp,  PU , 0R(K`VP0@Sp jPf P 2 R X 0| S 0x0 t { H0KHK0 GPKH`K@K | | 0 0HK#P2p0 Zh |x 0R:l@K̓d`K0 |x@\PKƒ0 c0KdK| O L 0#PWI [&[tHKp0@p f(p HKH K@0K0  @KHK0#P| t o @KHK0t#P a;>HK@ Kp  pp tHKp \0Pp )I[@K&[0(kP/i*Mdԩ+j949 -@0@L@n@hi --L⨪tM00p0 ` 0, l0 h 0@#2S S5 6hP3@, 0R(K0 G0K 0 S *:X] 0S000 0V $#$("(8#X 0 dR' U00U0S 0000` G0K 0 S` * p0KP- p 0R0% * ebߏK0^0 0S 0S0s 0S Q  0 0R 0 000" "(00(0G[Yp YPH@Kែ0HPKGK d@KKU"ᒂdPKcK0 6KI"\ 0S V 0S ( 嬷P\  |0}PU| 0S0h0 l H70S@0   h K$?V l 70S@0   hK 0\ l0  h0Sh@K @0S@ )0ȢV l0  h0Sh@K @0S! 0㵢&@HK h0ڥP% 00 00SN 0sK   (0 0(0 0S R00d00dSP'U$ꀕP U l0  B@(BT P Ur @0 Ql0 #0R R ,0S00S40S80S0S 0S$0S(0S^? $0㇓@P8 Q 0l P40S@0   h Ke>V 4l 0S@0   hK 0S华 @h0HK@PሐhPㅐ 00 00h0 @0 P P 0S^ \ L3l 0S@0   h K$>V 3l 0S@0    hK0L HK@h0 P$ 0@_;@HK1H@KGKdKK 0D0 (d@KcKK0`0 V$  0Z0Sl 0000, P(H000 P#0RD0S  0@> $00"!Q$008 @p_PUq000! 000^+ 0 9(@  0@婷PO8 R 0R( R 0R @ә6( TPK00  0 0Rnԣji:jʚ;9 -LA0QLAdj-Q@P P*R 000P% 05&$jPAd -LMP)0Kp @៎)0[ !#R)K R V (0/0(0(K%aVT 5,  , D001S %1S T5,  , 40701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ῑP @ @ 0 000 ("(04"4#0庐(1 0 ! V04 40)[Z Z Îx#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0{B 0v)@[T T` ᆎ"(0/0(0/ 00S St) +0Kⲍ@0+ K*K*0K  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(a00,<$"*)0+ K00(0C@   00KI00,<$"*)0+ K 0嶐0+ K*K*0Kc *0[0 +0K2 0 , 04"48#89C40$j?d -LMl4 8  +0K`+ ["2S S (00(0ƍ(K( 0P "2S S ` 0P|`P + ["2S0 4* K埋0S000坍 04 8<,<$"*4* K冋0SY )Y( 0S:Y )Y p 0S 553 R1 (>30 PU)PU& 810 R@T@T W 0S 0R Z 0S *~P$00$0?w040`O0@Y0@ )YuPB8 R DP  0u@ D0pR@ 1 00Sa@`10`@  @ 842@P `0Su i4 t 04 8<̠<Č,ʠ*K) K)K' P>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K P  )0[R 0 0Q3w`P)000 00 0塌ᱣPt@gH00H0同 00 0%000 @@$j:PAd|8dSk{i{ii -\0LP1  0 ($ 00 0a PAd$j --\0LM R1   00 0 d K 00 0?PAd$jG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [E9A9 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(KA9)99!9%9G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Konu@, iu G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q Xt, 0R(K/iTAdE9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hK```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao}@ y @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ l, 0R(K'iAdE9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 l1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  goyf@@pb sf y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1Pe( 0R$K i4:F9F9G-}1Ab_`>q弁^fAa0@408@f^P`P`,P0`- $( p!j?p(P`Pb?`0  . 818<4!,00 @$! p$(P,`0Q004@ݍ`F9 -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P !b@1@ T@D 9 `phP b@1 0S@DRH0 0@H0L@Pa@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP a@1@ @D  pj?X@<@H@ ?X@D @pXP a@1@ @D Pa@1@ @D 0-PPL 0@ waPqa@0@0D@H0L@0 F9 -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~`<H00@<@P`P`(KoPPp``<@pPP`0P0< `PP` -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko` -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Ko_ 0-PPL 0@ A`P;`@0@0D@H0L@0H9 -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8_@00@0c8( 4<"$$ (  Qof_P@8_0P0P@8`_P@@`_ 0-PPL ( _P@_@0@0D@0 J9G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L $@J9H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `n9j9r9v9G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @Pv9n9j9r9 - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0L,(8( 0X0PP(($.8  .%<!...Gg0.,A.40 %.( %4,G0!,,, ,4l0a,( !q, %8!HgA0!!!!0$P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vd[,Z,Z,Z,xY,Z,Z,Z,xY,Z,Z,Z,[,840P(\F($ 8 P, 0 l% (Ƞ $6$& *|aq !40` 0`0 5ap %D q%ȠPQ` P U*d*  0儀 P0!P "0%P@ pUqhE`QX APe " ` !0# ! "0#  ` Xw],\,\,\,H],\,\,\,],\,\,\,`\,0,4t(,X*̠*(48t ğ0 (4P !Q*D40d t@x lP !Pq#@4(h8@`| ,p q`Q8` hP 40&\l`p  "#`d0ß!$D0&x`@ q aQhp@0#| ! " ! "T[3|#LX[ Q!M[al#d3A0  0# "! 0  \\ 0  0 0  \ ^\ 8K VXKVHKV(KL2"!M[X[T[aQ|2|" AHD\2T"! @aA<2<",Ƞ9P[ 0 0# "!@9[HD1!!aQ1! ,Ġ A 0  0# "! 0  SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L O^9Z9b9f9G-M 0dğ 0@R$2.  B$,,$ ,8 1, ..4 4<.ğ0#. 0#,? H0죟  ܣ))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7   X) "0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  H X)t3333UUUUz9 -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R? H0|t l))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  X)00 0 Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7 H X)z90 QȊ9 0-<@LP [SP@ 0T00Ad\Bd -2LM @Rp`0  @P0ČȌ̌!2,2! ) !0 #,# ,!T"0  ! ""4!4<$"00#"0#  ,8#0 , ,!0)!S0 -ቝ4 4 40( ር)# 38 0(ˠ <0 80S)v0 p, @^ 0 (KT 0SQ0PM AdUUUU9Ȃ9Ȋ97 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P pphBd`BdlBd\Bd -00ML@ d0 @ Kĥj -LM,00,0 < K <0  P ĥj -L M T> P0@L 0D<@,0 ,80@,KX:ĥj`:Tjh: j -PPLD d0SA 1p\ a 10 ^ 0S 010  \00 P à L ` 0 0@0@ Pe`Bd\BdlBd -H0LM0S  0 Kĥjp, -@QL^ ppW`%P0S! ~32C0f0 !   \P0@0଀ 0 000ഠ  @`Bd\Bd -0`QL\PPU@pp0S E32C0d0 !   \ 0  ฀y`Bd\Bd -LM⸡00 SP@ 1p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX 'p(KV ^32C0d(K @ pP ,P0@`@00 000 \Bd`Bd p-@LP0` RpQ 0ES32C0dA1 R U 00  Q 0 S Q pPPU( 00  P`Bd\Bd 0-@PL f8PQ 40,80(8Q(0h0 jTj -LpL)`P DOW PO80U408@ P)@PP8w p lTj j -0Lq0SI RXڌPPU 0S00S  0 0ਐ?)U=32Cel `P4 0@#"B c!O0@czO10 㨐  l `0 /l0X0P 0AcYOP P P`Bd\Bd -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S N\Bd`Bd -LMpP_ <0S\ f8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 $K32C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 JQ8\Bd`Bd 0-LMP0| 0@Q *#d0"B a! 000'@0P  (0 QK0_`Bd\Bdĥjz,-0PdBdP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL(<PL$L!0 0-$@PLP R0000 0 PL$0 -L M4 0 , L *PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL 0@00 ,pK K场0P,JU0  000\ $@  (00(0  00CS 0ͳLdcpBd -LM 0S0,0 0Sꄁ,4,h,$,,QR 0,0 ,QRL h00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L r$ Uء .|P, P0S@pP,  X 0@0$0@S (L$LTL,QR QR 0 OP, 0S,0 A0T1 (0P` 0SP`0@0! W|P, 0,0 ,t: -La -8 4(0L0(#Q S0,0hx -LMpH4Q P, 0S Q vPm` L3#@0CX@@ 0C@L 00@(0 3PR{P 0,0 N RZ 8Q4H3  f{P, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ *{P,   ,2 P (, , ,0,0 0S 80 L 0, 0 00S Z D0@0 0!,00S *32C0bt!10 @ 0S P,  (@0,0;3,0@0!*, ,0 k,0S00S,0 ( R, Q 0 8{P, Q 0@ .{, 0 S Y 00 0 00 0ct \ h X ,`Bd\Bdt:x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^ @P 6P  *0St,l,d,\,T,H,H,H,H,H,H,L,D,H,H,H,<,H,H,H,H,4,d,b0StPK$P@K"K$KVJ  0t0 p 0R0R+*hP p0QJhLDP L0QJDL LaHaDa@a 0BS>,,, ,,,,,,,,,|,8,$,,,ؘ,И,,,,X,,,,,,u R0 ! P0pP @T3 `l PP7tl 0P  0R !("( 0p P @T\tXtTtPtLtl \P0S l S0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("(P 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("( 0S 01S 0\0#0 R0 P0pP 1,rs(rq$r 20P &r rfrrr 10P ql 0P 0pP qqql P0S l0P 0S 0 S01 0 R0 ! >G0 0R !("(  0$0pP ppp0 00X0 S077P0BdBdpCddEd@L@l^00 -A@L@lQ00 -z@L@lD00 -@L@l700 -$@L@l*00H -@L@l00 -@L@l00 R@R-L`p l >0Q @z p-L`@Pl z!Ppp -LM 0pP@$0 4`K3 0#0P\)  u0#0#0QA#0P0 Q3@R 3x 0#3@$ 0R K ?i9   0-LMP Kn@ !4<"D\0 @  Z@=z "K0 -@L O@I@00 -@L A@h:@ R-L@p`l Ar! BPP @ !@ p-LM`0P0 000S0A Q B,@K 00 0#0Q? 0RKpi9 p-L@P`l ( p E p-L@`Pl X%(dpH  0- LP@ lWP QPKP00 0- LP@l޿6P00 -@ML0,K - ML̀@0@K 0 0 -LMhK@P@Kp\? 0  0S2"Wh@ @0 < 8 dP @l ㎿P A "0@ xŸX  @ P TP [P.@K`QJP(d0ST0T0SEVSl `bP @ 0X 0 PTP W UAl LP 0 S  @l 0 @SWGR(KVH(1!@0 X T@ @ HP0l 0 P W- ;H0S$ `pK0@ >000lо`e0 pS 0PU :@>000l㻾`Q+2+2XFd$:TFd -pLP 0   R`@0 0` 00b@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000(9 -(0 $ , 08 40< 00= -@Lz =02 -LMT4PK0` p$0 = `4[  Z 0R300%0[0%0K–\@ 4[  X 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 z<$ 0R2 K1 0#P1  0R300%0[x 000#%0K  0R300%0[x 000#%0Ki09 -pLP`@~Vz_1 0#P1`F V@  b0`R1!~ ڙ20VS  21!0#P1z_ `h@ -LDM⬀0dPK`$0 p@<!<@0\0#0@@T e%<$ 0R KQi@9 -LDM܀0@R@$0 P`(p C 01dPK@q<!p<@060#0@@T ;$ 0R KpV<AiT9 -LDM⬀0dPK`$0 p@?<\ ><@0\0#0@@T(  ;$ 0R Kih9 -LDM܀0@R@$0 P`(\p s00dPK@; ;@060#0@@T Yy;$ 0R K\p;@ix9 -LDM⬀0dPK`$0 pr@;X ;@0\0#0@@T  W@;$ 0R Kli9 -LDM܀0@R@$0 P`(kXp 400dPK@; ;@060#0@@TP ;$ 0R KXpp;@,i9G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!$7PL0` p2RLH `08?>   c 02L!0 7PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U hFd 99h::,:L: -L\MH< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_ 8 4 @ 8@`4!4P a, QU.QU10pP1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP ϓ4 Q 8 <( @@8`04Q SPQ C` 0;<0 \3R 2<0@, 0PD0 Z= 0qd ` @娀ȟ 0i`@PdK ? |0 | <,,l0 h@  @ 0h@ @ ` 0 F.lKPE ȟ0),@@ ?D 00C0<0, 2R0S@3CL# 20C 2 0l,dU Ծ::: -LHM\ 0pSPo0@0T8Z0LOPo P` 0OVʶ <4 S?|0 @ \00 P4 7HP 8P 0O0@ ?ᯑ00` Sp 8'08S8@``00`Q8 ςX  !D 08P 00`4PR@0 0  R,6^88@`0?0 0,p0P@`W 800@$ b $ 4 D0@4 DL# 00 08P5DQ8p`0/ 80 0cQ@< P0 n`08X3%@_Q8`0  0P"004(KoeUF\ 080w \@ 00şp 0b(K8 8$ 8@`$80@_ P LÙ n 88P   ? 0@3CL# 000\@4Q d0@S8p4 R 280PuW@`00P 0008l3 R8TT0 !000t84S`06C cB SWAQWS 3 P88`0 0P 82 R8`0  0d 08 80   ? 0@3C0@L" 000\T2Q1 d0@_X@ TP S c6Q SPQCX K 8p1 RZ 20, 0PP0 Z5X K .d ` 娀 ?L H0 &0PO`sdK&,L K lp h h ˏL K ` F.lKP  `0', @?᳏P00080 ,R8TT0!000\ 0 mP8X 0  P , Pu8X 0 \ 0,m(Ql,dU :H:`::x:T:ܿ:: -L M 4 4L0 @PP(K  4 P, H 0S 02/ E`00a0 S0"Q^Q\0/ A 1P  <2PR\0/ 1P@| 2 ^\0`ϊ1Po pR 0@ QR` ?Ep1p^\0/ 1> R,01^\0?0  0<0  B ; 0@4D0L#00 Q 00C0 ,c04 ba^1>0p   ?> 0@3CL#000040 0tl,dU :<::: -L$M@ D DPAP(K@D  P, H P0 $h0U 0 S 0S P@Q0N 0R P3,9a02SQ0 @_ 0 <@ 8P ED @_P 80 UAO>@P `L H  Q Pp 0PS04@T  @ p  pW00 P0O0@ `0D eZp 0@_@, 0T PQ800cO  vU80pZ,b %l,d`: -L0M L `LLH PPT P0 00S  L 1PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D|@ < 8 Z?᧍ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S` 0@ <0 T Z p T K pXQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADa@@ 0 0 R#A4_ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004`0@ d! 400C4000 c! 400C40l,dU -LM ,  @_ 0ᜋ8  0薋4  ?n40 0ኋ`, p  @ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004P`1`#Z ,V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`{~j,@WT, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP040 00 `@4pP @ 05 p(K ZO ,0P>* 00 ,0  Z= H#0S0C0h0 K P 4 L0 pP+0匀0Q5h@T'dp@l0S 0l0@l0Sjl@l00S0l0 00 ,0 H#0S00  z_0 DP 0hp0 0$ ,g9:x::,::: -LM $5S. @pd`  02 f V@ SQS K @0@ P   10Pp7 K X\\Ӊ\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00(00 0K80`S 2 K Ze㼠 )Ÿ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,?^ P0S[ 07^Z&`pQ d0 c> @SPQP#00d0  c6 0SQd " 80O`p X_000K n :aP' 0 S@P0(0SK ,[H K@00,K"aP,0 H0@_0 ^,^0[0^00H00 f4@000Q 0H,\Fd0 R`Fd M-L4M00P L S@0,0 00 S `3Qt 0a0S QARQ< D?@Ě@c.d 0Pഈ0@0S@TmP0! ( ?Q< 80 . \ 00,KPK`P@ p,P q[0,0 0C@(K,0 < 0  cDpǏT  0H@  P@  <K?o< K @ D@ @P:  0HRh h  d0,s c4rc SqQP   0SpPPP@  8ß@ ,0 l  @ <4 Sʕ   Rm<@D4@D_@Ě0e.d  40PS 00ŸD :Q4 0 w<K 0 K0Urʜ0H@h  h Q d004@# c4! 0S#Q, 4 d0T30, 0<0,00<00,  @Hh),00Q: @4 K 50St<,T00<00, H N),00Q0R 0 { <@TD4_@0e,  4S P004SP84@ShdH4 RET@0c\D4K_ 8@0 <0@] 8A 4S_:\d:4g9:x::,:::H: M-LM@  0 00SN `0S `3Q 0a0S QARQ< D?@Ěc.d t@0d P/0@0S@TOT/ 00 , @P<4 S72  圄 EQ`p2ڜ0h  h (K#3 cP @ 0 + @84`S  ?چSP 0K0g,<g9:x:: -LM P8%@  D=00 0 R P 4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@VY0:00YRڜpK4K 0P  04  B4 X`V 0  LK0  @@ `00,Kt^P ,0H @4!\@_M R   0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 #400p004 00,K0 DUPP80S,0X< 8P 0` 4 @( X0<0 8P 0` 4 < Kf<@$0#= ,K 2,0P@S  0T 0P@*@ =S :P@(K H-:: p-00LS@P0 0h0S  9n`P p0  P np -LM, `20\%R64d 00  8@_d t,`p`p<@D_@,y`Vp` p, ,0C@$0(@[`4P8`,P0`goT: -$0L Pp`  e@P`@0 S@`V e@P  ?0 0ឃ @u -LM$0`bp ^PUMT500#0qPP00U00S@ $KPH0@x @  0@@i 0Q 媂PkLÚ㽚$0`B:$0 -L@MRx0\ X 0\L0 0  < < eP (KlPD7 X\ ᶄ@\0< @@h\ ZX $0 0@0 \0IPƟ(0K8 #H`0 0PPR8@t8 I Y` 00:00,K, T`/:PP , 6H@ \%R  VWP x0@@,PkK\ V@ \0R<  \ 匃P0S  PX`Bw P 5-0RP5 @0SX$0 JL5@s00!PT  ?O P  Y'P h "P0\%4RP0 0P,0h Hh0 S, 00;00, KP,P  4 0P4 =S540@@4@uD 4$5 S,01@D4 QH L480 ,0H,J4,@ 80D Q&D04 \40 i0p40 PodLDH4P`, l5. 0\`#Q0OH@P0 H0 4L{<4 $Q,0HSP 4$H04 ,0SPX`L  40S 0S0X 0 X004$ (5*(0$ LP@X  t0$0P0d 4( 80P@,0@x0X@ R40HCL 4 X@!00KI0ua4P0S^`\Q`a004 S:O/ 04@ P  TQh 4 +4 0040 X$00445PtPP05S404%,@P 4, 4HX<0-@P440LΘ4Hʘip9T:T: : -L,M$0PH ,P L  (K`20D0 ςL0H DPPfL DZu`2D0OO[/ P`$:,@K@NP],PHpPIL3P#L3P#h gh0 S, 00;00,I(5`(0/ 2,L  40@HtP@ L080p ` ,0H ?,I80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@NP ,]IrP5$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 bRD  H0X:XW- -L$M8@pTvi$K jP@ 0 !fPX, @ @s 04 0 4O  4$"0@<0 8@ @_@P< K @@Psxs`0d  , l1. @\$Q00 (KN@P (Hh0,xls,(0 H t, 0 ,0 (Hh: -LM X `SKl , pqFP0$U5%0S' S ` PT! 0SpU $KP (0O0 @   LVk p-PL00@S 0 d R `T UUp0h d \0  08`s sVUp -LM`PpWVpU@x0S hU0@0S B@sZUXU P 0 !d R0 d R @00C0  B  0@P 000   s@@00C00 0C0@L0 $@00@f@ -TLOM0,0 P`0  ,3pR 0;;I N?KP T, 0 Ru(K81 匐0 p t0t0P P ` 0  8TT000@81 0  000  0 000PL0( U?KX1 1RXA  T! 0 H1 O?K <P 00C0  B 0 000008iT~<@0 @ 0  8希<1UKH A  0 P <Am<>mPMOK  9<8 0NPr 810EiPwiHdHd9 -LM衟0p,0 0 PR` L L0R 8lT, 0R(K+ll尽V  mP@@D1 R5d00Q lV  Gl000  000 0P   B 00C0   r rkkM/KM/K0P i9Pwi -LOM0 `,0 8 < L L0RpP @k81V! S8PS kT<T$ʟ, 0R(K\ L0R9 d0S @T9 d0S ^j  ul@P< T! 0`1 x9 Rd \90Sz`L)0d Rs0: SHA DA  q8PL TP 000  T!000T 0@PY < wkP!R P1SL STHQT!000< lPT1  B 00C0T    <Rr0P@\  kR8R<XT00 0 0q 00OK YF@PWHT <dj@Otw (k@6 #k@10 <i@ <kLD0Qe H! R S@1 00S\! X1  TP\8RKTL o@P*0  NK F@PT8PL N P P!RI P1L 0RT0Rr ,<S 0]i P800P00SR0S `!T1R 0 0 T0`T!0D 00H1 H! R X \! @ 0 .R <j@L1T 0RXQ L!4 R@LL!000 L LL!000 0@P L1  B 00C0L   T!P0S L 0 P1 0: S \!R@T1H 0#6 PLZ@P\1S) @\LL1  B P00C0  B L000P1 0LP8 P@ P@P pQ8 p8 Q00 0 0: OK $E@PS<^h PT!`Uh \1Sc oVQU<QR  <i @ 0ih  0Q P yP0S^B@YR\p0Qp P1 p0Q@KdMOK TS 0i@P XQ= L!00C0  B LL!000L 0(o4QW\Q RX\ 0T@!0@y<0T T@000<6L!  P H1S@ ^/ 0, &402O0@ ,0<Hr,0@,*H0K S`# *@` |6Q` R0 `0P80SK 2@6/, 00P;00,*80@SVv 04C0 00 0m,r*j  0n4K  0P [40K0H0 6., &402O0@, <H,0 @ ,u,P 3 D0K0 H0Kp "(K@6pD,Ka/PM, h0H  ,T,"*  0K6 I/@P100 0 , ,q4 X 0 0 0D0K 0 a 6 l.0 63O0@,+00<H00@P0)@ ,: -LdM \0  00 R x X 00 L Zt 錐`P|  00t04bT@| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڜ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN WZ)p 00t 40/-00p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p W )(0 30@O/!(P(00 3)O0@0 a`0`  (0 0@(0,@'@P (x@ j0@fLVkti@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D F0$!0 S T^T ,SHL0/,00D}8@ $2ŸP0`00(80 0@80<@(, 00<8 9Q00P0O0@` ='@PT0HS࠳@ 0 < D 0wD0< &@SD@&0"!h! B N*0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S <^( v40@(K@1S D F DeR 0B,KH %00P0400 <,0^4 00 ;00' ' pLVkti: -LM@LP$  @(K4`K$0 00 T@ 0 0O!0 000 00P(` 0PEpR$R@ R,6 6@C,K6 ,@P30,00L HPR$@e`Q0)P 9 10#870!RY ,^)@UP \0 0@\0`@0,',)l,d -LMpRP }00 0BRSvRv &  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 F~,0fH,0<@2 ,(V W0``1 aN0 ` PRQ0G0/,K0 `P  ~ ,(000  0(K  L0( 0OT R~0Sz(.   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 0<0:0806(8gPeiđ9:: -L}>@`0$KS40040\$ \` 2 1C0 00 \` @KS-4d@6d -LM `1 n @^RQV(Kp@/0"PP T(6H 0(  $K(Y 00  0d  - -LM0@P p;pp!`+HHU }KKh] -LMPp 6S, `f 6`S6& S/!&,6@HHX/ 6`S0z03Y0S  (K p-LM`2 \@@\@TP` (0&\Fx0  KP @x0 R <0F0x0Sd 0Rx -LM4 `8  e8@T400K" @#>PP p 0`\"hPj00`00 0p0P p0PP 0=U (KP8 @(PHG$G@G,6 6@C6,K !PPJL0, S$PUH@FE$H H,O10'080'180 R1400K sPP 0d5d0S00 0S005050d00L0$ 0008 0;8000;,8  0  @0HdDjx:jHd@jl,d -0#LRL R 0SR T0 S T`0  ,Qd0 SH:t: -LM`r,`@V)8 K00 , 8` 4 75Z8P  T  0 S 0PPS, 0S @0f 0 tPP(K .l,d:: 0-00LS@P0 0 0S  <P  RPH;0h0S 0S -LM`2p1#RcL0(S, F" d0 T``\Pࠃ P 0!P` ^ U P ^ U`\`6 Ɨ0& 0,f"0a0`0b@ 0@ P,`P`0@PU`P `P $( 0@,00@ Z BZ YNZ t S: p-LP `b4@P S0 0;R @Sp -Lp`P)`BP,0S% 00Sx 00 S,0Q hQ`:,i~i{i$0 :$0`"xP303O -L M$0p@ @(K`2 @  07Pl,K ;@PU,0$HPr@PM`2`+"F 0@c E+0J OP@Ɔ& 6FDL0 S D$(D 6(S!P &,0,HE,5 6PS6& S,K/V@P , @0$< K8 40 <` 0 3@.: -L(Mx0R 0P80 0` P3pP (K:Pڈ3 Vp 06pP$0040  0{PpP(Kp!H H@ ;@pP < ,P R4 0R mP Q<0S h<h0`2,04HpP Yh< ch<+,0HTE,<,p 4 0R& 03S030s6 0@c,D+,@0B @@ FD /&@ Ɖ &D0DL0 S@ D$( D& 6( Yh 6,S&@&,0,HE,I0@, 6S6& SH/hP0 ,g0p]<  0`"8@$ @*<0(0$ <@`6#1$0&0,0( x0i -L M8@TU9(K j:P@ 0  6P2`@(p@DC$CPC,6 6PS 6,K @P,0L H`$6RU@PgC e!D, 8: -LKMDT SKl , pvPPA$ F ``0S  PP. kP3 # B06$ H 0S $0 ~mP3 S0&#6LPDR/K7P , 0R(KLKZ 0PPKKZ 0|p @0 ,0 0C K(P 0-PP`00SP 94 PP x @ 0 #40SP ,mP $0 LMQ0 0 NP IPU$0V 0SPS9U`2P1 p T,RL0S`EBZ  ZYOZ K @ZKZ 9 0St 3VS10 0 Pi@ P0 0 NP OUE UKKZ |g\9 P@@`k@ i@pdl,dԑ9: -x1LMl1l`z:P\1\As:P HDD KO;pP7  spP' 0 0 R  0 00 000`2PK' 0 L0S  , A:0s 0   B 6: f8@@ ? 0LpdLVk iDdi:0:r:xi p-@ MLTPT` 0DP8 40P@Kph/d8:DjD:j0  0 0 0S 0-PL@}+" 0PB8Q冾0jDj -@QL3 0S00 h< -LM @`0P0Y (0KpPK(0@ 000,1P!( 00 ! 0 & 0 pP 7t6 000( 0(j6 pP0  ]6(00 lkP kP 0;0$ G64dPwi- 04d p-L M0@P`P dP`)Kp0S  00ʚ; p-PL@`fL0(0S S0S  phM (phv -LM 0P@  0?`P  KL0p( P@ (/>`P00050@0 0,0 @ 0`@/P`LVk -@L00PS` 0 0 pU 550  upP0! B!75 -LMP`V6}5p0!R BpTr5p5 P 0 0 0 p 5pP10C1   N5@10C1 0\p -L8M"P0 Qp 0 ;;I,0K{pP H 5(K,0 `0 0 0@,00 0  @ 101 0pPNDpK0 D0 0> K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@3OpP L0 ` 00Q!/pP 0! B! 01000,4z000  *pP ,00m PwiLVkP: -`@00LSPLp}4L L0R Lr4pU  MpP.0!R# 00 LpU  L !0 00 0pP 0! B!H^LpYL  pP Pwi -LhMP @, 0 L L0pR` 9L,0T 4,P 4.L~50|5 (K\ L0R0 0 k50   P\  MP08h t !R| 00tt 0 o0: S\ X  D5,0P`0 hd 0h! !h h0 0IPP Y 0 LPd0S d@3`3\ Rh@ 0000LPh0! B!h 0300S$ K3,340400 0 0P 000K & 0Ki0 .Rf 0KM  KH  KC0 0DJP 0K`X 0R` \QS  Rp T0 l  Zd0S,<3`h *P0 = ,K &P,P` d d R d `0Rh0R@ = 0J P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ 0c4\P0Ql0 p T0  0AK 0I d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h ;Pp0TQ00S ` 0! B!`02d@p Q10C1 10C8#8S1k d 0d 000,200 0 0N 0K %0PI h@0YL0 e p R`L Rf2Y0c23Y`0h 0R@l R `02!R !`` 000` 0Ph PH l0S `@0! B! 0OpQ3pF` d `P d0!R\ Ra iV1BZt-l0SP 010C100000(1oL@HK! B!00 00 0 0 @0 0@GLP60[S#[0R    0T  0X 0C0< @ 0 0@%L :h:::::LVk..: -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R fP 000 0D0   0000 00l#00D0 R0 0 x L0$ x唀 0 y㘐SX }fP0 S R 0000R㔀 0S 0;0Q 0S 0;0p 00S Sq So  0p)P(0s L0$ d 0R >fP \0y ,0 GPr00s000(0s L0$  0 0 00(0 0nPY`v0 L0$ 2@ 0R  fPI R 00S  O@eP 8  0:0000   40 0L #L0$  jq{0 S ePRMꔀ0j0s6f00sz -LMp0`$KPQ0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@0l,d -LM 000 \.K p- Px0 @L0 6`P 000Hq0(/00`0`p4dP  ,0S !5%PA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 p-LM@P`P  0H 00S  Kp :: -LM @T`p5 pP Q*Z  $0( ,@ TP ,Zp Px($0,  \( $0 , 4  $K:@:h::0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP+ ,,0S "\" R ,0S 0R:\ R0P 0  \/ 00!-P,P ,0 S 0SP 0 S00:S P 0S0SP0SP0S  -L$M`  PZ 4 80  @P,K0pK $ 0@P P @P (K40@$0(0,0l, 00f0eaQ80  P 0S0SP0SP0S PQ00SQ00S -L`p@PPU@V4 0S2 `P, $0(,  0a@PPU@ Q 0( S$0 AP:,00P* DPU@:`P::$:: 0-@PLĴ @ P0蠫j9 0-@PL嵴0 0 00000jx9 p-P`L@ᤴ @` pjH9 0-@PL 啴 000 00 0lj09 0-@PL僴 @ P0蠫j9 -L(M`eP@H8 <0 6vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 ` 8000 D08 0(K80   0800  -L@@@DT@d@ -L(M8 `P (Kp@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0ン(0@ `0 p质j9 0- LP@$P .P 0Q0 0P0D:9 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0û`:Ԓ9 - L@P崻D:9 0-LM @PP8 0堻:96괨j20j.j*lj&꠫j -LM Pp P  t$0(,@ \`,K 0` `P P  (K 1k -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: Q@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP!@ {P$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0AP 0@@吺 @: -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K 'b@T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0 D 00.,P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 >0 ``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P 0P 0Pxx 0P` 0TP@ٱDD0*0<0 K0/dL:jT:j`:0jp:j|:lj$j`9P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0埸坸: : -L !Q0厸(: p-@L !ƌ\`"S  QP P 0 - `p Q0S  0  0 00`p^ \ZL::l: -@`$0 L0b#6<@ SpTQ&0@ P P-TP\P<@0!PR00R0S0 !P o-\ -LP@!ƌ0C  0S0 !h2 : -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb UP  0R000 00 0 p-"fL@P  00b0fS 0S 000  p匷劷:: -LM@p, ,P0, a@T; 0S"4PU(0 ( 0ቂ,P ,P(K 60A0C0 ( Q  6,00,0 PP  0:PC, 6H:P::R -PL@ᘮPP) $F%6@U0p0!a @ ppf bUPP@ 0 0!< R$0(0$ (呭PXjj -b@LT 0@sbTh|Xj 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000h姶0\: -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(Kmj 0-

 xP0100@0<^`p <Z :@`p@TZ   &6ʃG0 , T M/PP( (0  0l!u{@T 9/PP(0 P3PP<@( @P( @T0 00@S8 "08 Q/@( Z%P R@P (0tz 8 %PK( t4O P 8 010T:H: -LM`@$K/p 0K @ $p @ @@PP P  K I(  % /K -Lp`1PUT `p_V@P'P@@P0W  X R`P0@P_ @`T. P`P^ 1@P  W00X0S \P^@DZd(_`_U X`tIdId 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 &P<pX@ @8 0e0A@08 @ 0X0@3*;\d\: -LM 0@Sz 0St_`/\0 R000  (^hL0C 0yIdh: -LM(àL pWP`P1W 1W V0S0:S0 :@P`  0ppap^PUPU 0S05 00$/ 1Kz ^  _LP^ R  R 0S^L #*000S0 00pPm^00Th^ 0H0 0v^000$\^x0\dXk%k%IdIdt:Id0@0$0PLVk 0-@PL \P0 00 f  0R  +000000 E (` VJPP0\W0PKQ  @P04 `Rv  @)p000 @R000 P00 Œ8 L0P  0 PKKȟp h0R 7@lLpP 6*000P0<0RT8 \ 00PKPKP < D0PK@0009L0D < PKD0 6* 0Sd'101-pP  0.@P 0PK h p0S 0006@Q4  4< D0#10#0#X 6  ZylƟ< 14`01D0 @ 40S(p  (p P00 Œ8 L0EPe (0C 0PK şp h0R  U6@0S 0@-pP2 T)@V040`0C40 @((@V)pPA0`[PK  0Jğ 000fPK a_PK[z@PP 4| 0[-`P^P4p (0)4(` !PK0U3Sp h0R  0005@1  01-`P 4(p(H;4 4(0(140  @0 0G) 0B)4` BsO((A<L 0 c<000C0l4pi "101(04(0(4(00 <L 0 c<0(p T2PK 0 000Ÿ<0 00, D0 LPPb0 X` ,K400p 0Q40KPPo U0! t@ P6f(PK  0eP0AMs4: 10 14(0 As4(4I(PK !0H0005@k.s4L  0PK95@_'(s4kPG ((0?Ca PK 0s4\00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 q^`  ,4PK@ 04@ 0P @a m ?Z<0cX@ (KId -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<̥0R*0`"!B1 b 0 00  000 JU   &0 ^0S(K0 p@U 0`S00U o ,;$0 60S dYk\3kL:j>00  % -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: ip`,K < 80,  00y0P!4@,pT 8 `T,:,0 @T @ `\ 0 8,:,0 @Thc4K&(KHARU0S 001@ p0S 0S,U4K%0C! S, 0 0 0Q @ T00 :oU@ 0@ `S  @0RV< "f @0 4K` %PS l:dYkjj@:LVk -LPp눀` 0t@T 0R 10 P T(T*9(Idj -LPM rT 0RZf 1   T PqT 0R1   ThK@h`Kt!p *\0@P0 pP`1XTP1 Q 0 hK!PR UneTZ n]TU1h K@U@PQ x0*1(K0@p  P0 o00 @` P@6TVjId# jx: 0@.1k: -̡LM T Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, ?$KjqdId# D. -LMP$ Nl@T`p(KT,K, Lh0   P, 0 hn ꐰj': 0 p-LMP h`K! ̃.' 0@P0 gPKp萰j 6 0 -LM\ ~h(K!p@ 00  0@P0 CP4 1W , 0( 0cP`8 0:P@zG`W h 0 &@P(p0x D0pS !/W$00S,(K, `,,  apꐰj'IdLVk: -LMp@ `.` $PK @ 0$@ P @m K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1ph  a(RP4K@  0 4@ ?#P7,P0U/88 b,0Z0S$ :@`p4@ P00000 0 %(Z0 8,0Z0S$a,8 Id0`~0^p@0P 0` `P @P 000D T 0 00 0GP  K0 @P儡傡倡''::: p-LM1P0 @ |`|0 h0  `0R0 P b 0K@P0 P 0`KpNxgjdYk'Id<: p-PLMP*@`Kp vP \0#&R*H10R*0a"!B10b %JUxdYk\3kl: 0Q-L@ 00SD00D0p@-x|0\ @!@1Q% \ 1 !R`#`3P Q#3Q030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:Ef f@U>0e S 0SR F@VU0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q: 1k$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0 1k-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 6P@ A-P @ 1k P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<pLp000*f09; -0L @/;h;;0: -0@L  A:p3P 0000o:0'; M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , @Yk 0-0L@P!9P 0! 000 f00000H9 -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CSh.h...\.h.0S]40S0QO jW Y$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0 X00S @a=00CS00,0 Id: - L@T0000Эެ: -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x嗙0S PK0$0( ,0 0 $ (,@ @zЭ:: -00h t@RLBt>00 p-@`LP$ 0 q= UpPP+  @PP@ 0/B000cStiPPP@H0/B000cS 0p$|::::VUUU: ";: -p ML`8@0P(,0!0 @04 0P@V (0 H.P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XL:T9: :X::<::j::\::::j:: -L M䒟p`$0 , (, 04 0 |$0@"Z78X 0@P4K08"P< 0U@ 0L, 0Rq(KP`d pt x| Z $PP 0 $04@ <@X@H0D0L  P0FT0T  XF T F0T0j(0$D ,FT@PF T `D0FT T  0lPPnL?pi::$:H:p:::::::::D:::::89 0- L M0 \0\0\ 0d R@P 0xPrh 0`dP@iL 0Dd@a("K0hRꐰjg/d:1k$:$1k,:2k -Z%ZULp`e   ; < @$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00Le&T$0 -\0L@  Dh8hC((\ P1\@0CP1hD2k$1kj 01400 v P30,@ >0>0090. R 0^  0P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0iP 88`0S*#80. R 0^ T#/#/#/$/ $/#/#/  0@+  0@(  0@-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  03 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p a 0P $PK0@ $@ P @ { -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0 6@ Q 0@T; p@@0 `,K0,@P,000 R  JZ   0U@(K 0@pW P n P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 HP:00 z 0u  S0`  XʽW@ k 0K0  @P 0L 0S 0 @ kj 0CZ p@ 2 똠 p0 S -L,MH T H P :#:S0D >0 Z< *2 P08 40 \8 #P L 4 S TD8 0P4 H4 PTP , K Pq ,P. 0< R*L-0,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0, P,  0<Q PH T8 LD8 Ls"4(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP bP00 PH T8  040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,20,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 ġ0  0 0 0, K0 tK0 Px F,Q *@@R (0 (_ , @RRP@ZP  000000  ,@Q, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pId\3k 0-00LS@(0P PR0 00 0  (00C0(0 00 0000000  R 000( o00C0 R 0  0 0n`0gV@P0U,>0 N@ U $`KP% $J UP}hh@v0>0>0 0U 7}5}IdЕhԕh 1kdYk@:l:: -錒LM™0 @0 ,  0 @@S-^^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cl^0S 0pePcUg| 0, >0>00 00 >00,0h 0 P00C $ (0 0, `\0T(XL(K,|됰jIdt3k5\3kP`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VUSF0@< 8 K hV (@0 Q(Sui 0O Q ,R0jaZ``X@@0 *W( Z``X@@P ( p0S; T  0P( V Z<1W0J<1 0$# P (HPP 00(( H40(0C40( p0Q  \ Rnoui(D$LVkjW 0T00000 0R0T000<0 0 >4$4P($"8p@Wm 0 00, 0 n$ AQ4 0!@?CSD00D0W0 #0/Q R 0O0S@PoV0l0a0K.W,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU`0l0a@\0 p?18p0W1800 ,@ PNLVkj00/0P?8$r 0 QLVkjjаjLjD:<( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q @P0O0@{i i00 ;4 00&@ig: 0-0($@,0LP0"P 0000(,<P $$4R@00S# &0@ P 00 t$h00bh0@P L0(,$0pM0N\0b@ aiKpG0C0C+㰮@P+0\@D0GKL4  0C@PD p$ t4 xt Hd @P0d0CSP/$/////Ŀ/@00Sx0! @\ ` PPV  hJP@ 0B@@P\ @\P 00@00Sx00 0000S1  ;0\ $0*P@P 00Sc \\@P,8\w@8_0 ^iId\4k0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 }P  ah[ K f 0d 0f#&Bd 0S* 0d 0c#&d : P-0L R.  . h\: 00 0 -L,M0P ` Zj @<0"0 '0S_ P@@ GP  Z00ST K0R00} 0@0@TT0 C@ @ء0 < L  @00KP0 H` Dp ,@ 8 @@ 4 W 0S/0 PK0 0`@/ V @ T00T00S`' T 50 0C0 S/ V(K" S@f0 PK0 }0`@  X00R0S T0 `Xy0Sx% BI`P T {0:LVk -LM< -L M@H \?pP` 0 \p:@P`0s P,  (0  X 0  0\00 p0\P P(K(㢴,000P0\`p \:@`pPUY   U  R(,  (0 m0!,%PU (\,PP 0 PO R, PPU ,K 0PPP ,@(K,,000, (0 $, (:,H:<: -0LS0S\lZxpD0 0@`,PXWP: M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` P(ڳ:@p Q P`|@T 0x@K0`@ P P,0 P ` KP a ( a  D0(@㛳( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$$0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (80"$PK`2@P`P ` Ps{ 0 S0pK p`K, K0 ,` 0 xPK``PK` P`LP   `Vm 0^\ ,0Pq (0S(@޲G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R0]0 V( R0(@㸲 \0Ux QQ`VBP#0!'I# TWPW@   0pKj x@R,:t::: -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| #0S 0 Sj00    Q$0$0$000 K0K0h"mX:: 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 c#0S    R$0$0$0  0 0K0hwK00 K0hj~": p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKph1 05k,5k$5k -0LpWP  `0V0 04@0 0 6 LVk -LpMp 00@"0"0\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  7P"pPK`| <000P`@P0 @0S 0  0$0p0$<0v  !0 0@0 K!c 0x0  40  L( K0 P$0P0( @(`0 @Qd&x 8 0#40"!B 0S@v4:,5kLVkId$Rdhd0 ,5k5k@:Q00R0 S-LP P00S00S0P00VH:Q00R0 S-LP00 P00S00Vp: p-`PL@ Pat00P30@ p p-`PL@ PHt00P30,@ p -L0MPU, `X 0S 0S0S s P HK0EUS  8T (D#x"h dŸ@KX2XUpX `@2@0 ZP0 L 0 l0P ) T0S ,0S00S40SX 00Y00S @0S p0:0 S<  sP@0S V 3S @ZP, 0LRM(K@0S<0S80S6 ,@K sPWL X QL PX0@0S}L ,@K sP 3S @80SH0S 40X rsP 40S 0HK @Z2.i9*Md499 -LM@`? 0 9, l0; v P iAq喏᧱`PUPE]10C8#8S1YSW:A 0ᛨP04$48,#H `,0@bP C&: 0,0 l0 1!08!x#W6@X+PUPE"108#8W1X*qA 0_P04$48,#H p,0@&P UPE1(Kq<,0, @W 05k<40S;80S89 0 Qy 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 P 0 1(K 0 000  0, X,  (Ko04(4 S:0 0A凩P @0 ,00 ,较B0S0S vP ,Tk05k -L4M⠢ 0 ( L H S@"0S/0Sr 0S 0S0si ,0,`Sg DKDPK1 -LpPMp00`Q0S0, 0 Pz5`0H0SqUSm HPZPgH@K,I-0S p t0SVRm8 RUN H0S |0SM|HG0[S hq8(00000q(00000 EP 4d00d 7 0 @Z@dG0[S@0[S?0[0S[P %04"48#P , 0R|(KP (7 Rs00 Z U  000(0( 6)  5 0`000|00 p0P0 P {jSGHP005S3P d0 R-0S" S /  M>@Kh jPK 000`?`%0T LKj<9K00K圀K%@K04"49K$0 0 $0C K 0KP 0S0 0000 D0KjxK0dK0K倀Kjxğ\K0c0KdK%0L0 04"45KdK8!-@P   ujP 80S0C80@KDj3( 0 d0K0 0K 0 8 0I/P w  KkP 00S 0000h3 d0KP YjDß0 d0Kc K04 45KL dK8!-@P   %jPa 80S0C80Ť@KD6jd0K0 0K0 2( 0 8 0.P ' K PG 0S0 0000Y1 R L1 R   00LZ L1P0 t1 R 0 K80S0C80ln,i80S0C80Ŵf,1 R  00K  KP 0S0 0000ZX 0 RG KC:,X0 RH  l00K>%04"43K#,WiNdl,dTk:t9:9ԕ9$ i iĕ9:P::@: -LlM`S, p@ } 7#QP/ 7Q .70S&7T/0CT*7T 0T)iK-P7Q t7Q 0Q EP, 0R^(KUP 7Q0CQ7T 6T8 1CT7 1CT2 6TC0CTI*U1CTF 6TB ,0T? 6T 6TJ0CTX:Z x6T l6T P6T 1S  P-PU  0P|P#5T0CT*"0CTQ 0S0S 00S% jl5T )$0CT5T :50SM1CT 5T 5TPa5T 0TZl !4R/PTUPP4T 0TUQ ZY p 4  R:p p4  R:q@$00000q $00P0P004T . 0CTI 0TY r 10aR001#050%p= 10bP001#P3P#050%T3Tb 0T_ 0CT[1P83T~ 0T*@&h|2.P2T 0T5`,P0P0 m$P(d0lW`@ PUP K`Pg ` oP4K` Kd@K|KK0P 00 P@0[d0@0K@ [!tp0 K@ KT0 P FUP + 0S00 \00\0W$h@g|2 P]P %04"48#P R 5R00K KwXP0SIP=$\9%04"40iMi Ji(>iildiH:Ni0WiHKieiHi"i ix i %i i 9Ii i i Qi l,dRi Si !i : -LRMMğ  ST1  0R,0 P X 4X 1CX 1CX -d, 0R(K0  0So0Sl1SSh1SSd Ra3X` 1CX] 1CX0I TP P@QL@0`SG0SDpKxg  g Kf@T00   1FSK00KPp X T1a p\`K f\P<0X@P80T@40P00  \P X@ T P fP <@Kf0)X2X  \K fTpWIpWF 0SY L`K fLP<0H@P80D@40@00 \K LP H@ D @ yfP1X4 S_Kx~f  }f(OK( yfT5 NK`` pf|| lfP X T11!K]fT00   a!NKNf( (LfT!5 `F` Df00`sHF4fpKx`.f  -fK )f.iiixii 9: -LM@@0T0 @T 0 R0 KM@T -LM`peV 83PU,P  0 , PUE 81Sz@vT@T@T 0S<,0S 0iSl PJk `2 R ,  P00^00Sd V0 0,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0F,` ^RlʗRV 0 0bSPRXWVU P y|8dLddh0 `0PK 2d0 000#0 QK i i$ i9 -LM 0夐K0 x,0 d dT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ PL, 0R (K<0 R 0  Ei9$9NdT:9 -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` cP  cP U U00 0  00  0 00  00#0  uc  _cP4Jd,Jd -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 CE`0S 000 8E0 2E0S 0 @ P `p tP@ P`pE8`0S 0004 E0$PDNd|8d(:::::`: -"LM0PAK @0x,0 b  c5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 @  XZX @P 5d0S 0 000匀K`bP d@KKK4K0 0Q0@0[A0@0K@ [ @ KP T OP , 0 R&(K KP 0 R tpD AS/Z80 R 0 $[Di9Nd::9 p-LM4ad 0R@0 P *h0 S*1 R 0 8D 0R&Kp0BSh0 S:d0S 58J0 R 0 D|0 R P LH,KPP iNd(:`:(JdЖ99 -@L0000#0 -LM`\@pb:,Ka<,$!$P(,, %pK0Sp> SH 0p 000 00 00Rp$ R, 1p"[2[[0[0!0000 0!00VTP 0T* 0S @T`00V00S 0 0dS1!Q00Spa @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1Q00Spb 8#8%P @ @0TA @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%8SS@ALaPL 0RS00L0 S0SA Na0N 0RS00N0 ST`, ALaPL00 LQS  P`0 R-\QPNN0`@TY0.S 40S X*,` 000 04 0RfQ 0000 S 0C`00c 0Z feV -L@Md0 `PT,0 H6 R UVppVKe, 0R,(K40 <Y H@KT T )V0 @KG0KHK 0 3P T0S  @Pce PP  ;eP0 @@Pce0 P # 0000P\ : P 0P 40 0S X P0@00L0 L `00L0:  L 00@@@ UL0 ULv0(p(0@@@@@40 X R L00 UTL @ UX 0P(P e0L 0@ a\0 S:4 30 S L\ aP0R :0`@0DS:/.00Sx@UL00a  P 0P 000PdP0 0S 0S 0S| 0Sr P@ L( B("(04"48#,("(#80 @@0 P$("(04"48:#8( o <8#8 0P 0@@@&P |" 00@0@|2P`00@0@|"00@0@F `d$ab`PdV dT0L 00 X0 TL0X@ T@00S0C00 00S0C 0 0{00S0C00q 00S0C 0 0g`AaI 00SX 00S)P' 0S$ 1 0( 0*e TPiFkLdT6k9 -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P \TP,0pcXj Y X`Y@   @TP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Ri$K1T+ 10SPD@KT0 C0KD K<`K0S7 (QP 4080S0C80?1@T @T00ST0X0W*< |20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0Iyi|MdtMdMdxMdGk9 -LM@P`p$@0 p4K`hL: -&LM0`,0 0Č`P 0P 0S! 3 R80S0C80}Vz3 Rv \KL K  4m\KL K  4@  RP ,3 R \K@L K  0 480S0C80L0[S@C LK\K |Rp300 2 R5 \KL K  4,EOK(J( *,P \# 0 a! e0 00V 2 R LKa\K@L K ePF 0^4K0[0S@@ ` LK@,0@33Q: 10SP*@KPK'R`K#R R0LKK 0KK0K0KKKR\KK R K R!K0@ P 1%@KQ\KK0 0KKQi]u80 Rq \KL K 4X 3hiLd MdNd4Gk:d::T6k09:: :t::x:MdLdW0@:x( -LtMş/R 0 , pX 00 S0% :Pg   ` P 3V ,+Vm ,V V( 0R0% :PP 3V000011`PP 0@S0% :P= 0$48#8 R`P<V 0Z0#X( dKsQ0 S0d0Kc K \@K L dK0UP 4 Rd` 0 l0KcfPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`Pz0S 0S0% :P 0 @2  0 l0K'fP l 00R6:0Q l0KfP l 0R':0@ l0K fP l 0R:0] l0KeP l 0R :0;l 00R0% \*3@@KHKP0 H0KGKŭ] 0 HK 0@P_ 048<:Q0  D0 0HKS㈠ P x  p 匀 p`K 4 21C0$!10\ R dK( 0K J21\@K  B⃭0 $(, <4!4" P8 P0  0 0  < R2Q0,0  81 bP0,0 p,<$!$ ,, ,  ,K L  L00S <040C<0 4 P00  0   8 04<8#,("(#8 04(K100S  0 $("(0 0 Ph4 l,d|8d -L M4 !000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P P& P' P  0   @pT,0S`V p(K000P BKP0,0 mP    pp40`|8d -L,Mlş 0  S0, L0 @P` K:X/ @T@ HK@@KK0 TG0KHKKHK(IP 0 $("(04"48#88f#pAZ ꄈ00D0D0 R* Rp Z@l, 0R(K RWp`ZO Z* Z y갊000h0 P0K`P P 0R:0S W0  Y@0[S S T eKPH`Kp |3  0L K28` VkZ@Py  tYPVD V:]Z[Z@2  <`@0[S?0[0Ss2 @P 0S 0S 0R0%0"` :V  0pP ,Zp~p<`8` ;Z1 ` `( K0(` KZ 0܋0$0000 00880!000 P 0S0 00s00Y18 00 aX0L 8 0000PK4 P0 J0000W`p 4y?0[0S:17 0S%04"43K/?0[0S S)  P0K_P P 0R0%` h*,Y>iMd i$ i9: -L M@ ,  `0Rpf |" 0@,W$-P>`0@ 8$H0S |2  ,gY (K 0 S8`  K:XY @,: 0<@ pPP. x̟! !=0@@8DH@T JTe T2 TL,P |2@0  <@T^D0000P0; R+P(8,H`0@(8,H,0S 00K_P 0 0R0% *P 1,, 8;@P $(T5 Ty <:TX T : R, 0 Px@0,Ks,00S |2@08 8< <@T X 8H 0@8H<\W >0@*084HTR T,P |2@0( (, <@TW :T,,,0SK |2 00@0@, ,, @r 0w+PT),00S |2@0  W}T a:0DSiv,00S |" @00@@0D@<P{dT:WT ,0S |2@0x x| ,(0Z@P / F,00S |2@0H HL <@TK,'0ZP  B?*,0S |2@00 04 ,,70S W5 W5,'0ZP PP 6 8X``ß0@48 4$D8X 0@ 8$H#T6kNd:s: 0-PL @R 0S0S R  IP @0$ S00 000(Md: -L5$00 0Md|MdMdMd -QLM# @P`p, ( 껦@P 5", K  pf`0, K $K -`L 40@!0c480!0c4<0P 0c4Dڃ0 0c4C@@D0@ 00Q0 00Q D؃P@10 R d0H, 00 S0 L 0C # 0 >pPP8P@ꫪl,d -, 0LRP"* L0S, 0S*4@pD`@` @X4<0,0 H8@K00 sg, 0S:j,l,d -LMd(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+괤0P0P0$0$0$0$0$0$0$0$0$0$0$0X0$0$0$0t0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$0$001\0 0K0-0 K0h>t0 K0hlX0 K0hdT,,0 PK0hMd:9@6kSM: 0V R*KA"[04"48#8 00@P  P+00h a`*0p@0@P0h @PP,0T0h `@0p@P@P?,00h 00@@0 D^ g0S 40OL'> 0@0'p0 0 00LQ 400S? 6 R@p@@  &P@0`0@@0D@<0S |28 8< <00S1@9 0S$0S-0s- 00S~ 04z <0%z%0 0@%0@00S Sh 04d 00Sh 04!48#,("(#80 <Z 00SR 04!48#,("(#8 0 <D00S;0K4K< K 0P<P 0400Sp$P0`0@0@0S |28 8< <0S |2  < 0f 00S{ Sx 00S S00S S00S P:0< BW |" 00@0@<0P 0S 0Sd P"00@0@ R{ @00@@0D@0S |" 800@80<@< 0)S(RPf 40`s P2 R@T  ~=P#0S !hl0F\77P Pl0l03T~l0P0 0l0+l0P 00l0%P\,Pi9ȗ9  R-L@p`?PP T V @  /P; ?1>77 (R-LPp( B(0MAP @@0S1` ?P  0 0 7<P 000 0 0 0 -LMP`Ue?P1 @0 0P <(4"4!< $K= 0 (/ 000<P @ Z>?pP ; >1>77 0 @0 0 000  .0@=Pp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`!>PP@q P  <@Pl1 (@pp ᴋ @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0R@P!  R4 000,0) , )<)00`,08^=@PP7@(Kri -LMϟCS0`Vh臷@0$E D d0( #5#3 01Tk|8d001 1Ba^0 %iQP 000010!$10 B1 Q `V p p<00 0j P. pq0S 0S f00l0 d0Ba  040( Nd( 0DiriT6kNd:(9 -LM0 005  @0000 0 -PLiUpS q`PS *? 0S2 0RK0 0S0R0SS0x!00SP R 0T10  0| W0!00C0 0٧ P001hn0 R 0 0§ P000~ 0 |0 p0Ba0 @囧0@0 0Ndh@6k:::P:::0 s 3X R7 Hd0S LVLKH< O4 R \K> Ey7@40 070Si <K' ._c0S[ &L [ \K 屧Pp`P`6 lK@+X e0 00S b0S8 \K Ae0<K P P <0S 80S40S00S %!@KK( 00KK%@P 40  00 Rs Ea0S [0[0S%04"45K7d1 R H0SD0S@0[S <0RPP@S@ !80S40S00ST0%% P00 Ġ"Č0 <K\ KK@ 0<K @U0%  `@R000 <K\ Kov<KP Wo *PP 0p` `0iLdNdGk:T6k::<:T::$:::(:89T:ԕ9: -LM@0`,0 0 <K p0 sLK sPU" 7 R7@P  %hǟ, 0R(K @ 00, 0R0%P U:Uc \pK r0 \[48\l- \^ &300  L0[S^ @KH <PhL0[SZ PP@ 0PAT0Pb 09ᱤ(  $[0[0S\%04"45K5 R ᘤ   `0K*P ` 0R0%P *|5@P $(s=[0[0S S5 R]  tYP4 RR iN4 R a<KP4 R; R7U e0 00S P4 R+ 8 e0DT;  SP z HP v 0Xr 1# S <0e @R@U@Td 0e P  0@S! 8#8S140040P @PT@ P 0  0T4# P/U^ 0SR  U  1S012"0 e0,U&P ᶣ@00 LU e0 00e \2  0S A!0!R00S 4000e hP  @Τ0@P<yP$  0U00S 0!10 40  Z |2  00 R < <0| 03T0T 0 (iNdGkl:X:::T6k:,::H9::00S 04!40 g1 -L<8 Q l0 R  0Tq@ 00D00D0|$ 00 0@0@0Nd:l,d -LM\#X@0p<K,0 U 7PP` ϡTW00Kx0 A  K0K 0K00K60 <80 4`0X@  @ 堀 >0 0000 4 0000 8 0000 < 0000 0 |0K<K0tK{0K<08 P0 T `0@0`0 ]K@ PᜤUW Kⓣ1 R], 0R`(K`0L@K0 `0  <L08H 4P0`D0P@ P`0`@00 0@tK |0K<K0{0K@ <08 P0 RT 0P T RP #310" cb ` P `0 R K✡0 PP`0 0,DiNd: QNx:@:X9 0-\0L@PT@T 0SX X0R⨢P 08Od -T@LT  P HP 1S@T|\000N -0L@pT&@V HS0S P0T0SPU P0S0@ 0Su00S8Od p-LLM\`K@DP< 00 \X0 T P   @0H0 D 4 0zKp -LM┢P0 , L Pp p2 R ܠX0 T, 0RS(K,2@T@T T P0 X0X RP 㖠`PS HK@K(0H0K @PL@ L@ @KD 00 0`0 0儀 0 8 L0KXPLQ rLP00P0Q800C8060 RL t@XPo` l0 0` kL`V 0 R `V80 R NX0 0$RniNd:8Odd98:: -LMLP0 0, h0 (2 R *X0 0P, 0R(K0HK0 @ ` @KdpKG`KH@KPK (\Kc`Kd@KDH0K0 p 8 h0KPP#P0h0QP0(1@T T P0X0X R @Th R 80S080hY0 R @KʟX0 0P`P pP D0 R ᱟ0X0 0$piNd:x98Od(:: p-LMS@T @T L0 'P @@2 R T5L0 P0J PP00P0@T 0S00S@T@TL0 P0PUG L01@T 0S00S@TQ@T 0@ 0S P2@T R 0@00 RxPP0P00P0 3PP 01 R X0 P!`P 0 RP0@T 0@ 0S P000000@TxX0 t`P0T L0 P00P0@Tv 0S00S8Od`TkTkNdp: -PL% `0@#10#T`p7 p@T 0 R0@ /X0P 0P 00Sp`0WV`\00C\0i4*PP\0`0\0 PP\0p0\0 -LMP0 |bP< 8 \0SK.@P 0 R eX0 0@g㲟 pR000 TP @|UT 00CS 0|HKh 0 BNd:: 0- L@P |hP PT0S0T0T@0h0 -LMhQ0pS@|b ?R70S2`| CPP, ` kTP@XT@(0( @0T0G0S0 00P儠L0X  00 0 K @P @0 R ǝX0 0@Ld8OdNd; -L4MP@pT1;@@ @0 %`P L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 W mP L0k @Tp\ pDp @TN 0 R0X0P 0⡞P 0@p < KL L0 84 Q*<00^*r `200`RP0 H2% 30%`  ` 82QR:R40 @ R 4 <K0 H $LH!00D0S `00 80S `0#10#0W0S@ ᯟ(K\0@0\00\!@3P\00C\0 @Pp 01 Rl X0 0@`80,` S L0 , K@P 0 R ֜,X0 0E,P L0`>8@,0<@,-,`68<4 8<4 0D0 cl,d w1Ndd;; -$LM0ȠK DHpK,0 d`K℀  PK  x@K0  @H0KG K0Kd0K Kc Kh p P ` @ 8  0K?Q [ 80S04$0, 0R(K080i9 -$0L@T @T`Tk -,LM0pHKdK,0 `Kp 4 1 ȠK- D* x@KP0H KHKGPK0 KdKPKcPKhp ` 开 v 0 8P8 0K@Q  800C80T0$0ᥞ, 0R(Ki9 -LN1pQD1 R@ @T: `P@T V? $00S0U  RPU00S @TV7 U  P HP 1S@TV UbiK0 R  h0l P HP 1S``ӱU `V`LdLd`TkH;Nd; -0  LRP|b0 R)$0Sp! R 000  0 @T LP@TW_00CS0 |hZp 0 PLdLd`Tk8Od; - 0PL|r吜@ <`PL ATd $0 S A5  @T6 R0000 0p @T P@T P @ 0``000噝00  0``@Tᅝ1S 0 R0R(| P `LAe`00 R$0 R  `TkLdLdLd -LMP0P,0 |™<0K 0 @p<K h7 R 0Ɵ, 0R(K`V 6 R 6@P z@w0 0pz<0[S L6 R <Ke@ l;0[0S 0R0%P :Uz @KG P 0 4 d`K8( L8 u\K0L0K0 T$("(04"48#8H 4KD  <(4"4@%$LT0T @TI0$%#5$  %#3 000 0 4 8  <,$!$ , P`P% @ P 01@\:0SQE 44 R  <0,4@P $(:Q 0S \; 0 A9 e0 00T4 3 R2 <Kⷙe0 D( 0KP  0R0%P J*TPU3 R  ,2 R   @ 0<K@ @r0Sz St 0 S PK`j 0 K0KK`g x0[ 03x0K x0["# 00x0KlK0 $(, <4!4"<0 0 $(, <4!4"<| 0 PF y@0 $(, <4!4"\ U *(1 RT  0D"L Rh0 h0R@1*T:0PU> ~<@00S0 R  p0 R&  0@@Un 40 R ߘ 0\iLdNd,Gk;;l,d6Mb 0@S| 0L0 o90L0 n'QT 0SHK @G0[SQ /0L0 0@S2 R 0Sq 10L0 V 0L0  T+0L0 㜔2p p%PL l-@PL o ѕЏ᳏0 嗚T80L0 HK 0@K G0KHK  0\L r000g1 R 0SL0K,p 0pH0aP@ ~'J$坾0S 0S 0s S0S,50 ?Pr 0oaP0 v@0 P  00 PPL0S10L0  8= 0L0 i|8d;MdMdTk99;; -LMßPp, S0@0 3@0 `K3 07P `  zX Ks8, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@T| 800 0S 0Sb ,  0 pP700  Z0 (1"(1(`0241"4101 #0 !0p0@  0# #$#8`00 0HQ 40<ᚢ _ _ 0(  PH, l0 , 2(0H P e$0S(0S900 [ 0SW100 T儽HKH`K[0@K 媢P[@ ,KH0@ P 3S@ K n 1P@0K 0 f &iLVkԣj9@-@\   0 S  0 \T 0As0 -LWMP  ᪂0`0S0@+  @0S00f+cYU ,0K3pW0/Sp T(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` HP/00%Y0`, ,0 0@fP?p  1P 0p@0H0 0CtKLp l p0 t` D HP p,0K2p`|T\wT@ 0LKP 0 p 匠 HPP0`K 0iPP 0 aKiPP !p1R!l1RPLT`JTpu -LM  4 0 , 0 P  0$00 00S (K ŸK0iP0UX# R 1  Ӂp2  kPy0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  、0P 04K \K0K,0KyjPpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X P!|0 jb R ? 00 ` Q000LVk -L`p5 P@ P! P9 T00PU0S+ +4 P@%00P P P00W l`FpGW@ L @T0gG F`p(p@ @0; ";;;0tLVk@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@tLVk_ No@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ 3! !\8#8S    2  09P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0\("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq90@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 009Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@+2+20% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_1P1x1P11P1P1x1P1P1P1P1P1P1P1`1X1 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4R4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d \R@T*00(0S, 00000R00#3,05$ 02,0(00@c T: l l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,꠮9`99ެ9P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0] T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aQl0S 8!JG H800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n88 n8|88!if 0SC{[00hg00kI00+ n8[8R n8S8z J8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0\9ԯ9B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p\9 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00` l0\00 RtZ\ R80 b0L l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z99  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b03 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X99  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00fl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  #@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p \9 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_+2+2ԯ9 -LM@ 0 0=K$:0`ԯ9b c 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@hOd|OdOdG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10 R^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  99 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 099|999h9 -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >09@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q99|90 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ IT@D@00B@$: -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb⽻in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  ,9 q,=%  -LPxS2S2S2S2S2S2S2S2S2S2S2S2S2S2S2S2"  $(,04@DH;( (0 -L0 hh \2Pd -h0L0S P q00P0S p3 p3LVkdYk -L@`PPT T pT *p00 p@P0T0P@iPP,; 0- <LM00CP@ S V2U2U2U2U2U2V2V2V2U2U24冺1??3 0 008 >0  0   00#2+!  RV2V2W2V2 00 K0"880A10 00  Kr8 0A100 0L0 D;UU33 -3LMS`p3P:W) @P0@0PU (P `(KQ < @@ l, K00KwP , P UJ U 4$C@$;03$ 466cR 80  "82<8\!l\<  0 R00L @U[ U; T8H"<0S(2@0 :#::cR80 0@0 00 R !p10P1\ R 04 K04 1hxp,0d1 R PpD!,P01\ P,1R' ,4 K,4 h00@0 R p 0P0\ P0R 04 K04 hplp` ,PL0\ L0R ,4 K(v,4 0h ;,;dYkX;DUk\Yk}2 p-L`p P 0 RxL l3 =g`@P000#  00C0shL 3h|;TkPd 0-PSL@2~s 00H00H00 R-L@0 R-L@/ R-L@/ -L M4  @,  R uRu B,  tR RQY10P 40@0C`s0 40 * U( @  x  `  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP p XP L1T,P @ 4 Tk@;\; ";x;#;:;;8;;,; -QLM@|hlpihf`bP]$@XH4,RD hN;;T;; ;H ;p ; ; Q-L  H: p-LM0PK  % @`P  0fx`2 0- L@P 0h ";D`2^ -0Lp3 0-@PL> `S  `0$$ L000# $00 ;D9 ; ; ; -L,M` ʟPQ 0S @0S @Q9% (K @2S' %.9!  p@A0D0S, +4 3D 4 P0 D9L <)09 < 9 )TH 8 0 @ x #0DWS񟗤j2e2e2e2e2e2e2e2e2e2e2e2e2e2e2d2e2e2e2e2e2e2e2e2e2e2e2e2e2e2e2i2e2i2e2\j2e2e2e2e2e2Dj2e2e2e20j2d2j2j2e2e2e2e2j2i2e2e2e2e2e2e2e20i2 i2h2h2Lh24h2h2h2e2e2g2g2g2g2f2f2e2e2f2f2e2,e2e2|f20f2e2 P0spA0A0S Q ,Q, 2 8@TJ%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%{ u%odj`@pT 04 Z DW p@T w04p@TC ?%90!1 H*%t$%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   db^LHYgU\THy<%(as5e'D99 ;`T:9$9499<9 ;; ";< ; ; ;; ; ;;x:p ;f:\ ;D ;T ; ; ;; ; ; ; ; ;ȭ; ; ;@ ;/;::0 ;;, ;;tT:$ ;܎; ;Dr:4 ; /89 ;000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pL`@PL L_8P$1( <0D $00HL!0C00wwww -tt0 @ ,0L H0 Rhg, DH!匳0H1@0L!0*4  40L0C0$K4Vk iDVkDUk@Vkd_kdYkt8qdIdx ;QdQdQd0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L dUkUkDUkMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ 7,P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K  0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , Kr p 8("(8Q, "*46*, (00S 0p dYk  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . Id -LW ; ->0^0PL@,`P) 0Y`p@00T*U 0U  0 J0SjZE Z px IddYk ; -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V ) K\3k00$0(000F -Lp@@`  ,PFP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q؞22ğ223p(KfJH80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt 0Fc0 0 @, 0 : igDUk;;;`;T9<; -LM@dPQ $3\ b  S] 2"S0"pXUp1EOp1@8 Jp1 8E2XRR0S Z$ t"10@T ``"$Km.P2 RJ D2D R ,, A0B%@Z$Kp1     0!!dp⺥PPLZ2 : Zp18lp1 0\T$KmߥH1 1R0 \a0@PLŠB%0P @`忥p1幥c嶥`峥]尥嬥 $Km覥Ap9;Wk:;d;; ";UkUk9;8UkUkUk9Uk;;;t;;,;H;;UkUk; ;;X;<;@;t; 0-<@L`40P 0h1ld!0hLVkDUk-0 .!  !!-0 .!  !!LVkLVkDUkQd@UkpYkHYk@@-``60`t`6 !!@@- 1 xpxp`L! 0 p?`L0 !@Ј! P :PP/ U  Q U  - Tp!W R \!P Zt x U W( Q U0  !@Й! p? pG!@- ?U !iDЍ,h៥Reset vector called, LR = 0x%08x-DMO- @0lP @!1 ! ,O&iDЍN  0O   ! -- -i 0+ 0!0 00@S8hPpP\ L0R  K< hp80Yk\YkDUk}2dYkXk p-LM0!>00P @+.  0;>00 0+. R| 00Pxl`pP\ P0R  K@ hp 00Px\YkRdDUk}2dYk0Xk@-X0@P R 0S \ RXk@-X0@P R 0S \ RXk0 0@-0 0  L@0@ 0A0 A0P0P 0 0 0 0 0 @0 0 P0?00?l0 00Yk Xk$YkYk4YkXkPYkXk(YkDYkYk 3,YkL28YkXkYk0>0S00 m <>D 0+ 00)@ 02@ @RsDD JZQ D0 @46ZS#PP @ ): RxP 8#8ZS#;4D )6?> 1@pPU@" WU>0002 R apP\ 1R , K~, hPpU@DJȌZD 0(K 8)6 D;#;  1 0!@QD0:JD0 QpP\ 0R , KB, hptPpP\ 0R , K+, hp\0\ 0 <0 P04 080 7 <ۜ 4؜0֜YkXk$Yk\YkDUk}2dYkXk :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D  D 00)G#&R:0R: 0a"!B10b @PP 0T0UD  D 00 0L1 R <1p01P1\ 1R , K, 0h0p 0j0$  0S@ 0 R0(|0h0p\0PH0\ `@0R , K0, hp\3k\YkDUk}2dYkP-0 R0P  0S 0S  R00L00 08   0 0000hdYkh -LM@PP @ p4Q 0 pR Q 0\` @R^\fT P^ @<4\ @TV \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S |3 R `3Q \3 R 0RD3p83P$3\ `3R , K, hp@T22U  \ R W TK*PI @ `B ^ d2W^;``(*(":1 `0"\3 2C 0S0* !" 0L0 0SS  0S 181 R 1Q* 1 R& 0R# @T :#5 PLd Ubh 0S 51Lp0SZ 08V`p P\ 0R , KS , hp0S t0( 0S 0S1 L0(-80Hp0XpdYk\YkHYkDUk}20Yk -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  ix 0-0LS@P 0SP2000T( 00S 0 T 00 R 0S 0S  R00p00 0\   0 0 00P$00DUkdYkLVk0hh - 0LS@ 0T0000DUk -L0S< (#&R:0R*0a"!B10b< R8 D0< 7\ 0  \ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@kV 6 Z0 0 4 R000$ $004S VV 6 RR 0RO 008 00S <Q %Ry5S<SH0SkL R0R01&0ATd 5V2  <<<D0`00D08V  @ @D0`00D0W@d <D0^ @[008 Hu00S_,5 Z 0 *:$  0S@ 0S tpP\ 4R , K, hp}<0L < 5< D0`L R225S&&4< 0S 7 0S4  3L,0SW 38RCp8P\ 3R 8, Kl8, hp  @ P@hH70S- (3((W0P00 0P V 2 Z20 0 \ P @ @p%R55SSH0SL L R0R01H"0ATD0`0óD0D0` "Vb  @ @D0`00D0 P`40 0S\  0S ^ 1Li<<D0`0D0%@ 2@Pp P I 0!V    <0< @? 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ l0HK 0S H0X 00H0o Yk\3kdYk0Yk`98UkHYk\YkDUk}2\;Xh; 0-LM\˄P0 04PT@980q,0 0t8蠨h8UkT_k P-LPF 10`S 0Aq@pT P 0S ` U  \`PV \ 0S- 0S0S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0PLVkdYkDUk -LM0DQ8@8p@y K@(@0S1[ a A Q88)z`pP张\0 S ( K( hx@p0[ Q pP\0 S ( K<( hpYk\YkTYkDUkhh}2dYk -L M4 @PU 0L04 P0H04" R 0 2000 00  12C 0S0`= 40C4 : #%4p0C40 01 R 1T( 1 R$ 0R!  0@\巂TP0 Y@0 T 1T,*(":10"P` p0P0\ 0R , K+, hp4 Y@@ 0S 0 0S \040 @H0(K0 0S $0$0 @LVkdYk\YkHYkXhDUk}2 -LM< @ D 0@@0 TD n @ @0 08 0 40 8 * `(p":1 0\"X 2C 0S0O :#50QP `F @ P "`0 0P2ZH  < <L0H 0C L0H 4 R 0`00Sc 0S|  0S 42HPU 2P R)0S?  0SA@T(K 0S_ H@P 1Z < <5%0C 5%`Qp P\ H1R , K(S , hp0S0S 0(08 0S  0S 0LP 0S 40S l0H 0S H0XP 0S $0X0P0YkdYkDUk\Yk}2 -D0L0 -D0L0AQl3d3h3d3l3d3h3? -L M0D S:(K 80D@ Q጖K#:8#*at@80 TH 8 Par0f0 R 0f0p,6@T) @T$ 0$"*>!00PQ pP\5\, Ke , hp@T0D6Q0D4@9D5p:#:S,050%$PQ,Kt Pw '*(":10"P 2C 0S0 ,00*"%0㘤0@Q*x4P :*#:"*S3*X4X$$@Q  0 P< 8000 %*(":10"P 2C 0S0 000*"%0㤣0@Q*ŧt#0@Pp?t30 P<0 VP3X#$Q,K P p8 0R P 8, <,!*(":102\"w 2C 0S0n < :#5x 0Q40 c<*y0S p<P\ (2R <, K<,*hp  8 21C <0f!0001 0+ !;0 0 P 80,0 0K PMppP\ 1 QR 0 Ke0 hpp4P\ 0R 40 KK40 |0hpp)pP\ L08R , K(0, hp YkDUkdYkh\Yk}2Ȫhj0Ykh$Ykh0 )Р)0 ) ) 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0Hd$RdRdqdRdbk^k -3LM , 3cD#\0s C0S xC0S ( ("$P兇L30p82 FP@ n 0Sk @Prt OK2~Ϡ K,2 ( <Po00 @pP_"0S? 0" <P!,0SN(K<"0 <" L!0<"0 S00S0GS`!3T!3H!3 3 3 3 3 3 3 3dYkQdl; -LM00 ( H >~p@g00^0L PU@`H@ $@K,0  T$ 40>ZUzjc KQddYkx; -`1LM0800 0(0K CpP (KK2pP@0(4 P 4 Kp0p , 0 "pP0@@ 0_  Kp0 pP0 00GH2 0-LM  $ (0 L!\ + 0.Lh 0L!.@ L1:40   4PL1L@E@0L!L Q$Q( 0800` E`0(0004 K00LVk42QdA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5w`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xh Rdp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4SHpd40 $ R ((0"4SHpd 0Hpd( (P08#808#80$0$$ $P08#8 d@d 0Q 00 -0L 0+R 0  h蚋l0lP \0 RPg PD0D @80 UkAihiqd;qd <3 <9:; - LM0S @00ΞP@@ ǞPx@pp0 8`"gPh<属P, @qdqd;@; @qdqd\td;p@ Pp-L 2R 2 pB00b 00l"S S00S@P P0S S00SQ000 S0 S BP]ZP0-S SpQ @00ACSC@3@3@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3@3P@3@3@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3P@3|@30Q00@@ T T0 H @0 8 ,0 DSBOhi_k|qdxqd;;;;qd;; -LMP )-?)m0?`S P  A 0~0S @   00FS0S| 4t p9 h9+R`9`)X9*  /L)L9 d4494)(ɟ000  ~Y ~3 I@ȟȟ bx @``m~k~Ĩ a,Ơ  0`~P`Xpp8 @T:00C)0.0P0c1*U,0 I@9#9S @0^: 8BAD@L*0 1P0b*U0`X I$ITǟ0 C\lW:00C *0<0 C\@g:0 0C087*ݜ$ǟ 0B1\0a0:0 0C06*ƜƟ0Ɵ 1B0a\0:0 0C06*㮜pƟH00Ɵ 1BL0a\0h:0 0C0(6*㖜Ɵ0ş 1B0a\0P:0 0C05*~ş0 10b0}%}t5}hşx} 0 C^):P5L*W0s}$UA E2T PT?C ET P4@W}D0T@ ğ^N@P`@&0@@a  0e@XX3} :@N :@F :@> :@6, 9@/\C{o  @P: $T@ l3 0 ?? 0S  p   : 0S l"0>0>02 a<2"&   0||+ !1$ D2@"L8|(|!1|!1 1!1 | ~|<! 0 1q|,15#1( 0 00E\1 @0 (K<;}89},5}@qd;DUkUkAiP_k` p@(hrdhM3\td0;bkP;_kbkh_k qd`_kt;;l_k;`kT_k|_k_kbk4Vkp_k4 ;T ;t ; ;d_k ;`k$bk Yk ;<?^k  ;8UkQdUUUU!;8!; iDVkd!;x!;!;02Qd2Qd2Qd!;!;!;dYkhi ;;; Z-0  0L @R$  @Zw40  "! U {|1mt{p{X{D1@lH{A *B? S WkQd4,d!;[!;";$";4"; -LM@T^`PƆ ?p 0p 04@0@e@rdDUk000   p-0@`L P`@ph30@- @$T P@  @ 00 0 00bS- 0 $400`S - L  @$B (0  -0L00p p-LM@P0U` U U x1 ox0 03R0S48 L#ȠRPQ38Q3PQ3PQ3P3 MP pP) @P <1Q Q 0RS 0R S ? 0 z0 z 0 z 0 z x@0@0 zP0 c0\ z 0L z 08 z꠫h99x";";P";";";";#; #;D#;,#; -LM80,$ Q0 z\#;d#; p-00P@LqT0`  0 zp0D0S 3S@p 0z5{z20940386<5 0 \1PX!X hz70S9088;<: 01@᳙P&>Q @ᩙP phGz 0ph>z)t3p p-`LPH)@@@0)Tp -`pL@P PP a0P KPP  0-@PLP 0(P)0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 ( -@L(8 0C8#88 S (hvB 0-PL0@ 0(0S000 0@@0(0h} -@LhL p- P@`L(0S000 0@@0d(ph4 0-LM0@ PK00l0p0lP`(l0S H0 Cl0S>(p K09X30%; -L Mp0`$ K@$0 ;(  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 C8S'$ R P000 0 0$ RKY38%; -LM@'0S ,0 hC0S h'@%; -L,Mp00PK@` 0 pP KH@K$ 0$9Y3 0-Pt@Lm0hbk -LPpX  `n@P @C0 `P 0tpbk' -L4M0 8PK( @`p $KXK  0@p P @P    a,@Tf9Y3 -LpP`@P P 000 00P 00Cp0Pu -LPp`@P P 00 00P `p@0V01#Z 0 pzPM -LPp`o@P P 00 00P `GV010# 0 pSP& 0-PLM@P P D0U<0 0 0 P07P 00u' 0-2P LP+@P P 00000 0 P0P0 -LMP `pP0 @P P 8 0 0 0 pP' 0-LM@PP@ 0$ :Ɠ      $  @8 0-PL@P P 00$0 P0 P0' - L@P  th^L%;-  % -PLu@@zpp\`BlT W 0m  D Xck -PLpu@@x``Ll T V iD  Xck -LMp`H@PlP  `@P 0LKXck(i3 p-LM`P@@lP  P@ 0@LKpXcki3 -L Mx@T K\ 0Tx@@ n@n8 4 0@nKhm$hh%;bkp%;Xck -RL(M000 `  L0 \npP  PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040n>0"0H@Qt0@uL  R  npPm  PPe 42 0a0 p 0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P 9n 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  n@0s PH K `P`(KY0P`0P`mP`mP`m N9 -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0+PP7 04SP1Z00 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"BP0 SP R00 0S 0 480 00S 0 480@P9 N -LPp`P@P P 000$ 0"U0P  05P -LpP`,@P P 0000 P` %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |r08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040|%; -0LS@`LtPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 p700( R00 R 0(Pl0 00 0 000000C2Cp +lP 0 0  `P p` -0LSPpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@B Z (0Sx34y3x3x3x3Ty3 y30[0 R 06P k kP p 0 00[0$ 00b $0[ |p Y 0(}0[0 Y 0(u0[00[0 spPp; 0-Ld\P P1\ H1\00 0`Q" 0$ dP 0ă \ #\ @ 0S@ S Q PT $xh7iUP 9,rd -LM0R pO , 4 P`,  VP- 0`S0S͍8 P č4 P廍0 0  84000P 0R ,P ,(K Q-LCn ; -LM< 0p,0 @P= 8`P \ß\ ^`KD PK=@KL \  0P@n2 t n"20 nx@T ] 0SZ 0CS1d3T3t343P|20  P Xw܆333333333Ć3333̆3Ԇ333333333333333333mx 03 0SP U0S mx 0PS@ QQ 0A0_S3|mx P0@S0, 0RF(K>0@!08m0{n,yn0SPmx0P @Rmx mx {mx wmx ĠFD꼠B긠@괠>갠<ꬠ:ꨠ8ꤠ6ꠠ4꜠2꘠0ꔠ.?nFi;8;H;h;;x;;;;, ;;9p;0;\;";;;;; ;;;;;;;;;;;;;;9 Q-L@,m蜟; -LMp`P`&  PP` 0@00@0@L4| (0|`庠p000 0S P W`` (K0S 2W02 : g@P 3  <` : ᆋ:vgV W`2 |000 Q <0 @R yRz R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P JpPX 80S 2 7<1 -V 1J`2 `   ~X1 -B\`Rq0Sm$ , P 1!Y2:2A2<2  P 0S:fP 000   뼠 :fx lxP7 V50 Re❊P`< : ㉊P` XT3,rd990{33M3M3t:0@-@QP0 2T?\0S 0R00@ -QLp`@0P/2^,?\0S& 0R#@P 2`,G`P2 00 0SxP] `8S -PQL`0p$2U!2S 0S @ HP 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR -L M P`0pQP  P 2 L 0S@ 0S 9P@(K>0 !0QeP 0 0P)08 <041S,0  p @,0@S 0pS Z   e }e9,rd' p-0PL2`S@2@Sp0Q 0Qq0s q0sF r  r 0Z Q 0-LP@ᦦ0h/ 0-L@[P T,P T0pF0E0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0j03S0 @00hj040T$P Hixh4i00$PiQd,rdȀ; ";P3;؀;;0"200 0p0C0S0S 0@ <0= $$R 0A0 0 -L`Ppw@P P 0000P0 P0VB000%$00@0P0p YP, 0-LR@P P }>0GP0 0-PL@@P P  00}.A0 P0/P0 -LpP`&@P P P 00 00G0P0p`0000 P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -pL@` cPP p @P p  0 0_0C p P0  0#$ 0 pzW 4~c 0$ R p0u -L@` cPP p# @P p" 0 000 R0 P0  0#$ 0 npAW 0 $ BQ pH8c0u -pL@` jcPP p L@P p  0| 0_0C p P0  03 0 "4 01pW c+0u -L@` 5cPP p# @P p 0 0p00 R0 P0  !40 00pW00  b0u -@Lp cP @2 PP @) p$00 0` S$P3Ĝ3033333d33p33$3[ 0  00 ;0@T0#30b@@\0 @00 30 0  B∆0 @:0@iT00 [0 0030 0 + @TT d[0 0030 0 + i@<T L @\0 @00 30 0  B=0 @:0K@T0000[00 0""Ġ " 030 0 + +@Tr03 0 "#  0 #200b[0 0030 0 + @TO000K[00 \0#? 0@= [0 00 ;0@T-0#30 !  000  00\00    0 :0@ 0u -L@PT a`P e @P \ T0 0x10 R0 `0  !40 00mXDP@hpx0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT,a0u0Sp3t3x3|33p -Lp P`5@P P l 00 P `  C0W0000&4 0`P p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K `p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P`P0D@T ;J 0-0@0@PK@2L  0 0 S:;;S @0S 0@0@00cS -LMPp@`$@ `P   $0K `@@@@]P $Q 00  00  )` K -L MP $ 2pL@1T``P @+ (K $0K@@@ p*@P$ R@ 00$000$ 0S (0S T0 @_ K0 A@ N -L,M@`,@ p `PP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 Q@_(K@z_(0 @n_ N -L M@`,@ p_PP @( 0K ,0K@@@ pr@P,0S@ ,0 ,   ,0 0 R T0 @2_(K0 @ N -`LepP% d0( 008,d 0~40" P T ܃ 00 @փ00 '7<D +_@ P0 0bQ 00  0  1R0^^'88# '40$ 80 ie  ㋃00;4g:WEV3; 0-DL!88#P!XD@P 0 <( 40bS<0 000h?0Drd -LM  0u833 -LM) 0h833 p-0( LP,@l` Rt333333333(3 0S0C 00 <+0400 @0 $)a0H@kph5p0 0 00Cs 0 ph.<00 $)a0HC0<0ph":040$ <@ P4$0<@0 -LMp,0@L2K 0,0 +PB `(PD@$0c@B@ <0E@20  Pi1 0V* (  $$$Ġ% P@ V :;0 0 H000< 0 p0,lHH0 ! <0o2 46S0S V 000$$0P@0,P ot0u,3 p-DL!88#P!C`P 0@ 04000< ;00@ @ᛳ#V phr>0"040 Bp  >ph_>p@{Drd 8 8-#TL%`C@P 0@ D>0pG _CPU G2>.0" "2 9   2<2Drd Q- L Q 0 @00w0S A  - 88LM#DP$CC`P 0@ =p0 _GpP@0T X,@ @@S 2Tp 0, BpP202Q h0 @\PP 0P1S1S0h0h9 -L0M0P<0 ,0 00 40 80 pPE0EVP Pp`' @@K P 80K @@@PP @0S 0S 202" ` 0SYPp` OV@ 0 0S<0S< 0 S  S  S (KP000mVP Pp` S  S  SR0D#P<3 0 0 0P0@00 W00U ? V0 `0S<00S S_ 20"S 0 ,p00 ,W@ ~00 ,T 0 !!g p-P0`PL00@8 ,000T08 \ppdk - 0L 0<,pdk - 0L 0<,pdk -Lq@Sq S;; -X0LM@ 00<,P 0K0 $K S@ pdk; -40LM@K 0< 0\Kpdk p-0L@ Py0< 0`\00< ,T 00<0 \ph00< \pdk -L`P@000T3333TT/ T* .y9 00 #00    = 2X0@`PT T .q1   T; p-L M048PK4 ` x 0@0 , (` 1P 044 L p4 00 , (` 1P KpSS@3@t;; -L M4000 , 4 00K(0 @0$@  @@ 1K3 -1L!M4 080 0@0 P,0<000 P#w/Cb1L#`31C0!A}R?b1L#`31C0!AL`DxRx8 h0(US$SSpdk\sdrd0A@Mb;83ԅ;;0h,hN  0O   ! -- -i00~N01@pdɯPP > 0d 0T05*JWZ/ CZ,K00K 9P`0` 0L000S pP\t0 \X , hJpWZ (K IddYk\YkDUk}2(0 R 0RTh@0dkG-0M  "!@Qr 40R PQ R f R0Π` 00P 0 R 0>! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ XhXhtdkdkdk0 0tdkdkdk 0-H LP0S 0@  "!@0  "!0dk P-L 00 $ $P  P謆;4h; -P@LP`p+0  "!0 8R  @P 0` p400P Y 0@@ 0 < 0!!Q QQdXh;؆;  -0Ld0 SXr0@  "!@b@Rj 0!!0@  "!`0   ! 090!0Sf 0!!0@  "!C0  p! 000X!0SL 0!!0@  "!&0    000 0S2 0!!0@  "!  1  0  t 080\ 0S 0 !!sddkdktdkP 00(( 0000!Jdkdktdk -0L@  "!@0!!$ $0 1h,dkdktdk 0-< L0P@!!@0  "!0dk -<@L4 n( 8 0 tdk 0-@L@tOpp0@ ` @A10 P0@ 0  "!Th;dkXhXh -0L0@  "! RH 1000 0  0!!Xh -@L`GO0DS0 ! $40 0   !;dk - 1L 1`?ops+J쐟0Z1 0!!QU PP 0@  PU0!! ' ?opsZ 008 401oMdkdkXhXhtdkdk00 0 S ' -@LP  -@LP 0080 R  0 Rp0 0h@0h 0-L04@H 0\T0P T0@P  0 0-L04@H 0\X0P X0@P  0 P-L@ 04 0\00S  >Oh8;(0_P21H 0#R h(0_P21$ 0#I h(0_P21 0#F h P- L 004,0P Oh\; -$1pL ` 0_WRBA< 0 V (4444444O N` _WBA< u0  q o00_W `O f0` 0` h; -0 cX0_Pp21P@ CL0  _T21C h7h -40_P@2Lk 02h -0 `@TLY000_T21 CPN0 rP_T2C Ph -(1L`p@ 0R 8 R0 R-_T21I$ _T21 C0  _T2$R1Q CTP@ @040 $`_T21FR  0Rh -_QLM8 RY0 021H8Y``VM _YDY0 02QR 88D"0HRpE ?Y0 0,0 ,QW3 18 T0`040   40Q 0Up' 0 P` 0@  PU0,0WS ڊY0 02QH`(K8   L_Y , ꬇; -LP p@@}``y@@ P-L 0 $ $LL  FL謆;حh; -T1LM`P@ 00#!Q Ppp@PDPP@PX0hCPpTX0 p  ,!0P\+  1P`+ 04 0004 80P t&Bh 6l2pt"tbx0$ !|x B;P/!;;N6H; p-@$1$!@L`0 \00P5 `\10C A85@0 B< \0 0  0?1!58< @0 \08 C83A4 #:0 \p0x0 0-4P0@L8 , 08 \0h -@` Lp\P,;  ,@ \P,; D04S0D0D D @00H@0dk@-0QH0/ 0Q( 00S@@0Q 0Q0@0 0CQ@000d0Q<0 @ <0  @D0@0_W@EWDW@AW@ -@PL M`p @H^ WD @0/R 80 0@p0 < KQ -H0LS 40Rh 0-@L PR000 @ H0 BS@  $Q 80 8 R80 00h0H040# 0-,0P(0(L@S01 0( R  R d y@  D00 $ 0y 0/0 B 0C- .10,0 -3L,MP|3< 8``RPp XP Hx@@(K02,# R07<0 00  (B(\00B0R0 !A8 _000000,0 0  @0(p$08 , ,@P $Q , 8 R 0 RD @8$0 0  D ,04@P $^80 @D 0 P80$ @0,0@P, >4 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  ^D0'R0@QQddkp@:ĉ;xud -LM\  pPP ` ( `P B$04@80PP< 000 @`0`Qd -0L@P`!!(  BR @4@4?4?4?4?4?4?4s ,40 \(0\S0000 0, 000!.\08 \` ,0 \ 0!!tttp 0-PH0LS@ S 04g04 HP0 -PLp @`,,1 \JxKuLrMo0@0 S S:@@Da9T h0 \ ,; \8 , x0 -H0LS@ 4< 00H 04h-3 -LM@00p`".0PP  K0 ` px( PP40D H0``$0K00 D $h d0DMrddk\sd -LQM@XDp@( 0 `( (0 408 0`P 0P[PL$ X >dk\sd543܉;; - L  \0 S -X0LS 00S 88 #0 R 0S@00@0P @00@0udh0S 88 #0 R @00@0P@0 0 @0ud<< R0<0 0S00Q 0S P 0S  0\ 1s$0<80<  <udud -"L0Si0PUe 0S`jp|z` z@`l ` ` @` ` k k t yugqQ7D0 0LD0P ,L@0P ,L0pPP ,00LPP \L@P 0\LP 0\L@ 0P \D0L0D0P ,L0P ,LpPP ,0ud 0- L0S80PU4 L0P ,@@ @  @ @ IL0HIPPT G,@@@ @LL@KK J J @H0@0udA- R0 0@P8 R' R 0S&pb0L g ! 0S \$0P3l 1C  Q (0 P A0g010 31C0ud8wd 0 @fk 0- LRP@ @X<U<0S$ :S$ M<K<Q Q QA<><<<Q|7<Q Q d0<`0h-$10l 0S 0< #30 0R:l@TP nl0 X `lP @`1C`V @l0 Y  `0lP@K1C` V@0@,\ Vd@0Sl@T 0s @l@d Pl 0 0l00 l0l00l h0l$!l0h 0$1l@a0S^h@h@P`@@TL PE h0P0h!00 1P`U50S2hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ 0P6 d\ H0 H0X0l TH  l0X`d 0L , `P@@T 54 | tT@H\ 〨d@` VLgL  0SVH 000000@H 0 00H0 0H0 L 0S3H 0=0@00@H000 H 0<0 02H3L`  0Sh Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@w< DH,80S, FDPD< P DQ D RoYPS@MtH080@@:H DD<@P0@*H0DDD@@@L u 0SrH 0<0<0H 0;0H0;0H 0T0W PPM0S0S0SH00000@H 000 H000H 0000H00/d $P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qt00 0 0 0H00 R'4 P^@XD@OPI`C@=HD@L@1P+`%@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@zD* 9; -LM `)8QI 9L< )D )P1=@0(S@ U')0PS@)> 0 )XX  )0 Sꐙ44x4l4`44444ؙ4̙44T4< |)t)p  )`V.T)P) 0S780SNTQj$|)0lorux {@~    a)X`V 0  Y)0S S R)pO) 0S hI) 0S@PD\ 0<#0C 4:) 0PS@80S 0)80SPp<@D@Ÿ^0" T0C@)80pS PTQ )p)0  )0 x)0 h)0 X(0 H(0  8(0@ ((0} (0 z (0 w (0 t (0 q (T(X`VoXU? R6(K(-(*('($|(!t(l(d(\(T(L(D( <( 4(,(1 0@PX(U (Ko(<0S S((Ȍ;;4;; ";RD;p;;L;\;;Ў;4;x;;;; ;;;;;$;8;H;X;d;p;x;;;;;;;4;;;;;;;؍;ȍ;;;;(;;;ď;;܌; -LM0 4H`K4 8" 0 P @(KTK0 K` ;PH D0T p P L `0 \ 2  PhK7` S03h0 5* 84"PT00T  P(W` "R{T0K0K0 `;TT  0!"  `0  vPh 0 pP X0K0K0  0`\   0T  `0 \ UPh T NPd T GCPT AIPT ;SPTd0p00T0 "RU31(K0!R!TK !00K `; T00T P`0 T K00K `";TTK0K!;` T0@) Ph TT > PB T h 0Bd ShH4ܠ4ܠ44ܠ4ܠ4ܠ4ܠ4ܠ4ܠ4ܠ4ܠ4ܠ4,444ܠ44Pf|3@"!10@Q^T d00\$ H R$"R; UQ0U PP2QJ PH ,0S42 RSXX P X@T@T0X1V/0\!,0  YP d @P d ㈡00\ pP \ zX0X p \1P@01 U\! P1s@P DPDP DP%,p1=@0S@ W%0pS@%\ @P \ 70X0 X0 @0h@%10@p %Wl99wd;; ";; -LPp`@3 $@ T`Vp @3 $@T3 $PP0044 p-L,M$48`K @004 P 1%PKp$4 0K40 K0 ` 0PP84 4T48 #40 4T$4  400 $4 400$PP;t; -L,M@QP` $4@pK 400 P $@ K$4 $0K40(K0p 0P@ $@@$ 0 <$@T$4( @400 $4 400ꘐ;; 0-QLM@ Q Q 89P@Y(Q $$(T8$ 0$L F(y9 {8|9(@0Q90" 0- 4Ls@P PP 0$4 400$  400$$ 4000 p-@L`Q PU P 1S BCP 0$@T$ F? R 0S|0 R 0S0 RT p0 CP0 Rp99 -LMp P$$0@TS X@T 0S0 S #X@Tx#0 4(K0 0 S0k `400`Pĕ 8Å<Å ?00 P #$4 400*3 P B΅0@P |#l# A΅ 0@}@P <#$4  400 #WZC XZ Y* 0R WZ$@F? R 0St Q X P 1S kBPO  0R 0R 0  P6(2("3$2# "32#"30#48Õ< 0T83< $PPT 40CSC0$!($U0S # P0 $4 400y0 BP0 RT Q. KPu}0 R 0S".Kud0 3#0 3#0 3#83< $pP0 3#x0x 3#;;;D;(;`;|;9 x 0";;   H X"D""8" 0-LM`5Ps 0AS84@4L444@8Dh@Ql0lh588h4l@ll8 0Ah8h"8ht 0-`5Ls@P& l*PP"Pl5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R %AP UX `|d<}d -LMp `l%0PU0XPU- 00CS0  0SQ400 @P 0QU  8Ŗ<Lņ P 0 400XPU!0`5$K0͆  400@P+4PgoP} 0D5VΆ Pl 0S0d5 ͆VNX5 @ @xPd@D%! 0SX%Rd008C \1@@0C@D0C@̌0CR2 d ,0X 1@1 0R4 h 0X 0@cPP  0P P ,00 0| 40@\z'(;`;|;''p;'$L $;;;( <'; 0-@LP0!R 0S `>P 0 !R 0S V>P |0@TGD@T T \ 0 SQ 0SP00P09p9 -L*0 -0L  -@$0L $0 -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q D0 0  P0 08; p-0L`P00 ,@0 \phg; -L$0@P 0hx0h -L$0@  0-LP@T  0[| 0t S0C1Q$ 00P0#S@T @ @~Ώ4;<@; -LM$0@PP `p``\PP 0幻P  0R  h i: ;4L;G -L M0tSp!@ d00 0P 0(K0S00 \QJ1"000`p2A@P0@@$(P@0à, < 0<K 8 4@ 0P >; L0 0704 X(`FZtT:;x;d;;p4d}dx444 0- PL$0$00. $0$0  $0  $0|@l0T $0P@} 0$0$  N' -LM@P`p <0 ` p0@@ 0 0-P@L ; 00000 PUkAi  -40LS 0 -80LS 0 0-L<@@T0 \400 D0H 0X0< <0 < @0ꘙ;<; p-LP@$`T 0T@Tʢ?T QV LpNpQ T Ep&+Lș; p-@LP0Up U}L0S $ (@08#8$ Xihܚ; -L0 @P` pT T  (l0U008#8 U08#8 Xi=U00 X;| p-0 `@PL (U 10#pU  (p(; -LM pR`@a R"w$0K*00PPj$0!$  0X$ <X$ 0X$ 0X$ 0X$ 0X$ 0X0$ X0S $ 0X$ 0X 0$X0 S0 0$0 0$ KB$ `0X$ 0X $(0X "@~d`;H;0l 0 d0R R P'0i 0\0 0 0C 000 0 0P_k` `4 -L@Q (脛; 0 40 08\00/ 4(4 -t0P L@@ 5004 , 004 ,@d p- 1L @P0`40\U zU, 5vU rU& U U pph[5fd04 d0\N004 \004 , pI5ph9d -t1LM h1+R ``VpWp@Pw, 8 4 0 0 5 |@ w s@ nTP 5840 ,(KorUkAi -2LM P `0 04p\0@4 1\5.004 \004 , 004 , 004 ,@$PK04 0\004 , 004 , 004 ,@T5zxv0 04\$0 ?B#1 0 $  0$0 $Kd -(1L R`P>U< 㔿0 04p\0@4 0\5;9*004 \004 , 004 , 004 ,@L@d; P-L P P 0:hhԛ; 0-t0L @<04 L0\0P 04\00500hd Q-L -LHM044@ 0P hhrdpA; ";D0  0S S S 0 S<d 0-0L  0S%P0  ^ ^0 PS n @B21n@WP0(0e/"b0 0<dQ0 0`<dQ - L0S0@T L0 T,T 88S 0Y 8h8L#8~4T6 \ud@B -@Lpn`P@屿PUPV0P0 h -sLp3 -@LU^h -0LS@ PPP0lRPep0P 0P<: Q-LA  -LM@31C04`Kq@$PK4 T T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -LP Z 0`S @@\`V`pW@@T Z1 dP R G`V`pW@@T㐠圀ZF@V#0S9 0吠S0p圀0W P0Ӡ0P00 o迾2P@P 0S Z  댺00Ӻ0 S0S@@W QZ00F<0h40Baft9:PA-tr MP`U`2\2PODl28Ÿ1C 0P ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00wdhVUUUxfk1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PLoP kP@0dP0h: -L@Pp`RP NPTU@ p-L`p PPPUp     @ T 0 dY 0PPPap: -LMPPPK 㤺@ P+Hʽ101(pKa.` -ԻV3T0\ `S( $  `X( $0@@*( $0T``0\ (pK~`H嗽 00!00 cCa0 ᠻV d0SlhQ tpp@W (0| 0``$0 0d( dۅ$ <00S ``V<QMbd\fk 0-LP$@p0he Q-L@ Q L0S 0P00H80 ㋽L0S  ヽH(H 0P0 -@L0m0P0L0 0-LMLP@U K00\ ^HP 0P0T L0  0H 5 0-LM P@0dڿ_տZпU˿D0D0 P h 0>)K$ 0XK05|9 ";@d<5R 0S p 0P p0 P p-L M8`K@P  )T080K@ 002K2K0 K1 K\0,,0 3P DM 2[2[   D Kp? 0u(;p;P; p-L M,!@0PSKp8`K (43@  U002K2K0K1K8 KX0,,0 P @ 2[2[    0u;;; -L`,P P@ P P 0pW MP ,((( 6HP)@00;00000Evv,!00;6 ; -Le h(<(00谇>((< g0@ 0@ R<T 4 0 >8#808#8>@ >8#808#8>00  >8#8 08#8><001H $q!,PPP 4s5mS/qh; -,!L80Pd(qV }0 @)0kh踷 0-01LS@ڼP01 0C01L#Y01SP0 -LCM⤁1 (a$ @0!0P$1KR5 5 5 5 5 5>@L3SD.<00 @)a0`W01001$ 0R: K Q  IOK,  3 4 44 @4@@ 2k/@H_8C8#808#8>@ >8#808#8>400( ^01<$q,P P 1ST*5*5*5*5*5S , 0R7(Kqok41 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK , <xftdh``]XZH00diddd;(;;; ";l;;P;98 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PKᆸ0 8#808#800 0 B4 p8ph p-0L @` P 0(0f08#808#80 8 phtKc -L$M# 200l1 0(K@,0 PLŸR00 y00! (Ÿ0 >00 c 90008 < 00i10 > 600F 3@C 8^@4@ 0  @M@Sd@ ,0ŶP 00 00! (\ 40S 0  0<8@00i10 0 >@0400:@e33 0004 \XPH}<,(ȯ95Р;; ;;ܠ;;;;Ġ;; -LMp 200l>@ TP 04 @`=Up20 MP( 00  G0@6 0T R P0000r P 0 q000tU@ 0@[0@000]$KP 0  00 00B000G000>0$ IP` 0 0@  0@$ 000$ bQڰ08\{P000  0 @ȯD;;p;ȡ;(;T; 0- L0P@K0h ȯ p-PL@8`дP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40决0pp<595 ,5 -LMP \`Qp @p @T V4 0`D @HT(  >dd;`T:;; - 0L00S@ 00S00 00S<0 0  -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 K"P3[8#8 K -L M@pK0@ `0  @ 09 K!@0K080K4  PP 0l3K0P ,` P@  K ^0@0K18 K40 9 K3[8#8}  09 S" 6 04"40(Q(A 04"40Q. 04"40Pk3(( SS` 'NEFX -L∪ 0 h ;Qd 0-LMP@T |)Zvd0d`0a78L 0K8P@$0$d;<`fkQТ;|qdآ; -LM$@K0P(0$pR0DP `P@ V 00;00KN0  $K(P(Tx0 @0@,((P0 009000; S l0p20X <@8oS0 , K`P@p@l0, 20, @ TX$1d  Q10<P 00p0Sl -`0LM R L0 K0S <0S 0$0  K0fkfkfk 0-X0L P0R@P 00$0S4$00S 0fkfkfk0 `dfk0  `dfkHI5 -`0LM\ L0L Q <0S 04 00fkHVk`d Q-L -Lp\ Q  0Q  A b00@T 04 -LM 0@4`0pvP v <0K00K80( K,0K 0$0+ , @((@ , 00S0004 K   P4` 8` 0p@vP v` <0$K0(@,(@,   p-0`@0PLR :U:0@U0*p -LMP 08  @H@bv@`4@ 004 X SP0 @4`0p\vPJv 00KP 80S Y I (K4 R#: -L M@0*v`4 004 X S#H@0 @4`0p#vPv 00KP YI (K -LM0` Pu@E@0@`8@ 4p0u@u 00K00[140 00[!408XR0 @4`0puPu 00KP YI (K9 -LM0` @u0`8 4p0uPu 00K00[140 00[!408XR!H0 @4`0puP|u 00KP YI (K9 -LM0`@4p0luPZu 00KP (K0 0[PX 4`0pQu@ ?u 00KP00[!X9 -,0L0@,0 0Q ? 00 p-,0LP @$0T$: `V@* ~,0$ p 00Q@$0T:( R*Q Ch$0@0`V//` FY,0ph S(J( @$0  \P(@ `V  2 DHP @` `V  B   B   -,0L`@# p$0W5:  0R0@tPt0D0"U G:0 ,0,i 00Qp$0W:( R*Q C$0p00@`tP\tU0 :,0 S((p$0  C B -,0L@ =,00,0 -,0L0,0 @,00,0 0-,0L@=$ P* 0\Q0 S):,0 P0,0 : Pe0 00$ P* P: @W000 BP000 I0 00 P:$0L 0R $0PR0000 0$0,0$0 P,0*$0L 0$00L$  -,0L @ @hf,0t,0 -0p@PL`ss0@ESOñzs0 CR±A!W ,0{,00,0mmn -P, 0L@`p ^Ls0 0  $ B 00 ( ,00q0,0 , -LM,0@:@ @@0P4p0s` s ,0KP ,0 S  @ A @  `00 $( ],0F00,0$K ,0 - L2@02,0  00  $ ( QP,0,00,0&00,0,0 -LM< 4 0X< 0I#0S@0 8 B4Q7:@ Y4* 0 @4`0prPr 00KP00  00< S8 0 @ nr@DP08 80  4Q8 * 0  (K -,0L@0,0!0 Pc`Sbc\02$05$0%,05 % @  h",0@  ,0 Q$!Q Q Q  b -,0L@h2S02 -2"10 @Q"L< 0 -L M\ @T ,40#"B0Q ^ڈ0Q P @ 0@@K,88 #4 ,88 #$RR*d\d5`5 Q-L; p-`@PLD UD( 10< 0 ph ;0;4; -80pL`PBV 0"T@1\Q Q  ΕPP Bi(~㌕ ὕPP @P; -@Lȥt0  0t0 -0L"b PU P (p@l020@T$1d Q-0L@ Q Q /"/000bSb5b5b5b5RR hhhLhHhDh@ Qp-LP@8 Q# Q `p00 R` U2<0^2R 0 `, ?0 00 $ ( p02_X 0(>"`P00R00Sp2 0`2"pt; 0-0LQP  00A QS@@Q 0ASpP Q  f0pP f00 Y0 0AS00hXW q-LP# Q1`<@T p0Sp 00 00 <pQ 0p0 0pȤ@pPp @ 0p pP00R00Sꌣ;; 0-00L 0@S 4㡤 PR000r0300hܥt+ 0 -0L0@ 00 R Q0S00t0Q0 00pP0S 0- 0U1 0@0 00@@003Ud 0U0Sz 0  0BS0S 4 00@D3U <3U` 4 00@x00s030o60@@00S>@P 2 2Q"#  0@$ @PO h2 `2Q" 0@ @?Q00 0S-@7 4 00s030d`&tm@!800Q080 I80@1  80 008 0 80  0$0+P ' (@0@@Pl0@Hl0@000BR0 00 0,  0$ R0S1 t 00,VW^WQW PW—\` 0 0  ` 1CQX 1Q00 R 0S($ T s 83<`PF8004 `P=@ N0Q 0Q iji`0SàL @` iz0`Pw rn`WUW$NW \P =D+QА5А5А5А5А5А5А5А5А5А5А5А5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(5(555|5|5|5H5H5H5555l 9&l : |0S T1 R000l0 0 \PA l0 0 \P6 0T0  T00>0T0  T0010T0  T00$ , /d*'$ -LMQ0 p` P= UK R60R30   Q@  0K0@0; S V \P\ 0l@L00Ta@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00@0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P A 40 9PUV ;~a `=0SL00 RLPSBl0V ;_  0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 Kphhdh hPH 0P 0Q `0SX0S  ᄀd -00 0LS@ \ @ h -|0LS@PQ \`V p\`Vp 0U\0pP\P\`U   d;|; Q-L蘥;-00 Ƞ Ƞ,1XP 䄀d -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0t0  0pP K3\ 3\ 3\ t3\@< S0< S< 0S@lP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\0P       00  0P0 0       0 00t 00pP!0p  5PPB 㫆q0P0m 0R 1  6P`ɌPP8Z0P     00 M   0P0  Bt0 0㢌PP{ 2  Pcl l0(K 0 (0 $@ PP3 W W WW @W W@WWW@ W @dW WWd -LM\ 0\ 0\ XP, 0 P0\ 0p XQ 00S00XP 0 r 04 Q}f~fvt|f 0-LMP@@0@0CS08v8@- @.@ꄀd -h0L Ƞ Ƞ,A0S 040000CS0Mꄀd 0-0 (("ALXPU 0 X0 E`0S 0 0 PP ꄀd; - (L(" PP#0AT PP 0SP `0SX`VP 4p0H0PP X`Pꄀd p-X@LT` 0 ! PaU  2`׵P0S0Sp0 php, ph.00ṱ0S ȥ; p-0LS@P`70S$ U  l}PP\P l0!R \l QpPph1\P  UQ 0P`0ph00⯼ 0-@L& PR 0S \P lQ0hZ ` p-`0LSP0SD|0S\1  X@T% 0S" 0`0CS0000 R00f0S40S+0 31C ֱP0Q&ڬ 0 S00 S P0 RUp008P0 㜜00h<;Dpd\d 5;(0 -@@@@L0@ hh p-@@L `P$ $$P`0 p h\555h -1` 00| 0P SpLpW=`W0S7 L1l0D 4l0 P lp 0 t0 0 Bx 0 KP7l0 0@00 R*WP h $l00 lT0TP \Q 4,Ȁd; h5dd ";4;h ;<; ;0Q 0`c  <8S@08#<@8oS: S>; SP 00S9 -L@Q |5555X5000000<000000000000000000 -<00000@ L  pW`V 0S \ R P0 U*\ XZ 0@0 |0t@0|0 < 0D 00080 H 000040 0L x@00P@0 S, p 0S P/",000b, S 00`U pŌ`<0pPS0@ 0S P/",000b, S 00  pU0 p 3U1 =t3UM 0Ug 0CU X0S\0S+ p@pZZ p,000 0 d@PpZW 2UF0x02U 2UXP; 0 P (Kt2U /0CU0S Sf S#(Ko XQ 00S00pP dP 00 R 0RL1U 1Up\@@ T 00@  00d\@XPU /",000bS` 0RXP 0 r 04 Q(Ko   ^@@3@l0S0S)o(Ko0 œ00aWbWvt}fW`WcW@- @.@Ld  - L@pPP 0S `0SX`V 4@0H0.P0Pd 0-PPL 0S P0Q@ P  P0 000Pd- $   (00 $ ,0%AQ"5555555555555555555555555555@550 10p 80 108p 80 108p 0 108p 0 108p 5Q0 10p 80800S \0  0800\- *00 S0 0Ô0$\  89\0 S 10   0 B 8 ;\0 008tQ0S0C 0  080 p-LM3A@Q55555,5 d(<0aS<00<0080x0S ` \P 0P0\ 00S0C0@00 E0P 0 P0\ 00`S0d(0$0`0S d RF PE P 0P0U 0<*0S0C00$0#0 P `0S dP 0PS3J0`C 0PU0 0`F(J0S0C00$0 0 P (y (u0S0C07 0`$ 0 0 (d d 0S P 0P0U 0*0S0C0D0$ 0 0PO $0`  (<00CQd(08D $ 0n P 4 ]@-R@(Y \V <0P p`W \ \9 \1 0 S d02P# :X0`0CV*^ \ 0L0S\Q d 032 C\ * 0S0S\: P@ 0L0S 0d 32PC"* 0L0S-X0T $0nQ 0 R$ 5` R $0 R0d0 0( 0CR0d0( -LM<@!0 !S`pP␀O B0Sh01100 p0p0 Sa`!d(0S0C00WP00@0$.00Pd( 0 3>l S  0(0d( 03.lR 0S0C0 00 0ꐀl0P10p0<00<0}P<(< B.$0 >. Pd( 0-L!0L@S555555555555555H5H5H5H5H5H5H5H5H5H5555555P 0 S0 0Ô0VP P0 d (0812cS<00<000 S10   0 B 000\Q 0-L@80 8080 6Q-L@.A= 8 %A-L@5Q8(5555555555555550585@5H555555P5555X55855@555H555t555555|555555555 5  8  0 10p  -@\, `0L<0Y0CPD L0X8@ HPT  0S \0 Q0 t00 |l0 p xh  -LMP@`p00 pJ 4 $0 000 00PT0p0\0`0d00000(K000 0fk -LM 0A^Sx\5H5H55H5H5H5H5h5h5h5h5H5L5L5L5H5H5H5H5H5H5H5855H5H5H5H555H5H5H5H5H555H5H505H5H5H5H55l5P55H5H5H5H5H5H5H5H5H5H55H5858585H5H5H55H5H5H5H5H5H5H5H5H5H555H5H5H5H5H5H5H5H5H5H5H5H555p50(0 , ,p (d0:3iS<00<0W8\P ( 00p ( (pp (0l0p (0l0p (0l0p (0h0p (0h0, , pP, $p(p ( p (,0Ap0 ((0Ap0 (p<0p (0<0<0  0@ @ppؐ$0L P1 DHp@tPx`|0hl (s<0$ L<<0 x0H (|@P@DpPt`p 1h l0  @P` 0ؐQ<0p (0<0I@@( , <,p (@@:@@( , -,p ( -p (00&p (00$T00cS!` 0AR$0 0S (0 CYpp0d0(  (p0 (pd0,  Ap-@LQ5$5@555555@555555555555p580 S 4z( d>,0`S] PBQ *0S  0 SQ:(H( d>P 0  01! P`V0<0@"000U0p`B00 0^P( d03$ P| ( d03$ P0H0 0P0 Xd -QLM@ Q Q 0S0C00 00 0\0L0 00 0^0N0(0D d$0 < P D $ 0 P d( 0D3>b$>.P -LM@P`p 0@000 P! 0@@` 0@@` 0@ 00 000@p@` Q Q Q!R<00<0 ,R<0<00<0 0-AL@<)Q1|5$5$5$5$555$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$505$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$55!R  ,R  <0!R@P ,R@P U 0S0C0 00 0!R ,R!R ,R!R ,R@$ (0P 0-QLM@D Q3 Q `P9 $0 R5 0( 0CR0d0(80S0C0T $0 0aPCU 0S0C0e `P  $0 {`Q0A0+ 0`0P 0 0d08$ R Q0A0L 0 ^0N0* 0`P $ R O` J` D0P 8d( 0D3>b$>.P(0D d$0 < P D0P D0P -LQ@ Q \\0 0 C00\P A ^ :9Q0!000C^0/Q\\0 0 Cꤧ; -X PQPpp`gVL@0S0C0; 00 00S0C0) 0`0\ 0 VT uN`T ` R $0 R0d0 0( 0CR0d0(T D0P T 0P -@XPQPpp`gVL0S0C0= 00 00S0C0* 0`0\ 0 VT N`T O` R $0 R0d0 0( 0CR0d0(T D0P T 0P -L(M0 84  gQP( @ ;QJ 3;Q  ;Q ;Q ;Q JQ4 EPQ sKQ MQT`X@0$S 0 `fS0!aL\XT cX@T`( 0R$KnQ ;Q <Q rQ0S 0S0!R CRllQ<0 0 0X$0( TBQ CDQ- HQ<P T0RX 0CR00$0` R= $0 R9 (0 BS d (d0 03R R ! B0<0( cQ0 fQ XQ}0\S d(@, 0C0 00 0@Qs AQi $0TR a`R !0bP$0V 0SS 0( 0CR0d0Q(o9QI 8Q 8QE4 `lQ lhQ:0S@`5ژ! 0`S@K0S@`$0`S@@! P 9TX0 $0R0`` 0CR00Q$0 0S0d0"4 d 0 3>(R lR`1`! @ dR0S0C0 00 00Shd>$( D.P\H`PLPp? 0/S55\555T5L55D555555555555555<5545,55$5555555555555 5 5 5 5 5 5 5 50@Ss `pQ @K 0D@K@P~@0D Pp@0D H`L`(pC`C````````0S@`[ژ, 0`S@q@TM4 h7 cl`d 0 3>(R lR@1@! bQ0S0C0 00 00Sd >2.d$DE00CS5$555555555 5555555555554 4 4 <0($ T0$  c<`K0#p  P 1 #44H \Q Rz(0 0S 4\ R$ P! @\ @0S "\<`K20"@p  P 1 #4_ T0:4P V( d02 aS0 BS/0( S<0S0! c<( 7 E0S@`j0`S@, 5P  0d0t0 S0S0!0C$0RM Kh2>dD \ 01$ >.PZ`S>$0.> PJ>$0.> P>80, DL P0@H03iw$K?l?p$?h?p!c>J?u&;̧;;$;;;;;ا;;;,:;9 -0LSP`" Q"@0! 0@T2D 1C@p`@D 0! @00T99 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P Uph494:! <8SP$10;C  3=8S $10  >08S#10  < >8 S#10  030#0%2$` cD`0 V@P -LM@S A0 1 0P(#KD6 -L@\00 00C0 FghBg -LM@p `jgPP D @0 agP &g P  08@0 S00  0D@0 R  0 0 D@  S1,0S1PQ 000 p-`L PR 0S0S R g@ p  00@p00p舄d 0-@L0PS 0\ 0cS0 000 P -`L @vP 00CS(pX \00 T00 Z  4@$0T48 804@  S8D h@0S@4 m HBD$8DB@1c!<0HL $ 1T0$ X0$(0P @0\`0d0 <0 1c80@ a00 2 Pl#BdBB` c,2,"0(2 $"0 2 "02 "0Q0 0I(0F1 0 0A S 6|6|6|6 6|6|6|6|6|6|666 A@$8AD(0 |(pw (p  00!0 (1(!0 1 !0 < (0kw]30 0 \  `8P @< 004  b8@P \0 <" `|  (p p(pR<@66 6 6 66 68 66x6(6P666H6; -LM@PTp`0 S/ 0 0S2(0 , 0  P 002 `P(0 P@ $!(,048Aa` K  0V KW 0J P ʐ{,K K$ K(0KP 0P 1 H0H 0 @0@ 0 808 0 000 0 ԩ;;66 6666666@-A0Sm 1 00!#1  1""00#$48$0,0c80\DL 1  00 ! #1  0""00#$48$0,0c80\L 0 00| |#1  h0h""00#$48$0,0c80 \00蔕ddUUUU3333dd#@-A6<6G- M,P* X*`hT, $h 0 ^@8 #8( 08P 0c" 0X(p0`  @P* 8X#8 D  R0 ЍQ0@P:X @<4ȃ@? 100SQ0 @-! W(08P & 0c,A P0P0x0U  01x0   00x0  01x0  0 0 0L       T0L0W       0QP8(K4Z8Z080 0-L@ ;kP@|lo P 0h0H 88 #Q 01S 00="Rd p-<2LS 00pdBP `.m0S phm000 0@@0l -LP 0@R 01S 0 10<P  d 0-Lt 0@R01S 0 10<P  i PP  X70hgZ0dD 0R0!R00 10<P d Q-Ll; 0-0LS@0j0PS 0  兇0S0hkx; 0-0L@0tj0PS * R% 000 00S0 ᢆS 00S0 0hk R <0 R 0  0 gkgkgk 0-L@P0h 0-00 ="P0L80 S @0S 4 0 8L\ 0CQ 0dP f0 0d20 0 @IGdLhHh p-L@P-P pi0`   R h05 :R`0 0P0R H$ph'k80  @@0 gkgkHhgkLh0QD@2L p-QL@`" Q Q Pp00V= L0S XP 0S P@ X0P0PS@pph>008Pp 00 p-LM0@=2S @2+ `2S0 R8LwKp Kωl 0h 0`Q8 P`=iB0PEB mBT31C 0/L#b1 RbF 080T 0 @2 `2S 80 @20@2 0S0C0gkMb -LlMğ @.`0 =rW@ 3Q 3Qy 3QG 3Qb @(K3Q 1Q 0B~S1 0< RM L@Kl3\` `0 XpKTp 00lPK8008a PU 00 00K0 @0^!0 @ 0 K tp p0 , | xp s@X 0B~S1 0< R 2@0 4p q<` 8pK00L@K8008(1S@ 0B~S1 0<P ` J5@  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp eXT0PS0@A 0 80<#8 P@ 0Z Q T0Sl Kr@U}<ό@7 0B~S21 0< R 0@0 4p p<` 8pK00L@K8>0080S @ l Kgr@P0dUUUUU@L6M64M6 p-L"h`P@T @T' Q0000 0000;P 00S0B@TCi~V?i gP0  Lhgk; p-Lg`P@T @T' R0000 0 0000P 00S0@Ti?Vi gP(@T0  婄Hhgkgk; -HL@ @06VP0 000/VP kiW6|d;xdX6;;; -LM|r`PVh 0}/000DR00#`BD2DdT4`0 0=2$KTKV p0`S0 <20<20 @20@210@X0\P`pd`00 cd0d2SO 4 0@ P=@T0SO 008 R 0 @0 <20C<200="Rh~00`"R!000008$KmHTW0 @0 @```cU 00=r0S 00=r00T 800X=r$Kmַddd;; ";QdTR6gkgk;HhgkgkgkLhZ6X;;8;0S0="R00 00 0\40  40@-00 00D Ƞ00@,Ƞ  4@ 0D@ 0-L  Ƞ ,Ƞ000  P P@% 3D04P0D000@-DP @.P  4@ DP00@ @@0Q0-0R00\00^00L80 R2 1C -L00 00L0S0000L0S0S40"00- 04 P#*0 \*0S \0S P -0L 00 -Q  <2<200C<2<2 L<2S 00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^00 -L@T 04 - 0SL*@T 0S0P $倶| x괫;;; -@LP 00P e00;ڇd 0-@LP`e0H0 @H0P00@0@f0 p-PLIe`0 P(0  00P@@~fpD08 00D0< -D0L0@80 00 -P@L0(`Xe;J\0I 0\0 R0X0R \0 S08 40 L0 T XK 0P l@P \\e GJPX| \X0 AX0\0!m` d0XEgWe@Ta P@eIUgk66$; -L M`QP I0S@)pK$0[S I0@S wP K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpP K @2 P0 0@TT -LM4 @P0 `e xI`PPs ,0 00-0 X3,  0 P0? @./12 00 `Q 0XS _ 0S[  R00 !  0PP98pd@ 0pP5 2@[T0 1 00, K.@D 0p|P 2@DTP@D1P0@, K}7 0pcPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S  P?0@S@0?0ɪ80S? B4100 GPP0PP  ` P 0 1 0 <`P 0 0`"R 00d014 00PP ,@K  :P;; -LMB4( @\pT TD設; P-L 00 F:X#;Th -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMP`Q@Pp P(K!rJKI: ,K 0P,0`W`?0@CT  R JK 04("8  00X00S" ! 01 R101 01XQY QP@S G 0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[OH 0KhP!  -LCMXJOKP@D`K p0,P 0  !@姧@W@ p = p<0d 噧2@;E0:PD`d  Tdጧ%@ dPep ~@ d` 08 p, 0R(KiЭ;ح;;;;: - LPp F` ;W $@TCF| ႧQq XzqLvW ,F,mqfH:;;;@:@-  @ 0 4$(8XX"(#!\ R0S$0\ Q h:X :R R0l4 -00LT`V( 44 pW0P0@0 PR@ 0WPfE8PfE0PfEfE0 0T0 -00QLT X Zp`000 PU XP P @MX0@PpZ` -LMT p4 000 P 50 @0S0 0S ,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K A 0S 0@ 7  M K mP> jP 04  0 00  0`PP6 T0S  !0S00 0  ,  >0S00, x50 l /00 P)00 <#~00 ( 4;X;;|;;ȯ; -LLMh0`,0 P 0P,P: 0S=_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[P00T00SbPT00TTץ8PfDX 0PfDfD0T0, 0RR(K 4彥4f DP @f DP 0\ 2TH0S 00S 0S啥X KlPXGpP< 00S T傥0B 0Q1 0CĠ YKZ0K_q ~B<f WDP8 <X 40 `P Qy fDIq`00>0S Sf *DPa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P s0 h0 R0@0/T 00i;;68;;t; :6Ȱ;;; -@L 0S 0 S 0D0 0$0(0,0004080<0@0@-p`WP @U13*\0 0!`! T070C>1 g2S p-P`L@ C@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^ꐫ6686Ī66fp0S:0 $ (U **0DS;Ь6Ȭ66\6(6 0U T񟗾h6t6|66666ح6666$60 @0PU %p T;686p6666ج66Э66ȭ6pX0 0C\ X0 d 0t4 4S 0t4x4#ptX0 0X0\ Te  0t4 p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hBh @<pp@ p@lPh 3lPBBpl傣p8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h l0d 0 l0d 0,0h lhd0d@"tDl xDV;T;$;D;4; 0-PpLP d@ATp@0hA -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@GKh; -LM40@4 00 -LlMp4P^ `@ cS 0RKK K4@K004 0@{i : -LM`4Pp00 40pPP @40@ 0004 4 0PP@ -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 gQ Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  6UDUU@ 0-50L0@ 050l PBUlPPPVTPSLP -LLP8P &88PDP f@DP0 -LM50`0P@050l  Rl  @KHP f7@40D@PH@ 80@ @P@0P< @ Xq  4L0P@ 0PP 0PTL @8Df?50p050PlpP8pLp PpTP Tpl6 0-LM@P0K  T Td0DS Q020C0 !1*h0\ 50K08E  < ͠t; Q-L@ĠQ 萱;; -P8LPo\Pfk?d\ p p`@h0!R |h 01dp@\` Qp-L@ `pdQ `P h0!R {P00-P00Sdd` QPp p-LhM0 d0 @P`Kd0T@P7Kp -LBM P0004P`p  @ X 0S@00SX 0@SP~   00S|@ 0@S@0s 2Rx (K$ Kf0( YPk($\`< @P]P0D T02T,", @f >Phv 0Td@H0mCKp H0($ 3PpH0PHWH0PT08` H0 1<K!4P ~h0P180PW @0 $(P0 $(P0$ (P 岟 K孟婟0S S Sm0@$0 |$f >P( $ <z吟 p0  >`@0$0 0T0H0@}j0;;tT:D; ";H6<6;Ա;;d;dedX; - LP@ P 0S d0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< 4N00@wO00pP800 d d0d 0-@  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 0 Q000 0K P Q 4 @0R0 K*P|0-0|00w|00|0i}fpUAUvtnU~f( : 0-LM` @.Q@@v0@0CS08&8 d 0-0LS@D0PU 0 LvWP 00L P0 0-\0L Ƞ Ƞ,A0000P0CS000 d -LMp|0@`, p 4 @0@R@PK 0PP@ /WP, 0R6(KLPP0S0-| P |  i0PS&P |00|0 !NP R@0T0U0S T@#T@!PK P VPP $ w N#PPip;8 : 0-\0L Ƞ Ƞ,A0000P0CS00i0 d 0-D0 (("ALPPLf8<xP0 d 0- 88 #PL*0AT 0S P0PPP Df F<|0L0|0xP0 d 0-PP@L |0 lͫxP  0hR0|0hl⿫xP0 0-50L@0Q!ڌ 0 S00 S P0 0L0P0CS0PRhTMDpd\d6 p-0LM<00P00@4 K K|`0 /@0 )D0 #D 0H@ ԜKp06x;`1S`-T1S0T0 cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕꤲ; p-L?L`@P€ G 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !PA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ D1S BT\1S J`DP ]K0 \  ☴D@TMK(KK D_W - 1LSPp @`1 1S`@ !|b1S 2S a1S 2S h+_ hYhaq_ `Yhq 0-a1LS@P \PvPP^90X❚ 0 ;gk 0-DPLMXa@ $K 0$ P  y\K0@dT5 -@Lp`PP DnW30, Xb10Ya1P Eo:gk6 0 gkQ Q 0S 0-@LPsP h1l!PP @  P@T0': -`hl1pPQL @ ,P@T i|': 0l 0-LM00P@K4U Ip 8pFJ8 p-T2@SLPP`004T2S0L P2ph) 0-LMt3@SD0S8PKL P  0z8 -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ t3S` L`PU ph%p p-1LS@`P 3SL php 0-@LL50P0 Q-L@ Pt0t3 -02LM<00`00p4,K( KP(@0 ,@0( ,D0( ,{H0L06@,(0 $@ P@P h1 R8 \1R 0#Q@1LS 200"+ i K0 S #Q0At 1S 0 @aHP0$K,(x @P $0 X0X UUP03H03 \6S ";\':&:@dP':P66 -LM@K K? 0PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01P P1 0C110C1 ; -LM@P  K8#T0 0 @000 <Q P p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r`] Wr 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@40<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 00 <Q P -L M0`S@- 0BS*66X6660666  0K@ RY0S 0S00S S S 00 b0K\ٗT T 0R0 R D 0@@P  RTXpWd  00 b0T T00 =T1 " X屖T%  ,奖T[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0 DPH 0PP_ i[ N G @0Si d00 05@ 0@H:S 1S س;;@;h;;; p-LM0PS@E 0BS66l6666`6660S T00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@+ 0幕T\ @`840# <S  j i(h0$k0pp20W1 2pA - 0LS@  !P  P 0S00CSPPP  -p P0 0L40 8  !n@P 0X0 Y 0\0 ` 0S4N`P X0S 0S 03X05:S PS 0X0YP XQ Q #3Q0@S񟗒6666600CS86(6(66(66T#0L[T 0S P0S@ #0P=  X0S 0@S4P|  Z0P<  X0SQP> 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS76H6H666d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< ili躒X@Y@\@`@Y0PX0.B嬒iWi襒>0S=}`0T04> H0`P `;d; ;T;;;':|;t;;h;;;;;': -@L02 0 4JS00X0ĵX0ĥ -L@4!0S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPK'K04. -8LMȠ,Ƞ#83 l': -@L.A00hqB -@L$A0S00@eBS010(0RR00(0(00 (0S P( P0(0 0(0 -LM@Q` $pSJ66662 %㼠 㷰00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0S P( P0(0 (KoG`|0(00(Ko00 0 !0(00(0$6 ;<0S8<0 2 -LM@P4`0S3 pW00 0w0 0 ! T@  0 P0(Ko\0+ R  RW\:0(0(KoT@$ 0AP(K64; p-L!M` 4 0PS  0RKp0 "K@Knd PK1Q K1@K L4 幐0 H!x\jiT;T-: p-PL /@`@ @002408P40012` 902`p66td p-LM`2 <2PK0@!2 a00004  o00CS0x|xD3 p-LM`022 < ;PK@ 2600004  o00CS0xQxD3@-@0 , 00\#^? 0-@L/PY 30# 0 0-PLHP 3lS CT [0@T/X0 0-LM@TL 6>P  +K0LX ?P  L\ \? @PP v T̠`34/ PP`;; 7;@7 -2AML@`|3Pp0 ռS| 0|#C40x|3dO``  xP / 4徏HK303'6; p-@LPHPl3S 5  `0  BQr0Cp P0`FQ0S*DP I5 ;%55;5p 10R!!  10C1 -@PL HP Hhj p-L@HP/^ a>`Xl3S 3 30S 2 Sl#3Nfph?p0 -PLH`pn@P 8>8W;H8 WW" 0 0@0@ hW ib?0 0@0@ 徼 p2S0PiP?diض; p-LMP0 0@0@`X=0 K@xx 1S&'?Kp; -LH`PP 8@ U UUpp#R 00@`0@ 00@0@303EPU`h C 0喎s ; 0-x3P@SLtSS H6Px CP| 070 -@RLp` D ; 0 0P PfPPP_7; ㇼ1 S 7; 00,; -LM`HpP|P 8@ U UU(K303P(Ua ̠A`0L  @u 00KP 00  00S0 0@0@Cl 0뼣+KA )0[PU)PK00 0C00 0 00 0@00@<4  [7P tP  H  A^4>`20 0@0@@7\; 0-@PLS 47P 3S HXP eP 070 Q-LH -LM 0S  0 Ƞ8,Ƞ#8F P h-: -@ L-30CS3hE3  03- -L M@Hp`P K@0FH@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pK,P -L M`H@qpP K@0HND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@H`=PP Kp?0HF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PH`0K@P Kp?0HF!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b? (0hA~ V呌'|; 0-8P=@L8 XC ?3c`P 1P=`PB`SdP &PAdPF0d3hP PDhP0h3P 03P *03P 03xP 0x30l30 7 1`P  p( \"dP  < (hP 0;;;з;;; p-D3LP%HH;8`@/N T`00S 0@ZoY30CS3/<p3ebG -8LLp3 @@ TP, ` EP`LBPDLcPP kPDP7PJ0P3TP _PIT+P0T3P P03xP o0x3hP D0h3`P c0`303pXC {XC tLP XC |jXC dcPP XC @YXC (RTP 4;;;ȹ;;; -LM?`PB 008#8႒Ⴁ @ j"K2KT,K d@@Ld30 0pP j@hS `d3P/  pf`P ;(K0K2Kd,K pꂒႡ j d3 p303'!7 0-@L3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP  A5 ;%5 10R!!  10C1 -pL0P`P 5V VV& 0 0@0@XS 匆V i68h;8 9 `2S 0 0@0@i60PX; p-LM0 0@0@P`XXZc50 K@`` 1S^6Kpt; p-3LP4PPLPTP00653`0CS38@/N OcPP XC 匄4 τ07PX{4L|3x/ Px?8@0;S84m[03 RX,W4 Ⱥ;;a; 7; -PL@`pM3D1T% 0CT-  003T@4T 40T 0T0/.gX@4T5@ @l4 @ a4@508#8@5 0 R0@@ ,@@i 5i 6i( -/p  0p00LM @8@ 3#0S  0S S" S036?0 A0S  S 0 8P (h诃?  ; p-@PL 0P/^ 2`HL3S Zph3p -@L?#30CS3hS3 0?3# -LMP0@p`PX $KG4%0K&pKh 0`u&K 0Hn @40`gT XC! $; -LMP0@q`PtW K"`K!`K 0`@"K0| 9 @d0`2T ?!["0[X  X @; -LM`P 0`"Kx 00\ `B[L2BKTR 0< `0($4Spm <`K @ 0@00 @0K 0@0 W0 @ 0@0 H0@0 04@0  0@ K 0`0(p3` 0 0 308#8  0 0H`|0w ( 0`s0n  " -LM`0PpX30c @P  08 Ƞ,Ƞ #8"q3ϯ3?SCC!3S3CC/P |$K!l34 p/p0`<40S@00SD#0@S4P   0P@# PH#0# 0S;940 υ0p O0pr _ *@K@0@ 0υ(ṁ?0T]M寁;P媁 S 0P`1!81!1!1!$3!1/n0p@(#,3A!1 soU 0J#R*  bVKQ ,XV 1W kR*@K0@a^]00S"0V"3VIpq8Ax?04i(/:-7X;<7;: `0;Ի;p:<+7 7"7p/7.7,7$7d$77`;`Ȼ;;;x; 0-L@P ; B1P 0Ů@ -3 @SL## 0P P 7 -3 @SL## 0P P 7 -L(M< 8 0Pp4 P4 9@ U UU(KZPfUk <0$咟< 08 8w8 ,0KPA,6>00#(("(, *B)@ , / \ j,:, dpP' P0`0@0@40 0'  z/PxP :@ 4P0,\ \ 0K0 0@0@ K97d; -@L D30CSD3hD3 0D3 Q-L0o -LM 0S  0 Ƞ8,Ƞ#8 UP $0: -@PL 0EP 0h 0-@LPH$30 # 0 0-PL3S CT .K0@T0h|H p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK@P  Kp; 0- @L(,0 $BPP 00 $A0h 0-LM!P00 @ P:98<##8 <Å <9)7 <37<3 C <#K0h2S:P<3 @@BN "0K! 0TK0l0: -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK/@P  ? 00K; 0-4pLM@P  KPP1  ((    :PP8 8 8t;@; p-p  4p00LM `69@3 3$0 S$2 * , KP%$0 <#0,@@& <#00000 0  PG @,@  d~x T~x$30S S $<#0&%0@0 <#;; p-@PL 0P_ -`PG4 >Uph.p -LMp`P@$K$0 3dT   P@   p-LM @ PP @Lb~D ^~x  s  PPPU @L~(0c.PP `K PP @ 7~@2~0: 0 E8 Al*= `P7 3 / -`P01$ 0 #G , /`P#,<30 <3  <# <#@d }Pz@L }Ps@4 }Pl;h;H;;;0ؽ;;8; -LMP` 0P2@T3Xc\C`C\2tcp3xC|C/P h} K8W00P R;J<440S@V,P 4`d̜2"91!1 0.N!43 B\B( KP4pL L n}1!(31_,# @03#t!t1sDQ 0F#R=  7RFM> -R-00S#0@S8P   0P# P# (}A$ KP(0$#!$##Ġ"2"0Q"QA7;H7;,P7K7P;\R7Q74@7<7`<7(<7`; -L@03P #2hz 0-@L9P=9X>oSP P<fPASP P@[PE03P PCOP03P t03P 03P h03P 0300 |  |$P  p| \|P  <| (}|P 0;;;з;;; -LM0r:: @KqG:P0$` 0 ::$0 30 G@ c3X:~P @ @P J K303'L7 0-@L4 5  P0  BQr0C0 P0 5;50PEQ 0S*DP T65;5 10R!!  10C1 -`L0@P+P *Up UU% 0 0@0@G {U h#,9X;9 僩 P2S 0 0@0@h,4$ض; p-3LP4PfPcP`0.0+*D3`0CSD3r9@O DO40S 4@]J ID30CSD3Y+p>R p-LM@w*PyiY7P% p7P( 8 ?'P  Q{Kph+8 9>`P  A{Kph+:{Kph+3{Kph+3\/ `|9>@0;9%RKphf+`;;l;P;97 -PL@`p*D1T% 0CT-  04J@4T F+0T 0T0/+O@4T5@ @0+ @ +%+@508#8@5 0 R4@@ @DA@i 5i 6i( -4SLU@p` nE P F%# EME P hz hz긾;; p-LM0@0 P`BE P |pz[x%#EE PF K[x XzF K Ꜿ;ؾ; 0-LM@  2>P  >zK0  ?PP  L/z̠ 3,/ Pz`;;Y7 -2QMLP`|3@p0 C|#0|#C40x|3$_``  MxP \ 4yK303' V7; p-`L@P 5  P0  BQr0Cp P0 5;5pPEQ 0S*DP 35 ;%5 10R!!  10C1 -@PL P h蚾 -PL`p@P (8W;H8 WW" 0 0@0@ hmyW i)0 0@0@  p2S0{i)$ض; -LMP`pP K0 0@0@\;yD(0 K @xx 1Sz)G; -x3 @SL#t# Px P| x7 -@RLp` D ; 0 0P㪤 PPPPx7; 1 xᗦ7; 00,; -LMP0,0 @p`P 8@ V VV(K3;03YP/V] ̠A 0 L @{ ,0K`E 0, B 0 48#8 S,0 0 0@0@C 0x묃0 0 @0@$,00@0 0@v'0  ]7P tP  2 H0( 0 0 @0@Y7\; - @L#97P 3S P P 7 7 Q-Lj -LM 0S  0 Ƞ8,Ƞ#8 PP d 0-LM?0@ PK0KF0K0K@K@K@K@K@KPK0w; -L MPp@S P wK!1 @1.@1!3#ss K@P  y0PS00S#0@S mP9   0P# P#w&@K&`%FP w ;0 8!0 1!0@ 0p`–AG/ H^L' 0qw꼸;d`7Lb7;P;g7T7 W7U7`; p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`K4PKp -LM`pyPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`XPP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ -L7P i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ -LM@P K@0  K0KKKKKKKK|Pv|; 0-8P=@L8` X4/M P .P< PA S$P #P@$PE0$3(P PC(P0(3P 03P '03P 03xP 0x300 5v /v P  p&v \ v$P  <v (v(P 0;;;з;;; 0-3L@∺ⅺ%8P@00S 0@DuC;&0/qLZ p-LM`<  <8 0@\,3 !?bx0@Q,3 P P@ EP@D++!,0U,P 8l #8 ( @D ?2x,aD;;1,# ,#8d -LP廽P8@@ $p" )ogd @#T8`   ;7P( 7P u$  # "  3S 8@0;8%/hGL@7uh%,1uh%P hy%l;P; -PL`@pXP@  $d1T# 0T  00E4P@ V%5@(@ N%% = S2 @S# @ 5@l3505b0 R @ 3%@ T0@@Jl3  ` `~l3 ` i Ql 0-@8=PPL8X cP</PAS P XP@ $PE0 3$P LPC$P0$3TP =0T3LP \0L3@P 10@38P P08300 jt dtP  p[t \Ut ޾P  <Lt (Ft$ϾP 0;;;з;;; 0-LM@ ?P  *tK0 2>PP  Lt̠LP3,/ PfL`;;q7 -2QMLP`<3@p0 @C<#_ Ϡ,͠0 <?  lC4B0b8<3 \\  28嬾P A 0sKd30d3Hn7<; 0-@Ll3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP -5 ;%5 10R!!  10C1 -PLlC`Tp "8W;H8 WW" 0 0@0@ hdsW i#0 0@0@ p2S0i# 帾ض; -LMP`lsW K0 0@0@\3s<"0 K @8ϻ8 1Sr#Y; 0-83P@SL4DS@S 徽P8 ˽P< 070 -@RLp` D ; 0 0P PPPPr7; 1 rᔠ7; 00,; -LMP0,0 pl`Q 8@ R RR(Kp30p3XP0VZ ̠A0 L @z,0K F, R A0  $, C,  R0 0@0@pC 0}rp00@00@ x! e7P tP  ,  B "Ľ0 0@0@q7\; 0-@PLHXS >7P L3S PL PP 070 p-m3LSPp.!`0P f0038@ 00S 0@@?0m3^"pR -LM 0S  0 Ƞ8,Ƞ#8! 4P 0: -L@ P/彺P q h|; p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K妽Kp -LMpmP8 0 4S ,K0 KP. !0q(Kq <̠ČL8 ČD"̌#D!L  0@P( ` {q,3,P 8qq ̠8Č#Č"̌ 0P  \q,P,<4("!4l̠ <($Č"Č%̌ 0bP L , H9|;;T;;;ؿ;(; -L MpB^P qK K@P ¹0PS00S#0@S 嶹P   0P# P#`p3S 3S<p ,p 0P p 3 f1C P0& O@`E?P p [|0| 8!t0t 1!0@ 0p`;:@0m3 ,p~P;;8;`;p;P;}7\m7Do7; p-`PL@ OP b!P0 @/D0@ R phM(phjp 0ph)i;<,dw7 -(L"M"(@0K K0KKKKK K K4 K -LMP&/00P02 `@p 3 488S  P @0Vp `0 08#8   Ki0!B!O0,00Õ(0 0P  Ki -LM8P@` K@υ 0p@8/  00 00 o@ k7P y7P x3S 8@0;8Kh LoKh 4oKhjP KhP;l; -P@lcLVp@ t1T# 0T  00?4P@ 5@(@ % = S1 @S# @ 5@(3505q0 R @ @ 0q@@Y(3  0L   (3 ?  ("(  i Q0 -RLM R R K0K 儺@-03S 0 0@0@o; 0-T3P@SLPdS\S 她PT 岹PX 070 -@RLp` D ; 0 0P㊚ PԜPPPn7; 1 nw7; 00,; -LMP, 03` S@(8@% R2 RR x3 S% TI x3@!#x3 S0x3ʜA$0  @޶X(K`~n003 <unxÅ ,0K? ,,L, \ p  ,  R 0 0@0@$0 0 @00@ O0 V7P tP  ( >00 0 @0@7;; 0-@PL8LS 27P <3S ĸP< ѸP@ 070 p-LM8@@ KpPq 2SK 7P# 7P&   ?ⶺP( ?⯺`P J (mKph'A mKphmKphmKph@3<$/ ` <典8@0;8Kph̄d ? @2P  ,mKphꀶ;`;P;l;77; 0-@8$=PPL8X 5P<$PA$S,P *P@,PE0,3P PCP02DP 0D3<P .0<3\P 0\3TP "0T300 0-LM @P tPP  0 Ƞ8,Ƞ#8D  P 8P 80 SS8 1: -LMp`r PM 08 Ƞ#8,Ƞ ʴP?8@KݴP pS ޴P 0$S0S? 0SpʹPw ,0S@,0@S婳P(0P 0S(0!#哳,0@S3S 02 `R@0S2sP  @ 00S0"30Sҳ@ͳP0p@Pó #(#0`S0@0S(#0S崳Pg   0@0S #0S 3s (3spW 3s (3s Z` O?K0K0C NPOKX 2$KO0` r@KZ8< $8 #44"<,K ,0 c432@9@ j1!8!1!1!0@ 0P`:4:0~3 Z0Sp j$K233SCj zjvjtj0 $00B SAB Qa0B7 BSW B? 2"0 P2O TSjHOj<Kj 1:*P;4777;;;:t;;P;,; -@L 30CS3h3 03 P0( p-@LP0`TP 5@00"00p2d30`# p 0-PL0>P\3|S XCT ;50@T0h20 -qLM0P3@0` ֖C;QA40+ @-033H   303唴3@0CS3T " di0ⶮ K< aㆈ<0>x303갗7|; p-@LP0̱P|3S 5  `0  BQr0Cp P0`FQ0S*DP #5 ;%55;5p 10R!!  10C1 p-@PL 0匱P_ U`1|3S `3 d30S T2 S|#PB@phpt -PL0`pb@P ,=W;L= WW" B? 0@1 Az iW iV< 0@1A 岖 pT2St]iD3H03Z30CS3῵ض; p-LMP0 0@0@`Xh0 K@o 1S)Kp; -3 @SL## 0_P $lP 倲7 -@RLp` D ; 0 0PB P㌖PPPh7; 㭖1 yh/7; 00,; -LM`0pPᢰP&U& UU h0l0h0PCUK 0Ÿ0BD0  @堰30330CS3'(K,0K P۰,0S 04 C, 0  > 0@1A R"0 0@0@h@| 0 hh3D03p30CS3մ꿠0R P00 @0@, t@ @ =7P P  #"  I8 "z0 0@0@7\; - @L#7P 3S 0cP ,pP 7傱7 0-LM@0ׯPP K034038 D0\P  gP30CS3W4< H0GPP  HqgP<D3,/ P弯6`;;7 Q-L0 p-LM@PP` 0冯P Kp@ĠF@0  KK 0KK`KKKK3 030 K3P0CS3 -LM@P`P 0WpP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(K3P0CS3ѳ -LM@P`pP 0'P K@$L?0 KK$0K!K#K"K KK3 030$K⼲3P0CS3ᢳ -0PLM @ K@b0P[ -LM@PP`p 0PU x @ JGĠ0 K KpKp  >   7O p-LM@PP` 0廮PU xK @      K0 k% [0[48#x -L Mda0@0 0 匮PP 0RLK}(pK  = 8#8  -03S<=d =  0S !0[(<<P!0K PP4 K?0 Q0 U Ah?i5: 0-LP0.@P 0$  T @ 0h' 0-5@=P5LUPPS4 0@S4P/ 00S@8<0S80s$ <0s! @0s .@K 0pP c .Ghc@LcDcW20c2 o tP1!=1!!20" h30Ol#t` p3T# 0Pc7  0p,X#R  82-3P |u8 N"0U8"m8:; 7;75:;;(;<;; 7d7ؘ7D77|7H77ԓ7QQ -PL@pn!1`R1017@0!0 1SA@@10A/00@ 0@  0-@8 =PPL8X P< 嬭PA SP լP@塭PE03P ɬPC啭P038P 0830P ٬003$P 0$3P ͬ0300X bR b jP I pbC \b[P : <b4 (bLP 0;;;з;;; -Q3LSP` 8@ R RRpp`30`3@PV hTC 0b`s ; 0-LMP ?SP  }bK0 1>DP ߸ nb@5 ?@ P@P ȸ TWbˠ0 434/ @墪0`;;7;@7 -2AML@`Pp  3($S 3O\\  {P  0bKH30H3$7; 0-@LQ3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP 05 ;%5 10R!!  10C1 -PLQC`Tp 8W;H8 WW" 0 0@0@ haW i0 0@0@ V p2S0iض; -3 @SL$#(# 5P BP  V7 -@RLp` D ; 0 0P PfPPP_a7; ㇏1 Sa 7; 00,; -LMP0,0 pQ`Q 8@ R RR(KT30T3ͪP=VL ˠ4A 0 L @u,0K 廩 , 0 0 @0@, 0@ @ 0  7P tP  A g10@TCW 04`T0 0 @0@ G@7\; - @L,<#V7P 03S wP0 ㄫP4 70喪7 0-Q3LS@8@ 0P7P 7P 3S 8@0;80h@`0h,`0hP 0hP;l; p-PLQ3`S p0 0@0@(n`91S phW; -p@QSLU`@ _0T o0T s0CT@ 505 @  Rh @@ч@ @@ @@ ni 0-R3LS@0$8P@ 00S0-0R3_0 -LMP` δP _R!1 `/`$ KɨPP$堨0`S00S#0PS$唨PA   0P# P#_3S+ 3S( 3S% ; 00! 1>p!80 `~ 00P`@!0@`;))Rc8_ (_輸;;ܺ787`778;`; -LM 0S  0 Ƞ8,Ƞ#8 岨P  d -@L30CS3h63 03 -@PL 0匧P 0hQ p-@LP0`}P 5@00"00p'd30`# p 0-PL0gP\3|S XCT d*0@T0h'0 -qLM0@P `3C ;R' @3H -  N303ũ3@0CS3T S T^0 K<b}<᭫3037; p-@LP0P|3S 5  `0  BQr0Cp P0`FQ0S*DP 5 ;%55;5p 10R!!  10C1 p-@PL 0P_  `.'|3S `3 d30S T2 S|#Pw5phpt -PL0`pᗦ@P a =W;L= WW" B? 0@1 A᯴ >^W i< 0@1A pT2St]iy3H03叩30CS3ض; p-LMP0 0@0@`X^ 0 K@夦 1S)FKp; -3 @SL## 0唨P 㡨P 嵧7 -@RLp` D ; 0 0Px P‹PPP]7; 1 ]e7; 00,; -LM`0pPإP&U& UU h0l0h0.P4Um ̠BD0 L @֥303M30CS3(K 00KP 00 00S0 0@0@1h@ 0(O]h *KA) [*0[4  0 0@0@00 @0Ct00 0 0;  T7P P  p  - o 3D03儨30CS30 0@0@7\; - @L#$7P 3S 0大P 㱧P 7æ7 0-LM@0PP K034038 D0➩P 9 \P30CS3ᙩ4< H0≩PP $ H\P̠D3(/ Px`;;7 Q-L0ޤ -LM@PP`p# 0ǤPU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K\3P0CS3 K> 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 0_PU T T Qt0T 0d d\ThT T4 $ 76:;BF -LM @0K@K@KMP [0[K p-LMP0P KpA8#8 K@sz=8#8 @H $(03S<8 #8( "h=08#h G C U(08P#h @@l* P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 0娣PU @pT T Q0T 0|x U[@T@pT T<Q H( H7;6:BF 0-LP0j@P 0L@ ST @ 0hG.' 0-5@=P5LUP1DP P1D劥P6DPHP P5HP0H0P 03P ä03P 03P 030|30A hZ; TZDSP 2 4Z, ZHDP ;;;з;t -pLP 2n@ @`T  W >7PZ {7P{Z  1#H0S D0S 5@0;5 Pj1tP  /P;l;. -`LP0@pႢP@ J 41T 0CT!  0t0*@4T&  0T 0T0/d.@5 @ 8@508#8@5 0 R @5@@@ @J@t@Ai 5i 6i( -d0LPt`$0n0k3p0CS3=@O "-t0S (N' PJ0 -LM 0S  0 Ƞ8,Ƞ#8 P 46: -LM`Pp0` f@P  Y0ҡ$K2C3CS.2CCS3( KV@PO(0 40 0 Ƞ8,Ƞ#8嬢?4080@0<0 `RCS8 0@S4P3 00S@8<0S80s) <0s& @0s# F.@K`.0`pP +Y { ꔯ t#Y@ TYHY' 0Y 2w tPHx1!=1!2 0"h3 0Ot`l#p3TH 0Pc,  0p"X#R  -z"*)P x- ' F"0-"-꼸;87;746:;;$;8;P;87,777777D7 7Q Q  Q0 H/L(0$ 0,B$ #..-08 ?0R<  C4<0#.. 0-@LL P0CQ 0S0h0/ <# b ( C0?`% V Pq%-S_$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SFD7<7477,7$7777770D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&rW?F K4KrtP`V000000 R  Bqhq1! K 0 @] 4P `匛 0@P @ d0 R08#Q 0*@K2K0"K2K?      '$((;'( $$$(('7. -2LM ?Rp` 2RS 0RD Bn2"p 0 00@0yqT2T"@ [0 P8B8Ÿ   @-4 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 ;$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0ASh7\7P7D7 7 787,7 7 7 7 7 7 7 70 00 00p p <8# $ ((..$((7'(' -QLM0`(!(#R$K1p 0 ?% X00DP\Z, /<@  peppP 0 +  GP U0( HQ 4%=Q|7:@; //(($(('7,;; -LM?p`0 \`,0 M \@1Q  A1(A(Q0 m0 10Q @60 p0pᴠᶐ,0@000?p0 [@0 P}@ '/ /((.$(('7. -2L PRh x R 00 0000ScW瑛P400,AP P%焛P00EP>5@p0M PG PA |P; hP5 TP/ @PM(H/H(/ /(((d;;;;;з;0; -LM@P` sP P KtpP8 1!@! 0 `p0C `d!(0CP\1p p p60`S @00S1 0@S (P   0P0  P0 ZP0  P OP JPPZP d>PX:PP0  D輸;''4/8/(( (;/l; ;|;P;M(l7 -LM 0S  0 Ƞ8,Ƞ#8' NP d6:0@ 00CS77777777 P P@7P,@nPX@l`0 $H0AhSw7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777770 0 Rj Q Q0-L@P   0@T  08#0`08#0@jPjP8H8X8H8H8H8H8H8H8`8h8H8H8H8H8H8p8H8H8H8x8H88H8H8H8H8H8H8H8H8H8H8H88H8H8H8H8H8H8H8H8H8H8H88H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H88H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H88H8H8H8H8H8H8H8H8H8H8H88      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P88888888888888888840,($  ;;;;;;;;08 Q-L 0Up R0-LP 0hN0 @0C 00@d B  0@8C-)C80 P 0F 0h$;p -LM⨐ P# `? p0K ,K0KFMX T0P/K @N+K0.K-K*PK)K灘 ((Kp48 0-CML0@P0PS t000U00 -LHMhP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KbP  qM Kp ; -0LMPH.l$|. $H@0(K(0K'K&K%`K$@K#pK"PK!PK<P  KM Kp ; 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   V p-X0(  Q@P PL0@`[o| x phs -d@L h8#H,"(a(R -(Z(R  hRfdh -LHMhP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K变P  L KpH; F-0- PL@0NB 8CA[@Q \00HS X00 0R B0HSQ(0簔P 0F 0hy#p p-0L M`?0P.L"0K.B0"K K!KK@K0K PKPKPK<P[Kp蹢 HLpH; -4L@8$   08 #(hD -4L@8$  08 #(hT -LPp`@  @Thh LT @46%CA($H"(0H$(1 0pp; -@0L @R ,0 )0 @ h $) (0-"(LXP`@M^ @T(K0T O0; -LPp`@MA @T,hKT $("(h-; 0-@LPT T$ 00C0S 0h p-`LPV@ V@@|0 A QR@ P@  ("(0(  ("(ph p-LP@@xdT hP dT8:Kp,`@0 @x@Tp;8: -L@08>#`P00V0SOp3PFl#0Pp1p#S,88@8@8p8<8(#$3!3yDp V ""2! "8S 8S FV  FNeiD2!\ (""2!#)D !!1!#@ !}1!x#)D rVP! -lT!gP1!b#@  [$1!V#)D P0V  I D @0!;#)D 5 k -/8 +<0!& " -X8: 9:9:9:@8:x8:8:X9: -LHMhP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0KP ~ J Kp; p-LMPK 0@[0 0a[0aKQ[e%%% %`  Ƞ!`0 ,Ƞ  .P 0 P3.0G-  0G- <0x 0-0h 50LSP0CS005 0h:(I00 @0@0D: 0-PPv#C C-0$ ß  P!盓Pࠁehß, 0R(K> PʐX 4!R Rڰ8S S0 x q#H0820 007\mX 494@D 1@D )@H$H@H$(Dp8 < 81S'\sH )v74D( 0@0'PS@ @ G0 0/.000b0 q @B `PQHCM0$@00H!080 -u<8\p '.0 |8Pu! X 0 P PqP@ uJ 44@D+ @@H$DpSdT[  "PP@ $K8p0(3NpF-0 N;H =qU 021C! c.  P0GU1烐1P@, !ܡB=0  㕒@P 0 EE@1B} p  0ဒ@P@P `E LE@EP $E @A!ˠ0C- [P@"(R B 5RN n  08#(50;@05(R  @[ B@UT]EN7:"VSp|tp; ;x;;L;;@)8D; -QpL`@yP@ ~?1PT- |10Sp1TI 0s@4T@ H1T# @1T  ;[4P@# c0玏505 0S0!5@ @@ @ [4P@8S 5A0AS@@ Y0s@5A0AS @pi ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @~, 0R(K >KE0!#R0 0@0@0@ TD D H! rpPo ;H!r1 |D2r1 p00p0pD0T 48<#8:#:0 0k@A@ 0S) 01  DL 1p 0 K p0C 0D<0 $1 1 0H! 1 0@T1T!8!L1L!10@!0 ` 61!1#3!74  X0" 0 D0C @<0D BD0(K(Ko#B (KoB(KoBpT;x|t,8.88;) 99 9L'88l8l8H,8(/8)XVx;;8; -LM 0S  0 Ƞ8,Ƞ#8 "P ::D p-H0PS0`0LS4 U @T@T 0 R000S PH@ppp000SHPp -@0L<@0D0 -L0` 4#APp0Q ,78x78T68d68d6878l68 P2_@P 00@PPPe bPP 0 $`P00P 00 0$0S000 0$S0C40. 0$0S0000S0C40P  0$0S000 @P _ 00 0C 0  00  00  @ 0$0S0000S0C40\h p-LM0@`R@ PP0 $RL  Rb R 40Sf 00 K]p2RGH0S0\B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 +@d@<8 N0@@4<XKpHP 0  $("( RL 0CR K$@0P 8w0R1 R@@ 0 4 R # 0S0##40 0R 0RwHP 0  $("( 0$0j~,@@ nL@dp88; d d 0-00@L@P:0S R000H0 0  0hq p-L`$PD@T R000H0 0  Y  PL0S N0D  D@Tꈪ; -ML@@ ((0@P h?h;8;; p-00L@@P0`S0H00H 0@H@0D ph 0-LM0 @00P<@0?T?0L0K0T@!ʴ?D 0D0H 0P ?0L004 0P 0 H?0L0T@D $K0hd::;; ";<;\;<8 0 0  Q 0S3:Q 0A Q 0   dhfh 0-LP@T00 0P 0T0C? T00\00S  00 R0#03\0S0 00sP Q AP000 P0 R0 RP\ P 0 R 0 RP\ -(L"HP T  -(L"HP T  -(0 0@00L0P,00 0,0 40 -,0 0(,00 L000 -,0L0@(00 00-0@ 0 0, 0 0.  , 0-00 00, 0 0.  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,00 p-H@LP ``0S 000 0@@0<ph= -00@L PH 0-@LP0$0 @$0P00@0@H0 0-@LP0 P(0  00P000h-㕍 0-L'M;8(5'2&/%,$)"&Y#x h@^8 -)LP #p3 - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""07 7;@; -PPppL* 0 $P `U 80S T V0@T404040@!TW H0 ST404040@7H; -LM00`@Z 0| pp  0$  0QL< P$ R 800 QPR 4!P00P0S  Y00S P<0W)< < 4<8  4 0 4 @Kd d0, @@ 0 xP $000S$ 0040$0$40HP(00(0(K ?7`8|^8p; -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lg LT -X0L@l\  0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00ho L0& g \0  L( 0] L0& U \0L0"M \0  L0# C \0  L0# 8 \0X 0@ X h00<0L 00& X0L0 h X0+0 B `0  LX  0h0X 0C+ `0  X 0@ X h00<0L0 0 `0 x 0-TL,0@ 0P 0P  g0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,00@ph4, \00Q0S 0-(0LP0X0@08X0 T0$4P0T 0h p-X0@L$!;98 T8}PdU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 X/I0@N}T 8 T0$4 @ @000l@X0 } 0<;i8 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{4Y$8 80T$8 8X0@80T$ 8 $84  X0  h::; -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ESt8t8dt8s80% 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P L;: p-`L@P  x1(0pL0 P8 TP0 X0h T$8 40 \pphL;:;@;: -T`@ 0,@00PL8 T0$4 8T0$4T08 p$4,0@0,08T0$ 4  00 0, 00 00300  0 000000000000000000660000 0-(0PL@  0ES$w8C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phiX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0H<:;<<: -@L8T$ 1<8 0-(0L@P0  L0"SU U U  ]000% Up0l01-`; p-@LP`B,(0L0 P8 T@00X0( R Xph1, T0$84  \pphR;8=:; - 0LT@KP0 3@50  S R ? ;Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 JP JP8T0$X 4 000 0008T0$ 4 00@ 000  000;3; -(0Lp L0,S@R R R O0%  T08$4! 0%UR T0 8`$@8P/0  0T$8 8+; 0- 0@ LhPP 00 3@5 ? 0 JP  JP00P=:3;; p-L@P`P  *(0xL0 P8 T`00X0T$8 40 \pph*P=:;D=:; -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ESx88ܓ8l80%|A00[0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P =: p-0L P3 LP@`( 0P?> S0P0  )(0L0 T`8 0P X0T$8 40 \pph ?( P 0 3L=:=:;=: 0-(0PL@  0ES8ؕ8$880%^000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L 5P =: p-`L@P(  pp)(0hL0 P8 TP0X0T$8 40 \pph=:;=: -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@LL$8T 088T$ 1<8 0-(0PL@  0ES8 8l880%000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L cP =: p-`L@PV  p((0hL0 P8 TP0X0T$8 40 \pph=:;=: -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ES848880%S0020 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P (>: p-`L@P  p'(0hL0 P8 TP0X0T$8 40 \pph(>:;>: -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ES08H88$80%S00m0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S0p -L P d>: p-`L@P  t'(0lL0 P8 TP00X0T$8 40 \pph+d>:;X>: 0-(0PL@  0ES 888880%000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp p- 0`@LP& 0?.C""&(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4phy&T0$8 4`X;;|>:; -@L@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0P6P0P 0-(0PL@  0ESꜥ88880%g000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L >P >: p-`L@P1  y% 0?>C2@0( L 0P80TP 0h0X T$8 40 \pph>:;>: -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S 갩8P888 L0"S0%f00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L DP  ?: p-`L@P7  t$(0lL0 P8 TP00X0T$8 40 \pph ?:;?: -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S 괬8T888 L0"S0%100 L0"S 0 L0"Sp8T0 $48;T$ 80 -L P `?: p-PL@`v  #(0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0cL' 0[`?:;T?: -T`@ p,@0pPL8 T0$4 8T0$4T08 $4,0@0,0T0$8 4  00s0p  0  0S S S0pp0p"v0p00 p, 0p00000p0p0pp0p00 p0pT0$84 0p|0p0p6p0p 0-(0PL@  0ESh88̰8\80%@000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P ?: p-PL`@~  "(0L0 P8 T@0 X0h T$8 40 \T0 $84 0 \;\\@0:\ `0  phpT0$8 4`?:;?: -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 Z"T0$8 4 000 K"8 T0$48@ T0$4 000000000000000660000d7;;;?:; -1`LQPp@(0 0GS ꤴ88888 L0"S0%7 !L0 S  L0"S0% `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@3pd?:;7 p-L`P@!0 R$(0L0 P8 TP0 0h X0( R pph! T0$84  \pph !;d?:;?:; -0 3B5L  ,0|@P ? D; -L P 00 0Q400P 0- PL004@@0 p-LLM@0`SP Q S 0R d@KL?0+8H0 0( 4KP@PKp@Pd@KL?04KHP (P @P -@L004400 p-LLMdPK@`L?8004KX0(0 0+8H0 0( 4K P80D0#80Kp0 p-LLMdPK`@Lt?L0L 0SD0# (0 0H 4KoPD0[#SKp#0 0-LLM`@KPLS? 0$0 04KTK0 p-LLMd@KP`L@?0H0 +70( 4K?PD0  6Kp p-LLMP@`808-@Kp-@P d@KL?0H0 +0( 4K@ 0-T0 SL@P XP0  TT0S0; -H0L@<њP0 h;h^<@B;\8 0-H@LTP+  @T 80 5P80 P \ @THP P 00800;; -80L@H0S (80 4 H0S;㍾ -@L 㺾  @ !! p-@00L4004PP `p004PP h`[!`PP80 400,ePP80,;H;a 0-80L P  080iHP @T0H D0L H0<00r 8080 0-P@Lƿ80 080P M0h SP p@P 80 0800h,.80W 80`;x;D: 0-L00P4 P 80 080 0@80yɾ80 0800h08080 0- PLU@  0R0 0000\0 0 0h30 p-PL@00\  \0`@0\X0 Pphh0S` -L`P0PSXp PX@T0  P0S 80P0s80 080P @NP0s @T@; -ML@T $$0@Phn\8;; A-L@Q$8 888hhXh80 0P0 0-PL@A000 4 0X80 H0 L0d d0\`0x HXhld@|@ͽ800800h艻 ";88h8 -0L=p3 80R00  ( ,100 !0 $1(!(!;;;; p- 0LP`1>@0S@ V0`S@!1|t  Q \HphL10 ` V$;4;; ";D;p;L;;; p-0LS`  p  P  @p -L Mp F4<0S (K02*@R`  xYs `@PP00U0SS U0 !U U `Y[, ,@P0 U 0 0f P0 @  P!0P XP, 0I`Y& `P@PD@P@`D@U  0Hy4 `  `o;X;;8;x; p-`L @PT 3  @PT400 ph#00 R0Sx -LLMQp0@0Π; ; lK$PL `Z;;00 50P<800808400 0 4P P 8J8 EP8 >;; p-LLMdPK`@L7@P80@ 5[S L+70+88  X0 %K)@PT0  L70,8X0  08 5K@P P -LLM@pPl`K)05KQPL 0w03?dU L680` 0 Pp 05KQP  KX <'0 p-LM80@080PKj8 0S#8 P004P `P xN0P'PQ Px 080x -80L` Pp@\ 0 00aP0cS0c^T@0PD1`@\ 0 00aP0cS0c^T@8#8pH1X@\ 0 00aP0cS0c^t@PLqP@\ 0 00aP0cS0c^T@pMQH@\ 0 00aP0cS0c^t@PNq@@\ 0 00aP0cS0c^T@pOQ8@\ 0 00aP0cS0c^t@0PPqQ10@\ 0 00aP0cS0c^T@0pT1 @\ 0 00aP0cS0c^t@ PXq @\ 0 00aP0cS0c^T@:#:\14!R88484848P`@\ 0 00aP0cS0c^T@4pD1X@\ 0 00aP0cS0c^t@PLqP@\ 0 00aP0cS0c^T@pMQH@\ 0 00aP0cS0c^t@PNq@@\ 0 00aP0cS0c^T@pOQ8@\ 0 00aP0cS0c^t@PPq0@\ 0 00aP0cS0c^T@pQQ(@\ 0 00aP0cS0c^t@0PRqS1 @\ 0 00aP0cS0c^T@0PT1@\ 0 00aP0cS0c^T@4X1 P @\ 0 00aP0cS0c^T@0\1Pp@\ 0 00aP0cS0c^T@0PD1`@\ 0 00aP0cS0c^T@8#8PH1X@\ 0 00aP0cS0c^T@pLQP@\ 0 00aP0cS0c^t@PMqH@\ 0 00aP0cS0c^T@pNQ@@\ 0 00aP0cS0c^t@POq8@\ 0 00aP0cS0c^T@pPQ0@\ 0 00aP0cS0c^t@0PQqR1 @\ 0 00aP0cS0c^T@XQ4; -80L0P`pv@ Pv@\ 0 00aP0cS0c^T@ RP0!6 @\ 0 00aP0cS0c^T@P('@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@@AP004DT@0Q<"8!81\ 0 00aP0cS0c^T@ 0BS0! hDRk L<Pr@\ 0 00aP0cS0c^T@0P416 @\ 0 00aP0cS0c^T@P('@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@Y0P00(@\ 0 00aP0cS0c^T@4505 81@9400@=|;P; -LLM`plKLH2100 05KI<P& P$80KH RH @ 08R#HP@ LK+2P6D0pSDP L0 dWPL H@T#000 @T L 2 05K0,8P0 0 P LKcP ]P @T K@?h0;-40 ^ 1 <1< R<0仳 0-P@LT0$0 0(00hȗ 0-@L0l 0RP0 d0hX -PL @40p`0  04  3P0(0i:04  -p`TL Px0@d0h`l@p@|@ | 0`000 m dm8P8 -L@MЀ0 S$ P`0 0(0Q$ 0R" K0p^@K:@1 0d VK[K\KZ0K^pK10@ NKH8 >K1 :R: #*1i;;D:@: -`Lpy0S| R0000| 0 @P@@@|@0|0 `hs p-`PL@T | R0000| 0   \p -@LP 00 p-P!3@L P& `0 0 ``2l l02U 0@|     |\0pp(88 p-@LT` PP P1P#P㍰00p -LM` 㶰P @㱰 HQ Rʨ0  QpP `]K0P 0:$@K 3sH`DP700< $ P@ @D;88D3; p-LMP4@0 \ 1 `R 0S 0(0 Kp(005S88888888x88x88888888l8888888888888888888888x88x888888888888 @K/ 81R #0C###ĠKK K0K<1#̠##DKK@K0K/ᮕH0S 0 8< 0$08Q0Q:tP 0 48 0R,OpenBSD5.4RAMDISK#10 @(#)OpenBSD 5.4 (RAMDISK) #10: Thu Aug 1 12:32:28 MDT 2013 OpenBSD 5.4 (RAMDISK) #10: Thu Aug 1 12:32:28 MDT 2013 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK wdc_probe_capswi_do_hostdecryptwi_do_hostencryptwi_attach#h:#:#:#=#t=#:#:#;# ;#=#l=#T<#<#0=#L=#@p#0p# $$|z:$4;|:z:z:z:z:coredump_tradcoredumpsysctl_diskinitkern_sysctlsysctl_tc_choicesysctl_tc_hardwaredisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freedb_show_all_poolskprintflogprittwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@cache_lookupsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mountH't''('xk%'d'xk%'|''xk%'msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP::(:4:D:P:\:h:t:|:::::::ı:̱:Ա:ܱ:::::::ieee80211_newstate;:;3:0 :G(:9$:!:08:0d :40$:`(:RD,:UL0:p4:T8:|<: x:5:X@:RD:H:L:7P:6 ?;7`:7T: X:\::72\:p:7`:6d:7dO:h:6 X:0,l:@p:Xt:!Tx:|:6\:5h:tz:7x`t:d:p:l:R`:7|:7:A:H:C:J:K:::@:I::E:E:IJ:Ȳ:̲:5:в:7;7Բ:ܬ;ز:;0'ܲ::!::.::7B:7*:" ;O:\T:`:J:h{:7v:l :7X:z ::::w;7:B :7č;6$:$;:E(:6,:6 0:04:G$8::<:7HXq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mount.>.Q.>.:X.Q.:Q.H?.:G.8Q.P.Q.:M.XP.O.Q.LI.:|W.Q.:uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertId`+dIdQdQdQdIdjuvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_freend6_rtrequestnd6_na_outputnd6_ns_outputnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs%2 2 2 2$2 $2$2 $2 $2 $2;;;;;;;;;;   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`S2R2,=%l2m2,=% ;Dr: ;Dr: ;Dr: ;d; :: ;: ; ; ; ; ; ; ; ; ; ; ; ;p  ; ;p 0 ; ;p ` ; ;p p ; ;@ ;;` ;;P  ; ;P  ; ;P @ ; ;P P$ ; ; , ;0 ;8 ;0 ;, ;< ;8 ;< ;$ ; ?; ; ?;D ; ?;L ; ?;T ; ?;\ ; ?;  t.;܎;t.;܎;d ;h ;@l ;h ;t ;x ; | ;;  ;;  ;;  ;;  ;;  ;;  ; ;  ; ;/ ;R;o ; ;0/ ;R;p ;i: T&; ; ; ; @ ; ; ` ; ; |: ; ; ; ; ; ; ;  ; ; 0 ; ; @ ; ; ` ; ;  ; ;  ; ;  ; ;  ; ; ; ; ; ;  ; ;0 ; ;@ ; ;P ; ;` ; ;p$ ; ;( ; ;, ; ;0 ; ;4 ; ;8 ; ;< ; ;D ;H ;P ;H ; T ;H ;0X ;H ;@\ ;H ;P$o:H ;`` ;H ;pd ;H ;h ;H ;l ;H ;p ;H ;t ;H ;x ;H ;| ;H ; ;H ; ; ; ; ; ; ; ; ;  ;l ;0 ;l ;@ ;l ;P ;l ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;  ; ; ; ; ; ;eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrror_bus_dma_busaddr_to_paddrA; 9A; 9 A; 9`A; 9A; 9`A; 9`A; 9`A; 9PT; 9A; 9 A; 9D(;`9D0;9i8;9 i@; 9 iH;`9 $iP;90$i`;9 ,iP;90,i`;9 .ip;90.i;9!i; 9 !i; 9)i; 9 )i; 9-i; 9Ai;`9 -i; 9Ai;9Ai;9Ai;9`A; 9`A; 9PA ; 9pA ; 9A ; 9A $; 9/A 8; 9?A L; 9A `; 9A p; 9/A ; 9?A ; 9OA ; 9A ; 9A ; 9/A ; 9?A ; 9 ;;; ;,;4;@;4;L;T;`;h;t;|;;;;;;;;;;;;; ;;,;<;L;\;l;|;;;;;;;;;;;;;;;;;; ;;;$;;;;;;;;;;;;;,;4;;;;;;<;D;L;;;;;\;;;;h;t;;;;;;;;;;;;;;;;;;,;;;;;;;;;\;@;h;L;X;;;;;;;;;;;;\;h;;;;;;;;;;;;;;;\;;;;;;;;;;;;;;;;\;@;h;t;;L;;;;;;;;;;;\;@;h;t;L;d;d;l;;;;;;;;;x;;;;;;;;;;;;;;;;H2;а2;H2;а2$;28;X;2p;;2;;2;;2;8;2P;p;@````` ```dumpsys%;%;%;%;%;%;%; &;&;(&;8&;H&;X&;d&;t&;K;&;&;&;&;&;';4';L';p';';';';*;(;(;8(;X(;x(;(;(;(;(;););4);d);););*;0*;\*;*;*; *; +; `+; +; +;,;H,;,;,;,;-;4-;d-;-;-;-;0.;\.;x.;.;.;.;/;D/; \/; t/; /; /; /; /; /; /; 0; 40; \0; 0; 0; 0; $1; D1; P1; 1; 1; 1; 1;  2; 82; X2; x2; 2; 2; 2; 3; 43; L3; 3; 3; 3; 3; 4;(4;D4;`4;|4;4;4;4; 5;D5;l5;5;5;5;5;6;6;46;T6; l6; |6; 6; 6; 6;7;<7;\7;x7;7;7;7;8;88;`8;|8;8;8;8;8; 9;89;T9;p9;9;9;9;:;(:;P:;|:;:;:;:; ;;P;;x;;;;;; <;<<;l<;<;<;<;=;,=;P=;|=;=;=;=;=; >;(>;P>;H>;h>;>;>;>;>; ?; $?; P?; t?; ?; ?; ?; @; 4@; X@; @; @; @;!@;!A;!4A;!PA;"tA;$A;$A;$?;$?;$A;$A;$B;$$B;$DB;%TB;&pB;&};&};&B;&B;&B;&B;&C;&T;>T;>T;>T;>U;?4U;?`U;?xU;?U;?U;?U;?U;?V;?0V;? LV;? \V;? |V;? V;? V;?V;?V;?V;?W;?,W;?DW;?`W;@|W;AW;BW;CY;DW;DqX;E0X;FLX;GdX;GxX;GX;GX;GX;G$Y;G@Y;G`Y;HY;IY;JY;KY;KY;K(Z;K680~9o:k;lL|=>@ApD FPQSTXY] dK2$9<5D 55wddonewdattachwddump   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt100`555655wsemul_vt100_handle_csi@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!;Ȩ;Ш;ب;;;;;;;;; ;(;P;X;0;8;@;H;P;X;`;h;p;t;x;|;;;;;;;;;;;888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?pK6|Z6O6Q6usbd_set_config_indexusbd_devinfo,;@;L;`;l;t;|;;;;;;;̮;Ԯ;;;;; ;X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@  @  @ Q@  @  @ @ P@ Q@ u@d@d@@@@|@@@ @ @@@]@@@@>@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachDШ6 66|6uhidev_set_report_asyncp66x66uhid_do_ioctluhid_do_read6x66,6=:R: :]:::I::J:R4:7: F: r: : :K:L:@#V:L:L:L:L:L: L:L:H@L: N: _8::Z:\: : : :E: `:mx:KR:A:[j : !:0>!: !:":j#:$:?$:n2%: &:J"&:&:abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    6D60666h666665dd5(I*LCDEOMPJQNRK6666666666(  v      W 1 Q `  |6@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   6  L+ L 6L2 D   O  {p6o  A umass_scsi_probeF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 | 77H 77axe_iff B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- 7837\#77;7TE7M7;7$$0$0$$$$$$$$$$$$$$ $[7\7Pd7[7@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0|Lt7Hz7s7i72V{%1" `"'`~%ZP `T77Ԍ770w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff7777hF F hF fF dT7H7ػ777777url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_raid0_rw%s: %s: too many ccbs queued invalid strip size%s requires two or more chunksRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%.2x %s: permanently fail write on block %lld sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 4RAID 5%s: sr_crypto_finish_iosr_crypto_wu_get: out of work unitssr_crypto_intr: no wusr_crypto_done: no ccbs on workunitsr_crypto_rwcannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6sr_concat_rwCONCATRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocregistersuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchwdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d , address %s RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d No KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITCOREDUMPINGSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitplcpu_switchto returnedfork idleidle%dstunrsensor_task_unregister: unexpected state %dpausesuspendsigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss passive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptocryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestfituaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel region/dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_savemkludge: no kludge spacein6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3unknownCPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %ldintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabledmanufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %x for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) %s: couldn't allocate copy buffer wsmoused_sleepwswaitwswait2wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored wsemul_vt100_handle_dcs: bad type %d[>24;20;0cP2$u/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d urlwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not allocate beacon %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphymmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctskSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d wireless network adapter%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus gkd'(3  @: @::$@:,@:4@:<@:H@:P@:\@:`@:h@:p@:x@:;|@:@:@:@:@:@:@: -.,('&G% !$" 31<<h <<PdPdh <<PdQdh <<rdrdh <<0rdDrd <<Xrdlrd <<rdrdh <<sdsd <<sdsd <<sdtd <<Htd < <<Htd < <<Htd < <<dud < <<wdwd << l|dX < << |d < << <}d < << ~d~d <<@~dT~d <<~d~d <<~d~d <<~dP}d <<~d}d <<dd <<(dud <<\dpd <<dd <<Ld8d <<dd <<dd <<:dh << :dh <<ddh << :dh <<H : d <<+h':Hd <<+':\dh << /:dh <</:dh <<0:dh <<t0:dh << 1:dh <<p1:dh <<5: dh <<5:(dh <<5:Ĥ_ZJ0=yڴ@q UwV) /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . ..@ bin dev etc mntAmnt2KƢsbinKB tmp usrvarinstbin.profileP- install.mdupgradeinstall  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(4"4 (XXXXX$S$S||c|c88]TTTۣeXXX$$OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  00P - h0-L` 0 R   1S0B@Ct1P @D0t0$<0< 0 R-L @ R0  0S00 - -x@x @0LS ``00T0H 0S 800S$0h-  p-L q0P `P dpfP yH@POU8 g (4WPP \&@LP -PLU`p 0S /t0PPQ @Q GP P0 iꌐTL@ Pp-L@P`D ph0,0d -"L<MȂ0r"`8K01P@H =GP  P0Sl .y`Ÿ X08@ W P4  0` $8 000P  10S000 B *1 0S0 Sx10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0O$0S 0S  0O$0S 0Sl 1x(K, (dJ,@̎L\ dܲȲ (P -LM K `ep@Pqx1 pz 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@ 04 x 0 x@P @ x -L0 $, -L0 $d 0-LMK PEp@1 Qz 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@ 0,w0 w@8 @ x -0L00(d -0L00(, -L0̒ -L P00 -Lx0 -Lp 00d, -LM$`K✠p圀&q @PEP @Q` 0 D Fw 0R00 (0S(xE0 R0 ,d -L $w@ -L w@ -L w@ -L w@ 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  `[PP  / <0S 'yP00OU0@0V 0000 00 0U0 0 0 0S0|0Ζ 0  `ve0 f` R*Rb0 00d @$ D 0-LMPKyP \x0: S D4 K@SP0: S S000K0@m @ -ELP40  DXPD40S0o DP4000 T0$ 4%XP 0l h4P$X0000S|TD$(4 0S 0@?Pc0S 0?P 0|?PUxdpS $0   $0 D0; S 0 @c$ #"gx0,c`V u寓BT?T "0spy2Q 0Sl*0  Q C 2P Z "0  lwdv0 0Z0v0 0 0 0  P0 0 0 0000000 0 00 00P 0 B00[0 Ha00ؐ0q@P00Cs01 1R 0R!0R 00 l R R *p bQ cC0 00$00S8,T̒dd(@d -LMb,Kג$ (0 b,0P a,  B=9, =( ,(0 ( 1/@(P( 0- 0pwOKP PP0t!dphPPBL@ C H R <1<R^OKd0$!BD@ sC@ ` R 0REOK$KQ0d B(@]C$,0(O@@0 Q d0. 0S-`K$Kq0dP PB(`;C $LKX$K.Aд? 4 -Lg.T -LΦ@_˦@ -LMpa0@ 0P$ 0$"{YpLq  G@Pp: 0,0 00 K3KQP7 v P$p0 K03K,p Qp   X0P@PX`$0 p S  0S@P$0S 0S(Kdm@ -8QL0F P0 @c$ #"0Yp8q 0 30`p @0( TP0 `V`@ Pl 0S0C0TsP 0  Z <0t v0,̒p(@ -LB 0%0@ -MLM\"0`p( ,4 4"Mp, R0@!S!ꔟHHHHHHHHHHHHHHHHHHHHH|HHHH\HHH! pt1 aARB^KPEPE@PH ,4004 4 J>K 0C8t 4 D , aP20-S) $sРBKAL L P0 0$RpB.K0 B Bxpppp~0Hr0<$Yuz $SuX`Htض -LM@pP4 PP 0S nS6 =9A`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,KH, ?R0S@p @ `r0 p000"S 0(rr$P 0 0jrxpD<T -LM`PP( @(K,pK 0 g(0@S 6$Kt -0L |@ -LMP@`0p^W U@ 0S T  0((@ p-LP@S`P P@?tp P@qr@@ -2L`M2\Ÿ\[\ @ll2` P70PP@`00@,A>Pp4o0oS0 ` &rВP 0-t0L0PS Q @Q  |>P,0 r300 R00В -0LS0 R3 ZP"p`0@S 0  tP "10c0\/ Q<p Xo 1"0ctr0 RoВ -LMp K`P @PUO =PP -LtM`P$p/ P0@$S$xhX8P#όpD3D#Q 43 R(K ሡP A0pS h6P( PKp iPy0: S Se ! 10bP(AqPkt2 Rk (`1 i tPE pPWn v(`@Pp=PXUO Xi1 R]  w31 R\1]1 Y1 U1 1NX1 Jh1 X1C41 ?( < t 噎"10c(0VPPn(`}0 RX 0 RT rP w3(` `7np px<p눹В`H@` -|BLM0 j 0`PP\%D2R  0`P $K\% 2R004 쑟 000\%1RM = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K00D`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0[PZ 0Z t ,(d  80&`p<(@dlD_@TP0  R0 0, 0C@$0(@/,0 TT@h( -pMLK 0@0P#41RL0S `f`0R30 @0@c8p(80E`8` @b@cP @P   0@Q  0@$0(@0 \0`0,0 @PZ * Z & t K,S@h, -PL~;P@@ᢳP 7:`P @k;P |f;Pla;pP \\;PDW;P < 0$LPT(X -L 0UF븺@ -LM@`CV$ P$pKVh P 0S -SD01!@!= ;P0@0@V@x@ p-LMPP` 0S@R0xD;@A;@@5P ( 0 @`x:>0x nD 0-\ P0LS@ 0S  0S 0S00ؒ p-`PL& 0S# nS$ 0 @@,:P30PP@`00@,:Pp4 l0oS0 ` unԒP 0-t0L0PS Q @Q  :P,0 r300 R00Ԓ -0PLMP` VPp$ ` @$K: :8`p`3$@0&T00S/x -LM` KWpP 0P/:P? U @&:PP@ -L0M`0@XpP,0 0St 00 0DSH  `T 7 R P R   0S`7V Ȫ00@T0WS9P1|' x7``W@ TL孪PD7Q$`8' V垪! 6`V'哪!@ 6`V&刪! 6`V&}! `l6Vhh&r0S!! R 46`V,T0L&b0S!! R 5`V0&R0S!! R 5`V0%B0S!! R t5`Vl0%20S!! R 45`V,T0\%"0S!!R 4`V0 %0S11S TD`V$0S `V1$!!!4V, 0R(K0SJ 3`VX$թ!@DP% `V ɩ)0D$4` 3V0ứ0`SS l0F@KLKL0 j0.0K嬩@8P 8P[ 8Pz0St"Rh 2`V\ßX0P#P苩0S"\ 2`V(0 #~ 2 t2`Vll"s 2 H2`V@@"h 2 2`V"] 2n `1V"ReN_Z 8PZ XGVPKLK\`1PPV|A@\50"P4G\T"/`L^"1R"<8P!2 0`V!2 0`Vt!2 `0VT!@8P 0S 1 `D0V@ !8DX@Lؒd`LĻ̻Իܻ( 4@l@hmd|Xt`px 07L4 -L)MMğ~KpG`pG , P@P #T@U `7P^ Qe@0PP K@A@ A <0d Sd: D3qd A R (_d:S@Xd:@S e,,Ÿ, 0R(K+up@r PeNK@Db@DO0"6@KH0S l Ui0S=0Sx L8P$,`&NKkPaw_KZ 7P {K z7P1 R( @JoKZ k7PW{?K _,],KA P<h:#4(1 R0SQP@D h@,>,yhtP t 午k&NKqkPah\ h|xhRhj`嚧X@hEP 4@Լ  ȼ0<07 -AMLM6 `Pp, &pJ A0@6S6P<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<H<<8<<<<<<<<<<<hX@ P<p%ᚅp5 `bA0V84 Vm VZ @ K`P PD(6P $#6PP PP (0JP@4 sPnpi4 RD.`t4 \HPW4pR84 RM pIrPDp?3 ;963 R `84@ 0@@Z00S _mP; `3 RZBKHHP (:PI ]P@0 0  5P 0P 0DPt0 0 04 2 0@kPP B.K B BxP@4Pbp_ &BK@@z`Pa >iJPP7 @K5P D5P ?5P 84 f`_P⨑n3P`hft'5P@T@h@XHPx DiIPP84IPP84 ffIPP0D{0S h84 f P@ PUO 0t`P 0phX(`زt4Ԓ`HX|T|pܽPL` -L. 0Ŀ@ -GMLp1M ha d!@0P$4 @!p oP: !p 0bSQ`A~K pG0pG4 ĬP- $$004 4 =K 0C0C 4rPmP -P P| b0$\eA.KP0 B BDc , >~> > .p. 0b0CS/[>KQ0C 0C 2p g>K0C 0C6 fP$ϟ@T |6: S-  S lK`F `F؝@ 1pW@P  (2P @TDP c`= t=%p=^<= X=T= L= R =.4=0=I<\.=@<8.$><7<,2<.<<)h< << < 8< <|< l< < \p t8@T2 RS d` +6q0#0P` S`@XX`H hT$(,048<@DHTHdIIP\`J4/@8@edA0T m@hTPXh L8@`\gfffXH(ATTPxDp @p|( 0EM &P.b SV&\_6 S F &T$_ 6!&a 0 . `& @P 0 2" p0! 9 ^ 2 6S22S \< D2^0B0 *& R 0@, & l& *6 `@P p! 0u9@@T@!^1: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  ]6R 00 T@x5S%%R005  P0xc5 0S 05 Q5 5 % & 6HWQXSQdOlLQxH%5CQ?5S%86TDP.,Q' 8y$@T , 0RP(K ^ (^ K@ @|5 K@5 -(pP9 % R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQ)P50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`L(00ST \8 4  (0d8 [NKR@D@D 6(+ /0S66 { &RBp 6P &+GX $9Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T *&U0& U 0A Ah 6,(PD O}[NK@D@D6d+!+P t_00 5 % \6 S(+p 5S,+h 5S0,` %?RM5 c02?  5 % B QT<Ps 5P n @ S%<T E I @ )6S ,PPM&\<Q &Rp5F0%\% _=R 66  Qk T  UtX%\d\ p0\ |\\0\\~\T{ 0v\ r\ '^&0h\&^a\A '6~0#0P`6 S ^ʠ 6dE\5ox@\|\ :\^4\* -LM00PKpa@ 00p `:P2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(l*P0 0( b*P 0`:P|$K 㐬P@$0 R 00(@< {${`h<p P-L [[(D -LM( : *P( (( Q5 (K`P0 0S- =)@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0S)P0$ 0 Q (Q K( )P($00)P($00)P($0 0)P($00~)Pt ($0$0T)P@ ($0(0b{\`hxp 0-LM 0 P`^X0Q @0D0 T Q?@ᷖ 8hG$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"070 00 K0" 70 0`t - L7P\ot  - L7P\nt  -LM K00"7P\t -Lh脙| 0$~ p-L MP@`0KP 0S00Kp k\ p-L MP@`0KP |0S00Kp O\ -0LS@ h?.\ 0 << 0 -@L努b>0 0 -@L~80 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P <8@P  0SK0 Q0yC$y>  <' p-L0 `RP @ R 'P0 00 0 0 0 p01Q @ Q 'P0 000 00 p0Q @ Q 'P0$ 00$0 0$0 pp0Q @ Q 'P0 000 00 pp(0 0-,PL0@S ds000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 &deh|T p-x`L@PTd0 \ pr'HP@8p$0plp @P -LMR p, `0 P 0LS < חP1=@<T   ˗@Q ×@T` @a Rb:          0 Ql }@!` y $T u L &q?QPP  ( gU b  ^U XU RU  LU @  AU   @ 8U x 2U  d ,U T    H #U 8   0 UP0  P U  Ua@  U@ U U  Ut 2h@  < S S @8 U $    U  U U0S k\0 `p \$ ^ 0 R AdPd␐K 0h'Z%0 ^K0p4'O% W ᴊᲊ pG\W K⪊K⨊, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$$ @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp ppX @ R @; 8  45 02  .stA@t$+\!"0 04 t  2PFPBP>P:P6XhX0<l%$4Dl(A`Pq<Ue5Em=Tdxy@ )@aA\p$, -0L 㹺|@ -#L`M#0㘣p , 0x0 0S`pA}P#UH#rp a0@S<D`0`K1`x ` lPxt K2P4Kx ~2PXqL\\B6Px t:W`0S0 t 4` l h 0SD PKx@K 00 Q/ PP;P `000C S61|K !|0`SpP (9  0l0 00 Ql0S$h0S x2P(, 0R((K` t `` 9#P  0l0 xYPVtxTpTch`VXJT0 VXt@ht@`H@gt4T<`(4  -0L 0㪹|@t -NMLM0S( `@p2"IK\A2A0PR2 R4: S 2"t2Q0T/ 8@P> B^KPEPE0H"@! PINK2@D2`1@D2k*vKP0S: 2 RV0S% QPP( 0Rf$KINK@D@DP4: S:Tl5T<1c\ 0nP1K0PA A P+%4R%4R0 R s-P0S?00d Sޅ00HS@S0XIܽx|t@l -LpMP@"qp1 F0@-SD41 0bSQ`( S+ S 10pKᒧP60: S" 0 0 0 0 0 0  d _QP @P PQO  (U|txL@ -LP(@`&0p-+B@D 0 TX!h!\!\!\!!\!\!\!!\!!\!\!\!\!\!\!L! t0 l 0X @8P/ 0O  ,0  0  0 p=>P?> *Q-L QP!00PJ 9PE 4P@ /P; *P6 %P1 p P, `P' aB0S0SH8X:XH`0B8̑V BK@J0pQJ 04S   m@$ @$ W @0`Q 04S  dm@R@ VH 0` 4DpP (P 4@T000C S 4$ 0 a4 04S   `m 4$ H 0 H0ࠀXX XWM n@0 @pP`8 T4 \0 .0@p`8  @@A@HX0`4t  B9P0  kH4R O m@$ @$ ] m@@ VWT  @0 P`p<$ F T 0 0@p.`<  @@ᨌA@H4t 0'4$Rle l@@ jH4R O l@@ \H0hC1 0S l@40@4  l@$ @$ X@T l4@\@hl$( 4@PL -LMB0S007|"0002"000-HB0S00&{2~Ta @|TW<@TO1 RE ET@0DS?e/PB`PG <0@PD0@0- 18!0*0DS* e/P$@P @@ 05&0 0 |@Th lG \G<= `HD<=@@820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  m  -LM@ pH 0P`PBT 0@Q iK 4q -LM, (0 v@< 0p-H_ 0/`P 0p$,K 0 XXX 8S P 0< 8PS$K0@LX -p@LpP20` ````gaPUC 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0Poᬹ K !_0B 0S" 0H @P2 0t<S0Sk* P0xf.Ke/)PO 0<X 8|XP@d@,L -L*MgKJ0J e/ ,0 0: DP ?P 9P ; KAA  O PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ KD e/K@ c:K@0@: J :   P @P |PuQUQ 0ApS$ԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭ<ԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭTԭԭԭԭԭԭԭԭD8( ԭԭԭįԭhtخԭ8ԭԭ/ <0`p: @P 0STHK@ @H Op 4rlPP  07l p  Ke/PA =P< NKKAe/o 37 RR b@ P N L PI ǟ, 0R(KTn 47 Re , JP7ǟ e/;NNK@D e/4K e/0e/K, x l bUR l嫷@Pl  0Fq `@0p`p @TP0,,@ Pʷ0 0  0廷nU @@ 0 c5 R  [ \WU $0N VK0 $YE PB > <: 7 3ğ$00s03S0!n' Ke/P NNK@De/ Ke/ e/K @ = :db04 R L4 R 2 44+ ( $ P3 @Z|#00@@T   P~ Ke/[:a(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@6e/ K2    3 R `00CS`0QX0  X0q0 |:K{*KX =`2 RT2 Rf "+P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYApa`A 000=00C0Vx.St.JX  PPE 0SB 7 1xm;  @P e/K ,0M.((M%L e/@P,a 5pM@/-X= 6j<|)JHP`=4 <@Hp  $ rdAxnhpDpL3 -X0L R H0P808 0,bC]CX==t>("! -Q@PL0. P0 R 0 0oQ@P`0 p8W  0 \Q_d cC0@ 0PV0@0Q@`p`Xh=h" -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0Q_ 00@TP 0Q00 BL\ 000SBQ0 0 X0@X$ KK @ 8 P@4B=`= =X=h""m" -?MLML$LD0\,0 P`040S- S! Q4 0Q Q R30QC00, 0 R(KQڐWB0p0\?KK(@D@DV ?{KL(pGLCpG(0K8  P0(K  0 P?KK(@D@D?+㵀PŸ?+㮀P㨢00?K@ 3N@ PdŸX@'  Pw ?K#N @ Pn^0":BR?+|Pʡ^^!+BC1V\ pǏ 0(@K 0?KK\(@D @D PW P[5^0L!B0 !0T01 R DWFPDQBP@+^  A0@09^  A ^ AA]  A@U]X A]T `XXh,#m$#=x$$\## $\#L$ # 0-QL@T0 R 0 P0 @ 00 Pڜ0 P ;;Sx0@@0P@L0 D(A0], 0$ bA`Xh===\%$ -?MLMt0t` R   0RKHp0S?KK@D4P@D?+P嫋XX`h  -r0LP@4 mTP< P002`V%Pyڀ;;S@[h00`2 0SPPU>TA y42 Q (P>@VU@@Tʼ!000P]0 SX ]0SE \0SA \0S= TU@H}@<1 4v@$q@ 0Q 0O Q ,P@`@@\0S \0S \0ES0X@0y\T 0P ~@@6@00`hXT=%l%\%&%@% -t0 l0RL T@ 0H R,P|\ I@XTh4& p-LMP K`@ P1560P/T  5020@ +,), 0`hPKpT 0 ,,00@@ 0(#,  , ,pt&T&d&x& -L$MePp+x5tp5 llu d%d5PTT`U  % P4p 5Q ~0STP ]P T,Pd0: S   S  S00  0p 0Z0X4X$T4L4Dq[0S0C00Z0 P6U #' P[0#j?Um t# P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H K4P00Z00V;;S\ @1`V 8p ?Y1!``0Q 0 vZ0 >Z0 >LZ0 >X0 [>* 00 KZ\ 0x >h==lX= ======t`&=&&&m @&&'('' -LM T0St0Sfc0S3 RC]*P$K ig0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@GP[2@0} +0 0nrϻ00d2 Rl2 Rd `2 RxL00CS0~0  0(24 aJ嬻0Sy B*Ps0: So<08@@k16n@f1!11 R^ XAP[cXPlpX= ==\<>pt>ԯ='\'==@>Я=''' -ML MdNK0 @Dx $0 P PHT0S $ 0R KXY$%= PLY#=3 R 3 Rs@@P <@6P 1P 30S S S l3l <`<\#00CSL<NK@D<<8<4<0<(=PlPg &,[RW %<[STS0B&SPX4X4HP'10<$<|<z<<PP &<[Sk<Pc<_<= P$V<! 1@0@0L<x1  (1 \B<X@<e0L;<NK@D86<NK@DbLP,< q0S 00cP000 @0@0;X>=($(T=t>Я=D(&&X\((<)d))) L!*(*l****)*`)<>t((L*) +d+ -qL R Q3!  0 XRO PAx` wP`V 0SDQ@%@1S!#100P!0!  0 P " PZ `Z `FVڌ jf lT;`0 R PK;8 `00 R  ?;p=d+<+ -LM衟 0, ؑ0`PpH@00 T0$P1= 0S, Ut1 RI d ;PP @ T 00p34P9 P6U0 R5 :P0@00  ,0K8P P@0S 000(K 08PH:8:(:꬘=,,+=,++ -bML,Mⴡ0,0 P70DP10 P,x1 R.Eb}K(pG$pGTP0  0BS')P +P2 DPK`<0KP0( h=&, 0R*(K$ P Pb]K(PE R,PE0 <P`D0K(P'P  X>>! -ML M0,0 vP=0DP70 P2/P/5 R /P(Eb}K*K(pGH $pGP0  0BS )P ,DPK`<0K1P 0( X.L&, 0R(Kb]K(PE R,PE0 <P`D0KD+PXD0SL4 RZ(Pc'P.DPK`<0K\K(PEPEGP0Sx 3 R}( 0SʢS0S3 R LK(@D@D+P0Sj h3 R ( 0S0 0S<0S S(3 :KHP P V P00S SJ 0CSDPK`<0KX0S B0S 2 Rt"00CS00  0000S3 0S0 42i)P+ U "v9%1 R 0 0Sc)( 0S^( 0SO@PDb]K(PE,PE0 <30S dA0S X1 R=@!00CS0>0  000X`D0K'^U 0 )9v|00 a-zDPK`<0K-|儃\0 ЫH0 ˫ ߫w ܫXL>>D>,>> >><>pH>p,\,! -L%M$MŽK5HU@(KHd%,@  P-KL' 0Z/S /0 0 0*KL5%K(II wKLPnKHD0: S p8, 0R (K.0[/S b8T0$8G.PP-PT4 RmK(`F(`FP% 4 (K )PPt0S3 R5 :KH5@/Q  bKHP #8ZP  ,4 PP|0Sx H3 Rx a=( Q0 <SHy/P%P,:KL%.$PB0S2 R  vP0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000Mm-PF"d1 Ra=( Q@ډPX1@1  rp(KP$@P'( K K(A,Aa=( Qڐb0 _E,S <7UK(A,AO cXTX> ,,,L>D>,>->> >>=4><>p!$- -L Ml 0,0 p@WP P0,P2,$00Q.B`CPz(P3 , Q# .Pd.P V 04  3 R(K,PI+#WX<30 SS S p$P,Ks+R P, -S0"6+2 R6R0S S=ڜ2 G"000 P60S \R0S P2 RO4"00CS0r0  000,K+`p-P,PU~\,PM11 0,4 K@,K`0S XQ0SV^4KQ..PWb=0Q!&PO`20 E,K(+@0 R 00CS00  000P`P,K! 4@0  ,꬘L>D>>>$-h>>=<>p -bML$Mx0x@ R  v.P P L0 DPb K@$@ 0RK 呀D>X ! -bML$M 0,0 @P T T 05, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `Cb}K(pGT1 $pG -PX ,PDPK`<0KP AP&P0S 0(@P>*wP0S @0S ,-P+P8 D0 ܱ00(X@-D>>t>p-<>'(!0 0? =A=t -T2LMR`u<0S1,5P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,(P 0  `P0SPQ~8 @0 0@,0 ==-t===8> -PQL`tt 0hpcPP@@ W0Pd0U`00<P==t 00b0<= -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00|=t===8> -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ == -a=LpM00UpE``a 0 cR#?S erP/0@TP0U0 P-0 0 30(KR 0 P0TK Pa=p Q 00C h3TP< 0< 3P 0 3==-t .-' -LM a a= 0T ^,  r  K ~ PKX0S`pP0 PU ?`p q@P 00Kڤ\,K  PU ? U?l1 R \1 P0%3P ,\ 0S4  (KO!0R30SK! P$ a=x Q 00C 020S bOl 0d *3<0 RPO$ 0$ 3t=P.8..`.. -LM Qa  0p" ,0   KP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00Kg PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  D2V N0T u2<0 }V,0 R ==h>.8.P Q-LP`.Āp 0cP 0OT @ F ?PU`V S0U 0cP,0PP==t 0-D0DP LP0,@  `0 0h===t - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0Z00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP==== -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l 1PPPH1PP 0@x=t===P// -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P0X@P`P0 00 0 0 0S @0  NP0 pj0 <D 00 00T8>==t===/==x/ -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \<"0P4?;0記=A======0/ 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|/0 h?;/0 P3@h(W|Q  @4S4S  P00q=& -$L00; Px0F#0  00 PmP 0N0& Pc0V#0  0 PX P^0 PO n[PDVP? Po000c@`P300S S, S* S[ 4b-  0@na- p0P`@0S@b-P ``6 0x P] T0 t)h[t (0 P)X0h>q3qp3 (,$ 3d0 h> mQ-L eP p4 mQ-L XP x4 -2L pRPk nPdb0@ N 2 H 댢  B x2 < d2 .6 P2a-0C 6 am` &% 2 > @ F 40@44!00 N @ V 40@44!00 ft1 ^P@nzP0@0Pn000c@01P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh> (,H$0 KQ-L P 4 p-PL`LPpb-0 @ y1 s1 mp1 g\1 aH1 $[41 *U 1  00P ?P+ !a= a= 0 A aM@ ;5P0@05Pl 0: S 00 0 <x>55,5`5 -@L!WPB 0h%p5 -!L@PB 0h%p5 -L@Pd0dP A0S A08 %(0 R-P t>̯5> -L@ 0Pd0dP A0S A08 %(0 Rx-P t>̯5> -L@Pd0dP A0S A08 ^%(0 RP-P t>̯5> -LM\@ 0    |0 R p0  Q KJP K@0 R0 K0 JPUA0 !%갘5 0-LMPQ@0P-0Q   0;0Q*0 R0 RP 8a= 0PAh 0K0h$P0P 0;P0 l>> 85(, -SL0M@  0 0 0 R0  Q c K07PKL0 R00 c K0(P@0 $갘5 0-0LS@P04 00S0 0  000h>8 p-LpM`@KP X0PUH0 Q Kp0 Q $>6 -LpM0P/Sp/00/j`K@P+ 00P ^pP0 R PyP0T@  /0pG0$Kl>? 0-LpMPK@VPK00 R |0: S `TP@0L #PU @0 #>X686 -ML\4M T4` , ( pᤔ ,$00CS6665665 q#ß, 0R(KPPB ?3@P Yڌ3 R3 =P0\## HA#   $3 .3P2 R84S 2P 2 Ru 2 pB0SF R0P0Q0S<"0;0QY0S8 TB0SH2 R. <2 0a=Cf}I.K B B$ (K0pCyP4: SB^KPEPE!p@C?! 0 #U\1:P  P 0S8A0S,1 R  bm0 t0C @IKAA,P40S$D0  d@>4p " X6>(,660t>Яd>l>>8l6ԯd!? 7 -LtMpPK@P1 R! 0R) 0: S/ RPP >0` R "P X  KX>0p e" 0R H"P0 @N">>L7(7`7(0 P0C 0 p-LKtM @`KPP0: S  0Kp 0!J>0 "77 -0` LK$KP P0P p P >X0p RD0D P0$ ! >(,70 R00Ḗ -̢LP b/봒00@T) "0S@T B 0S 0x0t2l 3P P2P~0CP= 0"! 2 `R. qP00CS00@0;t0  R P- U. 0S ĕ@;t0 U@ڕ@0S0@q< _P  P@0S10 2 V0@0E 00CS000P p 0 S 兕  ᝕l R=\ !ᬒP @ꬖ==H>,80>p 87p, -<#L M0`S$$1P 30C S1AAtAA,AAAAAA0" " 2 R D0, K(0K3P0,( 00\"  P b]b-0@ PpK| |@Dp O2 * RV  R,  R1    R 0! P;01 1$K R1    R!  R`1  aL!0!00 +P5<0 0 h h0 0S 00a͠ 00  00~PJw<0SuPCn<X ; 0 | =88>l8L8  88@8 0-0L R0@T P@T 0S0S 0SU 88r@T0P>@k8d0 R00T0 RL0  D0 R80 R,0Q 0 `-긖@>=$> p-@PL` 0SpPP C@P0/S/0C0T 0SD0 00@ `PPPPpcp9 9 -0 0R000000L R0000 R0@00|0 Rpl0P PT0 RP()d>=p>`> =>H9@-PP:P 00S S R U3 /R07Rࠓ, /R7R10P0CUࠃa0AVp7@AW0A  W UPB0A A0A R` S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RPP Q `K0 HQKp\PHp -0LXMp Q P@ a ⹵t`K 0@0PtK4@K  0\ 0R Ka=@v(HL( (0T@@hP>X 99x9p! -3LpMß@0 ßT S, pP`$T2 R0 CR s00H, 0R(KHp2 R /T2@K  D2 R@u a H뀐K 0@ '2PK0C@1Pf0 @P @@妏!00CSBa 囏tA G0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X ŏ 0H 0,8,$8 #4Sa-0x8

>Xp P>(,9999099x9x! -DDq0LSP`$1 0S 0P00@  @ P00:T0S 0 ?@ h$0:S V0 lt?@P@ 0-S8@00,0 0 1 0 =`H=@99 P00ᐘ 0P-L 0SpPP6 0S# ,o`P00=i@P }P 00 P0@V0PPSx t00UpD0 :L: : -L 0TEkd:1@ -LG/ 0G8k;@ -L 0;,k<7@ -D0L R 0 Dq P萘>?@ -LpM@`pKA@冏0P 0@ZP 0: SU /00K70LSP  ,Y0 E@ -LM K`/ 00s@P04 P, 0b0CSWTWTWTWTWTWTWTWTWWTW,WTWTWTWTWTWTWTWTWTWW:$6U* 6 @P 0xS# S *S @Pr4;U$5$;U%1$?U! @P d!#pU @PTTT 0-LMKP͌@P 0 S R I0P   B@0 0 C8@H0 <0 R0#30@6P=p -LTMp/i됟P0000@tPd/0t x `0@/pW 00@JS^x^]]h^X^]H^8^]]]]]]]]]Y^]]]]^]]]Z]]]]]]]]]]]]]]]]]]]]]X]H]]8]]]Z]D_]]4_],___^\^^^^^]^? -pt0S>g -= /0CQXZ] Q1pZ1@TZ pP0`VQ T=pPHtPxN:!P @ P,PaP%X= R  !Z `PVJ@JP\ x< p T-@P <Pp=" P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P sP=Z+@T @tPPU p jPPJ *YPP[P@9 R  Z PUJ P 9P p>PI h2@P |)0Sp)8 X8 t0SH0S 0S mP 0S70(K PkP8l8D(8 @Lg ('L p 60@DSfffffffffffeeefheLefdLeffgffLefffaffffffffffffffaffffffffahfXffB  P!1 h" Q<L"0S(!x1 4"0SH0l0lkktl "\!01@Q񟗲hhhhhhh@P0 P@ RP 0 1P@0SP1 bt>Я??=(?@D?(>??t?h?\?P?(@ԯ>T@@̯pA@4@n9=@dV@@PP@>X>D>>@l>>@>4>>=$> >= >>`>=d>p>LA,>`H=0>$AxA!Ap$? 0@ A|@? :8wP1 R (Dy R0t0 0 0 x0 ;@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T1唒2` H@⩈T 1<凒BP2  `B0X000X0+KP*B0X<00X07PB0XHH! 3 3  $3  2+P20 R @a0BSm`m`m`mm`m`m`m`m`m`m`mm`mmm Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P 74  5  5   5Pl,5Pd`5  x5 5  5  5SPI5@kP5   O5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 ;d6  [@6 @0 S:Q >P6 R00CS010  0 <HD'0 0\\'0 0l ㄇP ql  e ⁇o ,Yc p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$> p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0pA p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@>@T 0UP0蜘@kB -LcMK M <KK(@D ,@D KK(*K, K$8 嚼 KP b-K( BŽKHK(B:K(H K@ KKK8  Px3(K -KY X1 p! * p00Q  X #R X[ K*K0* R &R@P \R  U+* R( &R@*K80/S89S6 K00CPaK2@0Q S``V 0eVO P  U:hPEK"(K00a Xp 0S  K@0 S@  X$:0 X0H KQ *K(0 -<[SL:Kh(dh-<[S<, 0RE(K0 X*0S:K8S K(K:KK A(˻KT"K KR(/0S K\  K>K(\ 0CtK>K@( 0C(,"]-KꘘX XtB@4BPBB! -MLM`s0\cP$0 0S0S 0/SK0S.00 @ J00C00S2 00S2P  0P 20SSQ SO 2 R0$ 0R KK @ <B0C<0S0S t>BC8C\C hCCCC!C p-1L`Q% 1@T! t1P 0\10S Q6 0S0T/  RAp000pp R0% ⦁PP$  R/00P   @0 /S/0C0 00@p\00 H0 pH0 R4 R/00Pp蜘@>$>0DD p- 00@LTP$ 0 /R @T 0 P`0@ Rpx0 r3p PL0 R 80 RpRP00p >@> -@PLp 0S|&PP `PaP ` p`P8 400PPPPLDdD -MLM`0PP(0  R 0`S @\S@ R 0S e`( 0Rd$KpP<  "PX00 R @\R@ 0S  R  H5R 0000S!  PS GS) h0 0gS pS0000 S0 0P 00pppp000\ZBNK@D@D ;[ 04ᶽXDD0ED!E -0LTM0 0P  d@KhP  Q-@0 R d@KO X><>E>XE -L(Mp4PjPP 0S [@P  0R/S 0R B/S@T cP T /003HPKzP uP pPv kPi -3ß3( ,PK ß8@K0 $0 , PF8P>  P=80Sq  P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa Px+!E1 KQc v@0KH0 D@ |@0KH0 D@ t@0KH0 D@ ls@0KH0 D@ dfI+!1 aP0 TP MP FPl0 RmDLH>ET>\>FP>P>, F8>EEE=,F-1^ 1!3Ș,H -L` pR @00B S R #T PP~ .RT@ 000G S8 ЌX|0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S00p 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @TU /\pP 00@T`  `00D0 S 0,TV`0B .TQL@T@Pv W 0S 00 R MR- (CR1 0  000S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  ᧺P000 R 0` ᒺ D ኺ, LFF4GĘdFFGFF p-@PLp R @a0S6 #R. \R' ᎝P@9  1"#200b100c!QR 0S  RP% @ 00 0#R@ @\P DZ 4 T  O Ș/>3=pGGG p-@PLp R @a0S6 #R. \R' P@9 n 1"#200b100c!QR 0S  R㛿P% @ 00 0#R@ S@\㣽P D 4    ̘/>3=G$HDH -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@!!QU`@ p-T`L0S P0@T  0@T0PUpؘ -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q ;`VZ7000ИԘ> p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00pؘ/>3 -\pL0S ` PU 00@TP0`V' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00奸h袸$qv -MLM440S, `p 1 RQA0Q( @P"{BP) 00(00 徠 000, 0R (K0/S BKAAI;Pp ` 卼P (0  ${ 2UИXԘ=hHH! -L@L0S 4 @00P[ И=H -@@L0S (PD ؘ=H -@@L0S (ػP- ܘ=$I -@@L0S (P TI -@@L0S (㪻P  I -LpPP 0"#200b100ca R  R 0S0SW@P BzP 80pP  00@ᐷo ؘ/>3I -p@LP 0"#200b100cQP 0S P\ `P 0@0 00` ܘ/>3I -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  2 / 㯼P 00 tp 00dP 0S 㛼P `$ 000ܘJDJ -0LCP -$L@pTP> !a@T ^P @T c@P NyP IyP 00@PAP 哶ᑶT኶+yP(JJ|J -|0L@`TpP \ AT  P @T W0G0 -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! 僱0  S;00 S0000 00CS 0"㻻@P xP 0 0  0  00@800qv J -MLM"@0T,0  pP! @T@T 0S00S3 T$!!h, 0RH(KX@PJ Da 0Q : SP 3$!ድa= 000@ 0SnK`F`F 1FP  nPa=0 S0Ÿ$\ HGR#@ ,XG KT>KKK  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -t6LMl P, f PK PPKR  0P T4 LR2010"K+1K1K d4".K|0 P"K  ü"K">KAЃlp ⺼ 0P S0S 0\  0P"KXtp 0P 8S0S ,0\  0sP2".Kd 0jPa=">K  0P2PUwl2b"KB X2".KJ }"KcK 0>Pe"K}Pb R7000qa-1K1K <P`@0S@p">K|  0SP^ d1 A".K|5 0K P2L">K|6 0KP'A0 pV O0"K#0  0P$wp_ ">KB $"KJ  P 0S S00#~XDL =L$L0MA(H==L,==L (>dLL!@h -3LM3 0A, S D`| |> 8(>0(,HNNhNN OON  Q0-LP00S  H 4P  @@T0 0A= -L MP0 P0ೝ #0 偹03#pp0K0C0Sd@T#00 @i0< 0#00 @_0  d0 03   l0 02 t0 20  |0 Z0 a 0 Q0P0OPL !a= bb a=8"0C G 10@, SUh1 )x0C ,@0/S,0  00C0(KQa=,Q`< @0S@KP!  0 )x0C , ,, 0/S p| <@0S@ P`0`)` 0<0  * $x> |> (,H -LPP -LPP 0-LPᨸP@ᢸP 00CSt0 @Pd0@ 0H@4 $00 0 0 O=O(OXOO --LP0M0 0  x0 R l@0S `0` \r LD rK40} r008>><>t>O@ --LM(@ P  }K -0- LP0M0 0  0@ R P0S0 |Qrp ԧTnLX LErD NrK080} Fr008>><>t>O@ * -D0L @R  >P zs0 0 0-L[@PptlPP \tX0P 0s40 R $ G0OL>OPM 0P Q0A000  B@ Ѝ 0-P`L p 0  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S? -L )^NO@ -l1LM0l  y 0D8 YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ 1Q0^l0  L00@ @'l4'@T (KPpPPX@PP -|0LM0 K R@PD0@ @c@0 YKX@@>X;-0 CR 0R0 SZq00 0-LM@P0 !P~'))x' 0s' n'PhQe'UTPE@H00S< K0h( K0hqP(QDQPQdQPp -@L0 0Q 0 $0Q0 $ h+'lQQ -L@Q񟗤4@pxLWQ6(08@Hlt|YWUS0SO #SHFDB@><:864;0Q xt&lhd&T!PhH0 $#$(,"(h& Q Q  0S&hC <8#"hx&QQQ R0RtRPRRRRRRR SDSlSSSSSSTT@TdTTTTTTU'W` p>#*P 0@$4,<4("4#! d#pW\ J TX#BS3  % 4E 40Kc00@000 ' 0)[R00@ 0  0 00  0400L40 ! 40<2S@K(P ֮#K K0 KP&Pl!30 3@ *0K@P(30 P3@ )0K@Ph30 3 00KPBH@KP#<0K@P Ps< 80R\#80KPPLe0;CS00\Lb$CP#0PP 2Qx"Gې"XR0S@ 0g b|y@p a0 hA0 02qpPP@lKPKL`K<0 @2 X0 \@ 0     \K0PT TK8 0R@P,0S  :  P0 媩 @ ᡩP R ,0S:kE@pX`HX@{Gz?@XXAX?Y@@,YDY\YpY!YYY?.At@YT@YZ@?d@8Z@Z?ZZZZ [([4[@[<d[[['[`@ -1P p0u03W0SL`F 1ᱪ`P,*W# L0S'0S 0 U0/S \0S /S   0S /S  \0S*`0XM|F - @L R000!M -LA6L 0CR1 0P 0" `000 L0S X1` P1 P`(p@W  0000 坫0001dU0 a`o@ 00C0S _00 0S 101>,a0` 000|F`MM -L4MP04   0 < @0  K00 ,0 (0 $0 0 0 0 8 p@Kz Kx -ML M P00P0Sp, M3Q  0P1#\CSAEKI I0#X `$ d 8 4K\ 6d3&?ἶ( 7 BnK`F`F 0$l#60 c S1 Q PP1t4 p(0S, 0Rq(KS"V0EOo 0 5!,@ = JPh 01p4 ( l ( h(,"6O0@ 0l0!0(0PS1ApP^ 1&噪!h0PS" }p$t( 0P( (PD0&0b0(!6 OQ a0h0C0F>0&iUl (w0PS0&  T 0 R t00 v\PP < 80oBXXM|F[H\HM\\L@ p-,@(`LP0S p P  L0S `00 0p 08#80C S PPxPpPhP`0 0p0000000|FL p-L@Ah1PS* 0S" 0 : SW@ f90S VH0S 10f1ph}l|P p\0 P@ph *,eM\\HM\$]0]@\ ] -LCM M$E~KpGpG 0,           `$ d \$ `0$: SYx@p#d0S0X,P$ L0S@{0 44 ,4P\4 0$KXT }@T40 0SN h0ࣟ: S= P, 0R(K 0S 3 @CPP[ H3 PT DS@#004K\$ XD @A$0 %2 Q 20S BKNN"1A\0A 2 0!00c000l\#0 0@PRY B Y00C0%u!0S 1 Pd  bPE l0SZ 0WkPS  5d4s d!G101T0 00(:dp  0S 761?<BKNN+4K@T 10C1$p(0SZ X\8]HMT]M@]]D]DMHDM^]XM]`]]x]\^t^4^[ -MLMp0P@AnK 0 `F`F 0  U00U0S0 Ut 0RK&@eP < 80 Q ( ;XhXM^\^\  -`LMd&0 H" @cP 0STYPPW 0SK 0Y,0 ,0@0 p p @TP@P!:P YU3jP\1 PF(p`0OQ PP P  @, T000000S0ST0S  @wh 0TP0PPP04 6  6OPy|F^ -LMܡpܣP, h 0Ql$0S V0 P# /00S@0@, V E0 @0 o 0 2 5"@0@ /P @ ,,0(0  0P` d,@@.@,ʝ0S0S,彝$ 0zlk?|F\MJ@^ p-0 P!`UL*@PP 0S 0 @0VP \ 00\ <0 0S \ PpLFTFM p-@L,e,!PL0(S `0 0S0 0 00 lSp 08#80C S, $ < D 4  8#80 0cP 0` ,G p````````|FL 0  M p-`ML@P0 dP T0 `0ASx M00x00x^M^ -\0L@ሤL0 P 0S P 0S *MHF_ 0-P(L@T0,oP T00T0S 0 T @0XM 0-( 0LS@P 0 ,帥, 000 p-d`L0S TPT 0@1@P䏜0S劜刜000pHFTFLF -@LPz00M -@!LM0\0>$1 \:q`\!50: 1 Q@(@F@  ,6" 0 0 6P,0 $F! 0  0  Pݣ00@ ,0#0Z0L 000(K H{D0D  MXMM@M|FMMMPFM_MM - @6 80(P@ 0L 0cp`@妣먠@@吣P300@ 00`S lPᑡP P,&|FMM@MMMMMMM<_ P00P0 S-L30 P/쐟0S P-*`$F(pP@Z,6 R0`00=K뀀m$FB00,0# 0 `$F0P5P@2*XM@|FMd_ -1` LV@p$`P  %#T*V&0 R  05"| P%#0VL0 R @ 05", M|F4M____ 0-PLL@T d0h0 R \d0T@0d0x0000,0 P|FHM `\M_@` -0L: SpP` RHh PR@l qPq\` -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`DP( 00P蔀0 0`3P( @$K$ `@0 0 /&8$ 000a 0G MXM|FPML p-0 : SLP` V pu6pl0@@0P` 0-LM@  T00T0S0 T8{P'0H~P 0 R d0K0 嗄 D804(`XM`h`HM``O` -L`p1&@B_?F PP1d(P@P( 0叡0V 10 A `   g! $ ((dPd 0RX` 0 A8`d00P|FMHFLF@FTF` -LML 0C\ß, p@  L(,P dß, 0R(KPCL8j6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0ᵯLH2 Ra D8pW8 :O4HLT >L@?88pS@Y RLH00S00   LNK @D@D01PLg@  Q $1D(000yL4 0] D(000mDH000gY<< P*D< 10pSH8  H(pR0S L(BNK0@D T P( P@D0 LPPP0D0`0DjP5L@ $X|FL%a @, 0Rx(Kq BNK @D@D0Q35P@1&C1`/E1P@! VPP1\p&t 21C` OYR+00S00   BNK @D@D0  P & 4P0U4 6 #1@`p YR   0? ;PSd4"@p  Q ,(0$ mX|Fa0P"Sn@00!0002  0b1  ~{d1 RO 1P7KAd2@0008 00 |qtnlk dh\ TbL_zD\8B0?0([`L(->K P j XM,bTsHM4M|FbLbPMlh 6 Sh (KP_t3 R  X(C H 008 P0\ 4 (< NoPU=  PE (K0 w}pB0 0S1P ,00XP!D2!0/1 R f_ 1 R V0 Uh0S1 R HAQ;P:00@@# P@ 0@S 0&"!0l 0CS @JP p00d0 St0p0    pZPe QSP|FM \$0S00$L0S$ `0! $5 ("( B R\ATA@LA@DA@.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p JKJH$ 0 N,6 1RK rK }P$0Sh# 0 9&.hPM0S{ 0# )1&hP`1!̑0  1 +d3 0ASH$IKKK$I ?,1   1pG1[0S1 S,6!0  ,6!  eK P l2&1峔001&gP,B H44. eKP 1&ᐔ00&gPA{ ! o,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1 0`S rKP )'h, 0R(K! |@1! 0 w000SL_H'X|FM4M,ihiiiMhiiii\Mi8jL8\00 ᄙ|0ᄙ0x -LMP o\j Q-L@ P TΊ^lj P-L xP Q|j 0-/LP*,@P 00+8/00,+ X+T00@j p-LpM/P ,@P KSP0: S Kp0`rS@x f P0-L@P0 R 0 R 00h-*t0 R0h0l H0 R <0<808,0|jO|j --LM0 0 + --LM0 0 K --LM0 0 K -L@) hX; -LMH0@K0PP`AK<P0: S V@@ S00S F`PP$K9P T P`0 R000 ]K@P l1: S 8I((Z>xEjjj --LM0 0 V+@@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |Fp@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0|F -T L@HP4T( fDedAkk -L`p@ᤓPPP5:Pa0@0S 00B S0"a>CPP R R,1,,!!00@ S c.O P 00C %`fzP0Fx3 @O&6F n  Pf @06_  h?P00`CH\hk8k P-L@ 00 R$hmHMkO -LM0 Z3 ?Მ3s ;@P (K謓k  `w#3R 0X 0@cX, 40 "8 @0E8  OƉ 6F&V3 ($6 0( "0080S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+cP 0 R04 0 / d0\%8d0L `P@ 0R@X  aA T@MMPF\M|FSkXF\F4Mlktlk0lHl -kMLM0',0 7K@0AA`@`6 PP6: S 02PR u먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@݌ ڌ0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 %P0S fO4 R}TFT0SpP% p30S uP, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VX`ZP `3 00B10@B3P LHC8`3P 0D3P ((3P 6cS00 ,20!6 S 2" B0"S[ PY &$% p`\P@5嵟D"D2t|ĝj@@)1 R_a,YP @0S@@0@S H6<4"D0#@1 ]P @0T!1bx\A1\SHO@"8H(B 1R  zXXFMDMldPFHMTMm\MMM\F8MM@MDn4M|FXMM o mlhnnml0oMMLMMLF@FTFHFlnn?Hmmn nhm|mmmooHo@\look@htn|ndL@-0 @BTx00 Q< 1P 0<000  MM `P0@_8 0K@P ע|0 d0PR U#< L 4(K0< <Mrr8M8r@qq p-d0@LP`\ D0l88 000 0Y `Pp|FDMNPF 0-PL@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@0B|M|FNMDr -$1LpM R  1 qf0S!  p@, P1 P@T P ᆡP pSp`0SxKPL0X S;30`P<9808X00 $KpNN@N -qL0`S8P00@T P@T# !P0SP@`0S t ዞPP@XT0 @T$~@PxPpNT(@N -\v0LS` PW00CS00@0tR U T` T 5 Rk 0 0S`0 CR` !X0M  X0`0 CR` )X0-  X0@tO 5  0 H 0SX`0 CR` X0^  X0`0T C?@R` ş .X0 X0p P0S F@t0S40#3P50S$6#3P4 R 0Sh`0 CR` X0$  X00SG4ğ`0 CR` aX0X0pPP)PP 3R0 S3 0`003 R TR 3 RW # 0T0Q0SO pp XD0S06#3PA 4D03 R 0SL`0 CR` X0^  X0`0 CR` X0I  PX0hp0R QD)F@ $xxDpP} YZNMDkDpP 0S< -$cDpG^ ]DpB 0Sp T?@SD.^ODp4 0S] IGDp, P"P4p0RAX$ODpp0RXMEDp 0S `0 CR` p0RX-3Dpp0RX^*Dpp0RsX^!Dpp0RtXIDp PFPJp0R RXDT@@pNPNN@N$N NN\r N -0L0@`TPp D@T /PPp@`8U|0 R0`00@TPCPP @0p,$0 TN(p@N 0-@PLc!Mp( b0@S܂̂0\1\ X CL1 (!$p,1,!0S1 R% wDP2 堼L 0000 0 000 0000 Rl0 RX0 R00 RJ<0@hr|@drNNN N$N NNf -LL0 L \ 00 (0 $0 0 $V4VxS(V -0L0 (V -0L0 (V -$$ 0L00  $V(VQd d00A00d0XV( 0 QPxX}-@0 0 S RPxh} -(0L00S 0 (V0S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D gx40, 0h蹖0 VTVTTSDV0V5i 0-LM@ᐇP@K㧃0[P00KybPPd4\@\ 8x0 000 (兖P wK0|}}SDV0Vi } 0-L M4PK @0 jPp\l  x[T0DT 00000 40402KSP$EK0S0Vi }DVSi } p-,`M@_L0 P将x(N< -T L0R S S0RS  P0 商|(O} p-L$M<@K$ ``P忆\ wP P< 0,` P ʺKp0VDVi$}i$} 0-L M4PK @0 Pxt w[T0D\ 00080 <0<02KɕP(㖺K0S0Vi ~DVp$0 K0@V,V~DV0Vi -L M K,0 AP=$0`Sp 0X000 P00RPPU@  㷄 ᲄ  @A0SS c020 K$ p-L MK,` 0 AP<0S H0V000 P00 R0S P0  s PBL0S S c020Kp$ -0L(M08@K( Vp Gud0 \圓Pz0S@f( 80 000$  K VDV0V6i(4TD -L M0p$0 00|t0$K @W<$0PS` 8ε40  0 . K VXT -`L MPp@Kp P$t1 @P+< 0S 0,0 $,PKSDV0Vi  -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X ԃPPJY t H0 0D 0s 0D0 V Y yP8u P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S ዃ0PP0,0 @cT dT@(KDP -QL(M5K ! @00 0K  # eP D@0@ 50K$t00 (50K0wPiKSDV0Vi $ -QLM@ K  =^PP K⧁&@K4 s(0 Lp> K4DV0ViH -|0L0@S h ? R00S L00  |,0T, @00 0 0 0$V4V(VxS -\1LKMp@DK Q㾂0W@0 < /P RoK`F!sAP /т000@pD K$0K|VP ' 0T$0 R  L(0S 00S Q  R ("(04"40$= K X-0 CR 0R0 S9=00 Q-L X6 p`@ -0CU3@% R 0S,,<0SR00ӑR00Hӑ<@ 4 R @0 S0SpD -@RLP 0S 0 TC 1@0S<p `(<<0C3@ R 0S,x ,<0So|<@ l R @0 S0S400S(>hT>h<hpp p-LM*@KxPx` ᫁h @pP  ខ0 01Kp ⴵKpS0V:i x9i  -L M K0, @9$0 x\p  0306@K|P`x  `hd @岐pL  @rKᩐp0v K S0V:i x9i  -LM"@K @TT0 L@刐p [Q"0[S "0[ S DKS0V:i  -LM0@KQ !  P r0 [P L- 0`p@P0S 0   0S-|-;0lS v P;PU@K0ODV0ViȀ܀p   -81LM@8Kq`P  ẀV@! V/P  0㩗p@ 'PK 0fP !400`nPR@P 0 & qOP  9$K04X p-L M.@K `hP0 @小p'  Nq00SA[T<0K 80SK XT001K,0H 刏p4UKpS0V:i xH 9i  -L M Kp,`0 Y8$@\P  0ͱ t000S \±T4PpH0 p@h  4*P$0 t@l  K@Bt(VXV꤁ꬁ p-x0LP @ T 10S ] p:lx0 {[Lv[<S`RV( u@Ld(fEed0SB0S 0B00S " Q:5P +X00SL  8>:x07D php贁pȁԁB ->ML@M|10ld@K PHL 9p 8収pP m0S=g:>[KD@K$PE@PE >k. * ,P 0` p oP `40S >KK$@D`@@DP?'-0tS  X9P|@40HUZ<V$K,AT 1S1S1S(Q$!000C S0:S Q $ [7P`T 0S,4,c6QEV@P T "R0S x@30S,P-K 2S*0S' , 0  0 }0  0nZhU"Rd0S`\2S |[`1P|!A tO0l 倊P01S H10S  5|0 10S  x500S 00S `p@Y(KS0VDVi i8i4iiiii$ht|i|Bąȅԅ@h8x$@Hi pT@V,V -ML MPp4 4$4Q|x4Qpl4Qd`40ST ? @n5U 0S 0SS0XVL@KJc( z k ՉPW |,PL`usPx  \( 帉PXㅮP{ <0 <0R$ 30S  520S(( 50 20S))|4p20Sd  P4@H=ZP20SP` pA00S UAP( 5`,0V pWP`oZ10SAQ 4T0@$0$@SFNKP@D/LRKLQKy j1H &P/K4[S SoKL[ <P UP,jK[K[ 0QppPK OKL[K < PUP,j 0 $KODVST 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K 7#@ 2#p0RX B#@0 R0 R ` 0BO?%t el  b@P 0P 0@kX #00]$ 0@@0v(Vp@WWWē -0L "`|@ p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@"Qpp0R0 S"pPW -pL@P`nP` m Fp00pT@P a@Tl0 P @ gP@0㕓#PU`pW*LWP@д0PW 0-LM@P  K0K PPep (00S K0LWl|  -L MP@ `$K 0PPep $bpP 0 PPep ,00S X l KLWl@0P0 R0 RP] -LM0 Cr  0\0 Cr P \1 @,K@P\,PU 0   0 R$ PUQ `PD 01(1$1 R Q @0翸0@S,Z&p`@fP @ T0 RŤx`pPh` d0@pAP 000 ,徚$廚帚Ț̚Ě -p-M L M0` R P  0 R 0RKp  \dVT ANK@D@D08 *f $КXԚ@Ĕ p-LM0 0`L0<0@0R  `   0``!Kp800 S80<@080<@8@<@LQ6 Kϵ0@!<@ 0Q =9A =CD H H00D R_0 040S@<@@<@b0Ϡ AIl$!B30b0@@<@LQ 0,D a<0 R@0<@L0 ̔$?BĚ\@BCHؚ -LpR`PW PPJ`a@PV ` e` ᢣ`P/ XaPL z0V\0PPPPPPP$0 ( h(0S<0 0P000 P0000B 0S0@ 0,0 [0dh PX [0$8 ZZ]|̖0 -@PL 0S@R 80)e0PdS J 0 )ꜗ@P -L$MP`U@ 0S XxXXXD  ẴpH 10@<S< qp7 7pg RP0S6  0S 0S  ) :  )P .P0 80 @ #KP\0S1@TTPo@ PPz0K= &@T PL0SGD00Q  R4 0S0%000S p DD5 C00@00=L0090060030D0 040SPL0S DU9 W 00S2Pp@TU 0 R 00S 0000S_0t$ pD0Su Q H R 00S T0Sl R(KHFP000 P0000000`V 0#@i0003 R 0ST3  0S/P  x30S 0@i0S) /P :*P )%P 嬵PᘶH ,0R  (Q  "31C0La1 @KQP=ں3[ 0K= "@T"aH0S00;,00cS b0=9 = B 0C!00040 Q $0< 0bS$00$00p,0X00#0S @0  Q, 0RB(K4!)Z,!$Z *Z?@P 0D`p 0D @P05F 0Djb0 00  @PY *dZTX<`TPVLVY@V4<$, -L@-?j누9T 0p3k 0p3;P p-`L VPU ^ 0 0 )R @ TpQ ^ 0 0 )R @0,S,^t B @+P R T00S R @0   -$p P:p( D -L _+p3b -L M4 1`   0l 40VG*0 48#8 p40QPf=0E S[*YU @,K  X, <( 4"4,<  ,0 @Up  0!48 #8(p`" "[04"4858#40S(KU 0KW3[ $#$("0U:"[Q04"48#710S`41 D(<L -L8M 0p1$ i`P.VPR@K .0 P  PU iP`PU$ 0R  K4. 㫖( BXPx -LM P0a0@%K,K0pK  0p׃@t% %0[S S , 0( K02[d#!4 K00C4 0 8#"$KĠ$ 0-LP \P @0)S 0 00 0S@0Q 0)S0#0CSCBBBBBBBBBBBBBCCC8^ 0 W zdDT -4L M Rßp3S00@@@@@@@@@KU "娓0 0j0m)Kgp3Ƞ ,Ƞ("( ",D3!, ̠( Ƞ"(,Ƞ! 0^0 `a2 pt0 0````uV8#8 $#$2p` 22@H0KL HP D 0 @@ <@ S/W00S@ RC02 (00P (K m t00@@@@3V8#8 Ġ#Č )V p|1@0K$,0@,̠<Č4("Č!4 <$̌8K 8 40 0安(1 @t00@U8#8 Ġ#Č U p0t0 0@@U8#8 $#$pD0@ i0Rʉ\T^ _D^ `X^ <x(pH -LMP |0 R 00  @d @ @ @ Ag K mK80 0xA(0 A;P0 0 Ph<,@@0` 'S0-LP@ 0h(@0dS<Q<8J,J,J,J,J,J`J,J,J,J,J,J,J,J,J,J,JJ,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,JJJ,J,J,J,J,JJJ,J,J,J,J,J,JJ,JK0h001@U 0$ 0h 0$ |0hpl0\0h蟻T001 80h},꜡1lQQġ -CML Mw@0 @ 0 PR񟗋MMHNhNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNOOO(O4OMOO, 0RKQ񟗜PPPtPhP 048< ("#Q{ Q Qt *t 048< ("#<4,$ ~{xu刺NPK .0 P g .0 P ]ZX 048#8 $#$("(RC\QPQDQ8Q,QHD<B 048#8 $#$("(RQQtQhQPDy+(s;p8m5j2g/d2  @ Q32 8pl2  / 0`S fC -*Rb L$<80( Q 3-SRNPK .0aP 1 |V( ppMK @D K`@D @@ 0Td P 0$. ^:. Y+NPK .0.PX̢0TQDTdtУܣd̤Uh0RQ@XD(H|<0 Uh6 -2L4M  , P@A 0Sp S> 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0P V x 0S @DT, 0R(K. 㢑X  dT`XPX 8&DXXp$8, -FML M,ENK0@Dp, P4 0W `V Q 9   k, 0RI(K0SX 9    Vp 4 P| 0S - Sl ,I0    g ȟ08 R`00CS`0FX0  X00  P ȟ0 ȟ4Q8l #8 4  0x$ t4 DH(04$48#84 @TP7 4< 0<D 0x t <x$t4T> <pD xtPxt$LDxt Px$t4 X  048#8 $#$("(R *R 0HS0∄ l4 P4 DTmK`F0`FHp4 P4DPT :@TJ4[S 9R(K#D@PT $$ P4Qw ßp$06@P`@"0 N @TK TPPD0jS'U <4("4!L,0G TA`V@! T,Dl$R t ,㔝l$$|d1 R X`0 CR` X0)  X0l4P ST,xc`Pp0RX) ) lP`L`\P q 01  0 8P4$RP `x$ j jrXDDHWWp ЙP _LXȥ@  Хإ^W@@4<$,0@hL`XdlxT@PX -NML?M? $ $ $ $ $ ,  h$       \/Fp= E0@2S2sbbsxsbbbbdsbbbXsrbbbpbbbbbbbbb`onnnln@n0nm mbblllbllXlbkkbkkr d.pX>@dXXpH1aP00 p Ο1 1 0`JKI I8^ " 0@D &$Pt0 R=|= `0Q  N=>P-0 k4S- -K B B@@@@@F>K@0C @"0C D #Pl$0S 0͟0   00 )YfPull ,0 և fp` ̟ 0Sa  ,0 R t,00`- ANKP : T̟0Tڴ+00B0S Fz[+0 00000000`@K0C0C5  \ d)* 5\ ep D-K B B0$ * R44:0  4 4 ˟: 4eP0 ʟ$0R pspW@$R$ 4S P 0s 00) /d:   t)00P@@X04 .PH_ 00) 30 ) B0\`pP UFnK`Ft `FP@  0"PGl4 RL_PDPl} U@(ɟ0) h$R ɟ0RFNK@DPh(0PNeP9)0PEePsɟ@)$ 5\ @9eP+d9)% 5@0eP9(@7 @|AݿH;Q @$@T8^(^ǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@0{P PP7PƟ 04 H0K4 4 4 ̤ D Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50SPU %5 &0:;:0{%0<0v%0:;70o꜕EKAA 6Pb0 R^ `4 RZ%PYX%000QDş 5   H %080C ?݅PRДEKAA jP-0 R) `4 R% )ꄔEKAAP0`S `4 R 4Pz2t@@+3 0-8 39m2T3P#000CEKA A&4@ R `4 R0 S L]`304 zPd#0 00^D#0600#0@00bEKAL L0 P d$2R 0/띱R0EK0AA `4 q@h 吱0S 0 R `4h$TQ (P2, *++ 0S @A0C2S2plpplplplpplplplplpplplplplplplpplplplplplplplplplplplplplpplpplplplpplplplplpplplplplplplpp0SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'X^^< _`^̫_ \@@_?.A'XH|`H'Y@_DԫܫP^8ZD^x ('uxh-TZ0D@L$`ħԦp@(XXp`LXȨlЩ @ XJ.K B B@@@@@@H1TQ@ N"0 D P0( Jp1 !090~!0701 0*4 !080~"050yFnK41`F`F@P)' 0lD PbPl1)( 0P|bP( ;0S22 0 .0@>@$ 4 /20GP-   } 3PW03@R ]PKT0 G dC0S? |~b:0S6 ~b13p3 =K0C 0C 4 KI3 P 1 0`POMT3F>K0C0C@)& lD aP8 ` 00) 0t   0,0Q @@$ -F4P @p$)+ 5\ apX$E>Kd 0CaJb0l4 f@Ph5P 4 xx%S00  4). aP ]0 Ps `) 0`aP0s 0) `aP (AQ 0)3 qaP h0pl$wPF.K B B P4[GKA  A|4 xD 4 D a6 R=;Ҝ|̜l$E.K B B% ) 50ap3L~\\T |Tl|t| ~| z| v| r|||ڮ00f|Ԯ00`| \|)\ W|~ ~~~$~,E|4~\$0D<|P9|X~`~h~p~x~'|~!|$|z~(0 S?˴8ɠE>K@(0CX @`a 0-8P8@L4 J  0y@|4@h - Lh갬 -AML MpP$E0`00 ,0 7rP dP jP4`- aP* uP zP# tP#uP, 0001c|4pp }p `000C SX0 $$hp00S4@,0S 0K⽁P }Z劜p 1 dR 0+S 3D4  D$ H@TPp00F S.VWpqP`V )W0P 0p `JP` 0RR!>C 2#=S0W J@ PRh(~~@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0(XQP l781@T%$10S @K⽘p0M @0 c8K8 4@ :p 8K8 40 P7| P %㶛HQ 0+SD HXڜzY T {D(CNK@D@D0D$9 P0@h`HجĬȬܬQ8XL`pG-M$\ P!* =c?0$"B(0 c.00B `Ñ pU0@\0 0  `Q㰀\$ Z`F pЍ@-A\@b ʁ42C=C000 \ = @ R ʁ42C0C00 0 R0 -0L |@ -P0LMH @K0*0$F,0 $Wp zȀLW -LL0L r <@ 4WPh1|@H|H$W  -LY p-LM@ K``"`Wp @ 0P0t`@p ACL0P *FKp,8z ||LWȀ -0LM@0P`p0W0s 0s!,K P,00CS44W (00W(00,K Pp Kp -PLdM`X[6PP[&PF VPl6l6 h`VPPW@HƟH*}G4&,&,62 & F?&t5ş% ş< KP0K @sT㼅e^\ 00* 0\ 0*X XTd ͠` \0N @#(K#z|zpzhz뼭ح%W AH$W tVΝ`L?@{Gz?~@rȭC0 S S  -`0@P@@T0 La <00S 000S.99̀ -L?@PM/ p-L@$FP `6p p-2 B 0L`@0PP 0S00 |2P $ -8L2@E0P/S @P,EP$2 B 30S ", ,,, 1RjP @EP`F ,V 0+S-S0SZ*PW*P *_L10S S*PT1  @` XPg,P`T@D00S<PUPP 100S 00St0Q. +'29s8P1PQKp, ت 000ᄅ 00@`, 0-L@PU0 0 LlH -|@L0p0h L0\0L L0D00 xL0,0 qL00 LHd\T -L@`0X ]LP0@ WL<0( QL(0 KL0@PHX`H  -L@$000P h  0 0S00'L0HD@ 0 L@H0 0L<H00S 0  LhH 0 L4H 0 K0H -D0L0S (0@ThVh{ꔪ 0 0K,H 0 K(H -h@L0S X00SL0L H0K@00S40$ 0K00ĪtH| - 0 @L0 0KT p-0PSL`0S <0 S @Tp00Sg,| 0-0L0S0 0kK|00Sp0` \0aK\00SDP@x,0 T@J$0 0xHĪp - 0 L6J h:K8H p-LM`fP& 0S0@ |CP& @T PC@}0\ BH 00P (@K 04 [C2KpH\d -L@P h00ShI者 -L@P 0S0S00ShH者 0-LP@P00S0hH0者 -L `pP@P0000P0S00@h -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000Єtx| -LM KQP![A[R0 @mP x0t8d P00TX0@PZP 804%$ PP00Kht@H -LMP>LE0PHKP @P@DHP00 P00e-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  H|"  `2 @A00 0 P"bH2 K@-1 `P0`S@ 2  BG!  `1 @A00 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  K訰xTP40<@(  8DL$İЀ$ZH@hptȰx8|@̰D<P@а8HL԰DPTذX\`dܰhlЄ(`V04 , -2L,M0P 2pPpLPK 2b0S B00PP2pa nP4 2P+ KP, P 2UP/ PP(P, KPK, P9 1P, KPA%P) K P<) P0 K P6) P- 1P0,|1 +p1 (d1 %X1 "L1 @1 41 (1 1 1 1 0 0 0 0 0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L Kv}0 KXH,X -PRLp@S*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ<U  ip i) 8xȰT0@-T0P?0" 0@0S0S0 R0舅00P $00SCህ\p@-@00Sp($$,F6PI`p舅P<0 5-=?0S> 06S000 ,0 0@S200 ህ 0Pህ 0- L0S( 4 @ 0   04@0Q@ DLP 4r 0T4v40@0h%0舅 -0L Up0q 0 -0LPU5 40 0@044D 0S040P`0$44p Td$T(d,t$0@044D $ 0Upqh5(舅h -0Lp`PP#70 4@0$($,T044Dt T$F P 404(0$00 4si8 p-L@ 00s'0@$x -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4SU7P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0Tp@Pq4.'H20dtŸ q 00010*b%ph P'(1 4D0O4D0P00/0d4t`10S% 0S0+K H&S<10S01pKP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(K舅  \$@`dh 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0舅 -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4舅 -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00舅\ -LP l0 P 0R 0R Q0$4(D0,4舅 0-PL@T 4 j 04P X00S Cpq 0hH0 0@ p0舅\p$ 0 010#PQ0S4:Ss0p 0 00 P p-L 000 x 0Pd `,P @ r 0 04 (0$ Y; P00 , (0$0 0 0 ᴇ0 0 0 ᴇᔅ -LMp@P `@_00C0 S%"0 .S0K0 $ K K蔅 p-RL@Py0` ;TUp -LM`p$ @PL0 `p蔅 -L|@||PM$pK(`K  R(0S0C(0 0$ 0b0 0R 0 000 K蔇 -LMP@p`i;   e0` p-L@LMPK@%T;`@@00S x蔅 -LMyP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$K蜇H -H0L0S00@@Y$ 0@00蔅 -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 ]00S C$K蜇H 0-P0@LT0 0S0 <@/800 0P0s300蜇 -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  K蠇H p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʉ"000 0SKp蜇H - 0L00S L蜇 p-PL`@90 Rpl00 AP@*D0P0A0Q: gp蔅 p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphp( -LMP8|||p`,K  ,P }@TN!,0PT@:0S0 0 0 0S(0PPḇ -0LMK0 ! KȪ -LD#P x0pq  T0 hH00S <@ L*.0S.0SPK !>P 2 P L>d P p>0S E P =D>U Pz 8^0S2 @T1$@$PZT 0S:8NP>0S 0S6>(0P 5?;r>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKE+Pn@ @K0@0SP +aGQ0+sx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSptH( d<|T  (PLDT`lP| 0IRQ|80S0SL80S8q  2RQ80S0Sf +0S0S0@W70S 0S0S@7=  ? 0S0S0@9 ) 0S0S0@)60S'0S!#0S 0S0S0@0S0SmP60S6 (6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )# k0S0S0@!0S0@40S0dSd0@h4\4m EQP < :{0S0@(4 8 /,m!8 8KR%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@GP hP P %g 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P kx h00 1! j X0H0p0PN 00PJ 00 PPE PC ,Ȧ4܇l ԇȇL@h̪\x@ |؇ı,d̲HthtЪز̇0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000S( -LMS0P`p2p (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(KPD -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0@ 0< -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K, 0-LM@PK ^P8d/P  0S NP 88 -LM@R,  *P @- R P`Pp /1Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00 - LPh< - LPh@$ -L hD -LMph) 0-L MP0S$ @Kg 0s0s cdP@T L0UH0 %00(0 0 0 K0ԣ`dPM -@LPE -LMB0PP 0S U E0,K0 K00 `P@@00SpJ<0P42p0,0 A P8  8Km8W%X 0 zO%D K%I%Z f fCP, 8 8K|10SP ,!P P8K8` yPYP ,cpZ$1 w10 @ 1 P0 , KŵP 0 0 0P@ $PG0 0R0 A{z0Ul00S(8K8` $(K(У@ȪDԣ`d< 0-LP@6@P \P0h$0 -`LP`pW!&`V@ZP PT 0  0  0   0  0   p-L@P`P U  P V  P php -L@h P-L 0h -00LP T hУp( -L@%/ 0r/S@ R -LpMK@jcPHK 0|EK -L0P蜳 -LAMPP2  0bEpq) NK,㰴PKp@%`@ 0S PP  } 0S*# P fP` 0S:VKܪ -HHaLp@P#R %RT0TS 0S %R #RP I.PP@ R_묐0ਠ`P@#R %RU0US 0S %R #R P ! dt.@ P R  0-D@L0PS0P(000-P0 -L M`?, H.@pP@0S 0S P W @P RX Y"'.@XP@ d \00T @Y- P  d,@000S0(K01ܳ -LM@pP 0S `PKh-@-@@L0H P`-" כ@"K -(1LMP, UARuOpP; -@-@,-v@`PZ0%S00sSZ,  R- -N-,-P@00@-T:@"T o5 -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP < -P U-@R- @p`Y0%S 00sS  ,:-@`00@1-T:+P5"UV 00S h10S@ R@)K P ̚B)[980P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R @R!,p@`00ዚ0Sp(K贪(p -L@, 0 pS` R0S000S,`PUګ,P@000S 0001 0-LpMKPTP@|0: S@@!K0 p-LpM0`0SP m,@1 P K)PPl00S0: S N,*@ P, +PI!KpȪأ<00S,0P 00S00C'00Sf| 0S00\p -Lp@P`WV 000CW`K@tPuZ :X`qgRpWZVX (00S8 mW  -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000\ -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW |UV jUVP@ y1P @1@T@ ZZP`!hpP`qX:p4q2P P AP!=T 0 0S0uv 0 0S 0S0x  Vp 00pWZYT+00 o\ 00Supl -LMp`iP P &@;P9  Ki`p@P(q&V 0A9P 00S CP@P 0p@Pq Kif 0 K\0PP 0PP < P000S SP000S0 0HP0000000   -0L`Pp@)P `VV'(` W  00P`p0@ 0 @ `000pW 000 H 0-@PL tP 0T T00 00C0 R( 00C00h0 H p-L@Pq P`pyp P P@P40`0pl@Pp P P00 -LMpXtWr`#0S PHC0S <#0 QPW 0@PQP B0S %$@ T T "06 P P p/ `B0* P 000 ,0 p|0 , 0KP0K0PK`p@ !0040  6` P P=ڄA0S9x!0S5@K 00< 80  @P(!0S!0S4@ 1@O P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S 000K@P*(KLԪt -LMpwx 0S P#0S t3tC 00S@_ 0kP0p , @P0p P:0 K  00 ,0 80K0KL0@K00# k @0P`Pڴɯ`V* @T PXW5 p@q P P`pR0gt T"@sTP`80S4!P00PUo-b  + TPPx1@Tl0ST!0; Pp@@F41P`@ ? P?P`@0K@PpA00S ' 000K@P*00SZ 0 P` D@ P P p\(Ko(KL\Ԫt -L MP`, *P,0@cT D dqw@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CT{ h00S]D0@@]$0 0@@(Kph̪ p-L`@PP  P p "@P$00S ph̪ -L`ppq|Dp@PqTh 0<UT0 h<Xx -L MKXK  K p-LP phP`pqP0  Bph4@  B@PQ phpt -LM`pp@Pq DP |00Sh0 W V @P,0 $K!oK̪xP\0 0TSP0 H0 D0 @0 <0 80 40 00 00ᘪ000 @00ؤܤd00S X00S P~0 @P 00 000000ܤؤ0 0  -p堀0L@&PP  `PPrY `L% `G%P`@Lؤܤ Q-L?P=0@P60 `Cp, PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@PLؤ p-Lpq0 9PP-p@) 崠`t T 0 @P00CV]P y@P@P0@`@40W 00 X`@PLؤ -L0<0  000 $00 00 8 L( -L0<0  000 $00 00 D $@ Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p(ܤ P-L0X$P P-L@ P0G$P M-LMP0X20 p@ 0(K>P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4``P00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  KܪؤHLܤ -LM0@#`p P@D\0@@0@T 7P \ 0  ,H -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 9@ p,0 0l0. 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ ``` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(Kܤؤ(ФPԤHtܪ -2L M`2 0 f0fR R @, oP"0L"S PP02P 00dp@40  004 0PpL 00WI 0SEPP &PpP3V!p0ŀ!0S0Wx!0l!ӷ0P#L! 0 P0!09!P0W !0P P  P0W !P, 0iSC`@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kܪؤܤ -qL0PS`@ 0 0Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3(tHؤ0 -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 8< Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@zPE(`@0 -0`p9pq7  0@P Y0$X!WP"`@0 0`ppq 0@P U0T 0/`p$$0S0  00lꤪh 0-T@L0S0dS0 PP(000P=000@D0 -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0l0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z 褪D@ -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50SX, -50 S  RXa0@ S-00LA0@S0FHL 0-L MPP @K0 000K0 'Pp-L7 $P'.P ^P"L1L!@00 0%cP !1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 ,P phpHtL`x -L M@KB0s0s ?00@3KX -,0L R00F0@Bx -,0L R0030H@B0P 00P Pr 0 p -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 ? K10 -PLM@) T TV\Q@p ` "00C0 S10R!@š0,STT901 0b 00@0PK U  0Sp` T1` @0|T @KaT @K,0`04 0$K$@ KPԤФ|Tx̵@ -@PL ThL0 D5@3<18/4-0+,)h6ܵȪPP+ P P0꠪ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@[$808 0K10 cK0 @ P-L (0 00ShE -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp 1@P0t @0S  K0 4 CK,0K0 K $@H -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp @P0t @0S  K0 4 CK,0K0 Klpx@Q PPP0SP 0  0Pܤ$0$0S0S -LMK h K -Q0LM00SK0 W K -Lp@P000C0 S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,0*  ( -0Lhdܤ -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 7 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0e90S V0V 0 @00SSS 0010,K0,0 @V 0 \0   000CS<<=H====4= K4D`|h -`LPpP`$T X P$T T T-T00@f 1W 00P@T -L@0 Ҥ̸ -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 =1[X!0Sn`z`@YPPT 4@ p,p 000CS9AAtB@BtBtBtBAX@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(Kܤи< S 0 Q $ 0S C  -LyP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRЪ, -p@!`PL PQ  0  0  -LM d 0 K p-LMP`d@H002 0@?Kp'@B -LMp|v`e@b@@%0 P`  -LMKj -锠PLp` 0@SP0000ST{0S{0#S \X -L P P Pp h -0LMo@p@`!0K!PK  000e@PV-00e i K -QLM@Pp@tPp0%0K%`K 0$00 f 0@PW-00f ?$K -QLM@Pp@tPp0%0K%`K 0$00 f0@PW-00f $K -\0\0L@S L0 P\-P p5 0 0 茪h 0-L L0PS000@00 R+0 P00 0ߨ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  1 06(`P K 0-0L0PS@ t00Sx P0@0S @00S `$00S0 Z0Hh 0-L@PSD 0 0\ p-0L0 S P` 00S 00S -0@@ct0P0S h00S ph1XJ}P0 @@@400T,0 ph@x(Hh -0LM0  l0 `0Pp `K  0T0CP`@PAhp3 -LMP @` a\Q  0R QW@X@T11: \ 40K]p3Q 4 ,0 0 0 00S0!P$K -@LP900 -0LM0@SpP s 0Pp@ @8`P  4@Po9@@U 耪Pp p p @00C000C 000C?0010@-<0  0|0@P4 p 0q-  + Q 0%P#Pp@q 0Q 0r S 000 JP mP808 PHZ0P:j謩t(@h(0$0 0b0c0AVH@( -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0  H@(0&ꔪ -XL9P@L5D2</804+00,'(0 ,x@@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3蘪 0-L@PL<0  0S0S0 R0蠪 -0L  0SWp3 -L& hة-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0贩꠪괪 -@LPf00h.$00S0 0  ȩĩ̩ -@Q 1LMPp@  PP=0T0 `Kp@&&P@ p 000  0S : L0R  @00S 00 0 0 ̩Pȩĩ 0-@LPT 0S$  0 0ةh -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(K̩ -L@MP`X T0 d@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hk@L H@D ,LD 00K@cP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LDQP 0 `LD@@(Kĩܪة̩ -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K贩̩L -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 t8 00CXZ (Ko(Kp -0L0@SPTpW"0000S `zpI@tPq Ab9`00CVw0pp 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K q $0P$K̩`x -L 0 0S0 h -<L<P(h+ 00s030h̩` 0      ̩ة 000 000 000 -LM0 $ KK0 0 %P$ K -@PL \TL hrrs -1LX@ @@ -6Izu0  @`Pp0S0S 0` 0?0080  N000S irhH -LMLp`KP p@P0[SPKT[ - Ls P00O -0L |@< -LMP@ὼP 0S 0S1 S K R3 ╼P 0B?S⳽P (K⇼P (0Sp`$K $0(RpQ tP` ⒽWQP00 -L 0KM#+N -L(M< @ 0<[ ,0 8`pZP<@d @PP 00@@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00垶P8S0 00CS00S 00H@P!>>>L$000<!#0S 0@Sv #0P o00g< \x2 ` R p @  0SO ,K04 胷@T# I\24P"L"l2 0  H"<0P P R0|\Q0|  001 `80S1 RE |`\Th4 ,0K]@hu|b0 , 4"4@ 000 00D(Ki@P 0 t#g>:<m @PLP`D r @2@ Tp4 -@LMh w&>oo`p20p0`W` K -LM @`, pP` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@4t K@PLL 00npK`2@PΌ  0`0Vp, 0R(KʒX8 -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2g0`TX2i=ST0S0@2U D _R 0S2! 0 DD0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PD100e0P00H -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00`@P 0@<P 0, D 800$,p(K >d bU -L4M0t(K(0 O(0`S $pK0 p尵$@\P  ~n Kb0( p噵$0`Sp ( gnP# 2pL`K2A@ @N P0LK000 ;n -L[ -L!M(1`"( S92RS]2S\@NAP KP n/0p 0 00`( 0R $Ka@0/0`@?X@Tp 0-PL@Vm0 -L MP$K@p`0 $0S  m K"100!aRRl@0S`VXaLmDm@_ ?0mT -L M`(K@0 蟴(PpU  `mm$K A2@ @ 1P p-`L|yP @ ;`P J00ap5 [h5 X8 40R00 40 I80<@ 18 IS0$00< 0>4 8$0 $04 @4 4 '4 $ 4!00 4 $0@|P hP0LP @1*84 (4@0p`S`@0 @HLD 4@GpP3H 0cl@80T 3P)`ps@P 0 S 00KPX0S0#3 >\PP   D,PU< @R@X00SX00SL0  %H20S\"0000SD"0000S 10S`\B\TRD2p` (,"0QP 0B1 aP !<&!)Anp`0Wp10SMeX 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SȎ|гܳ`H\ Գ@̳س`p@ ȳ 00 0ေ0P$ 00C0 R0 ေ -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphp耱-0 CR 0R0 S伱00 -h1L0`SPp@Dzi@<10S T (10S 倱g@00S T 00Skg@T 00Sp`YWc80 ׺400S h  hBسp|T̳< -L3P*  -LP* 0 -LPx*  -L 30S:S0S6R) 20SQ b 0R20SR Zp2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@f X`f`0P <0KD0 @@ TPK H  -0H +0K) K$=p; T0L%S񟗰$Lx#000C+K *KH#J=p30V1P@`P@   0] Z P@, "P Py0P p@`P P P 5"000s20K ?p `B0 0cX2P R^ :Py 00@Td@Ta  P  C1 妧|!00070SQQQ4 F 0SC nS 1 4@K t!,hPPHP 01oD10AD0 @@ <0 8@ 0oS1 4@K 4 0PoH0S @H`K0 0 (K P | pDp,$0tx8زpܽ`H|@@hx|P|j`@00 ᜰ0ᜰ0ᐰ -LҤP  \j Q-L@ WP T lj P-L P  |j 0-/LPw@P 00+8c/00,+ +00$j p-LpM/PX@P KrP0: S Kp0`rS@   P0-L@P0 R 0 R 0C]0hzwt0 R0h0l3] C8H0 R <0<(]808$]M0]ꔰjO|j --LM0 0 4 --LM0 0 K --LM0 0 K -L@P` hX; -LMH0@K0 rPP`AK<rP0: S V@@ S00S F`PqP$KP T P`0 R000 ]K@qP l1: S 8\((P\ꐰEjjj --LM0 0 T㣂@ -LM @Tp`P0S ڈ 0P P 000褰 -L,MD H &L0 0@  0 40 P @?@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ xP0S PUWP80 0 %0 00 ğP0P00 @TT@TQ P<@PX! 4  Y4 @0T l`VR h[ @T P[@T 6`V$`>SVXg 0 0(K4 [k 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K ppq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt; 0`Z, ^^  0(4P?p][Y0\/ @T3 0Q  0& P 0@TRf LEPa 0 ||;0 FO0 <4h@@h4\dxl -LOMP"\垣NKp5QnK @ dp➀@T:+oPP@@K ᵣE@k P-L <@< 8墣 ,,垣t0 嗣|@ p-0LPP` @`P PS`Pp@ -LM0@0cSz bSz8 PK ; 0`S R  : 0 S PU0$ ā,40V,((0 "4^ LD ;P ,dH @ -LP@@s<1<Ppp`!08p mP Z &8p0 !0@S( W VVW# ]0`P 0jP P /0 pRpp8&"V@h|`H @-1PR  P @^! 0n <,4$<, 4,$. !,00 0 0@SQ:00a0\ <# \ 8#,8# \ 4("$$#  4S,   8#8S,,8 #  < 4<( "4,  8 , #44,  -0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S8P8 $@<840,($ @h@LT\d8 p-@L M0KP`  @ሟ0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 ,h -L M A`+QO                                            0  Qp &0S 00000@0 KP  0SKt|XX0  QPp <04  Q  d밻ؾt|  -L,M0 K@ Ҟ P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp KJ -P -H@L"0 0SP 0;0@ -0@LP pF`0 A0 S` a0A0SW`AA0A0S7`AQ\  H  8    0d0P*P2 -L Ml pR R P P`@0 (@K@`7(\;@^ ^ T$K耠P`0 Q  P  R t:  T1lX`X8` Xh P-L 0=5,0, (幝$? 0噧z|@< P-L@ L02p pS,t_GP~GP@| p-L@P`@DT(0-S<@P4$@DT!`h0h ph`@T y``(0 `}zPܾd -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S N \0 R \X>0R PL>h00R>h@p -pQL@ᬡ0S:`00CS`0YX0  X0xmp`_S``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ P`U I &S0S0C000@` VP  X U0 㿜X ҜX ΜpP p-LPL`@LDR0  0R$  php -LM`@ RQ |o3Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R pRT dB0P0 LRPW 0yZ  ${RX  tRY %@  iR @ bR`R!p m-, R TRhF(NR00 L 4GR8@T700 L T=RP1 R) 0 43R0! C$1 R)`00CS`0'X0  X00Sd0S`u o2 2<o 3@`8@% RH o講X o进<hPx (p$d -L M4B4r0 S P Q 2 0RvK0A0SQQ0 0CSp#p##H"t"1Q QQN QO Q , lQ 0 XQPL!0S 8`V;0 40 L @L@(`@~Qz0@KwQ1P oQiQ bQxx r xWQpTQhr2``8`괻X4Ph@\ht -LM0@0 4 80 CDxu/ aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@a0S4$0 <400S0C0PP  N0@Sß0 30S0C0PP  :0@S0 30S0C0PP  &0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  0@SmT"0  t20hS0C0PP  0@S@g@02 R (Ky0@gS@ W1 RQ bPR,0SlA/UeP 0SL 0R!0S|B  ) ( <@A0K0C0C@ @ap> 1 R1 1R w8s`9 8  0@FpnK`F`F+&bp@@0S p.$ K@ @ʻ HL0(XоܾԾPT4t8p -4L0M@PT`4\+PEU50-S"@PX866H888X866(86666686666666666PU  ,K@?0貓, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 P  0@@py?0 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt 嫐Pi 4 0SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1&`PNP00P0 `1 R0S?0 `7 (K0S0C0K?00Ps?0 Rq Kl=S 0|O =\X PKYꬻоPl Ծ<H $ -PLM`P0*ē#)p1 T0@"S"=;;;;;;;;;;;;;;;=;;;;;;;;;=;;=;;=;;3 ")p2p2A*"P "P0`gSX@@cP P 2 Rj |t2p T"0SXc 0E2Sj>l>>l>>l>l>>l>>l>l> >l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>t>h1 `d1 \X1 XL1 T@11 LP =    00  p0 0p 0x0@ @app pF7p ;p@ PPܾlоhԾ`HXTp$0 R P"!P h0@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0PP @@@@@ - 0`S$1S00CS|AXA@@@@@@@@@@4AAA@A@P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $d ^P`( -LQ 0S 0S S h-`h=0 ?` -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@P;0!`, 0R9(KP` P` P` P`P` P` P`P P P)`4 `EjX8h`TX p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,80Kp <4("4!\ZP@ 00@U FIT!P`UU U&Ƞ& &< PP;&Ƞ &<t hP1&<X HP*&Ƞ& @&<, P@ Ph8`$0 -LM@0DSHH H H H H H H H H H H H H H H H@H H H H H H8H H H H H H H H H0H00 0(hkhhhM@` -T0 ML\@4 <@زP ,Kh`T p-PLM@  0 R (@,h`xK ∨`P @.PP (P@T 8h`` p-L$M|Ÿ|b0 S P? R6 @!T#\JdJJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJJdJdJdJdJdJKdJdJdJdJdJdJdJdJJ"RH 90!M 0RYKp|,qlpA00P! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.wP ,< B700[S S/0[0S S Q"[-K04"48#8 0 .K0h/0[0S@X`L8`@d 0-L(MtP9@K0l 0 0KS00 R00G 0RK0nhXp p-L`!\P@ p0R0S 4 LF. 4F$phF# FT p-L\P@` !\ "10Q0S 0S- S ]T)0 R phFpM 00S S 0004"48#8008 phF 00SphFh\@ p-L@\ `PFTN  00ESOO8O8O8O8OxO8OlOqF00CSPPOOOOdFaF^F[FXF R R |phPFNF RxphHFpFFhCF`@FX=FP:FHph6F@4Fdxlt 0-QLMP@& 0S S Ux0 R h 0K0hF U04"48#Ƞ08hE0 E8h@0@SRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ$E  E(@P  -PL$M@C !P- 5T H ldd \\PP L1L E@1 R;41 R2(`00CS`05X0  X0K  0nE@ 0@bE0 R Kh||REX Kh h4p(t|lHhpP 0-LM@0PS$ @K  L@@\ H@@X TQP 0v  K0I000D -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T C0 <<0 0XS0[  r( <D4Q<aD0S;00`  B LR` BX0X00K @$ @D<1 R 4Q  wD0S `00CS`0,X0  X04P P `]D0S 00 L y0 R00p0R PTX g@eXd@Hxp(Phx -RL0(MH0  0CPP`HpK,KD 80 4 @ < 0 P ` 0@@Ep770 S}@ 0@@7pm ,Q8V V*@0@Y0SZ0 0 R0@YJ`ZZ@@ (K,0P 0D < HP @ 4@ 8@ @@p7 ,PV 7 V*0PS@ 0PS p01@YP `0 @@p,0TLD<60*S $~~ r 0000 W0700c00B0200p  4000 W0700c00BP -- LM 0P  KP 0> -0PLM 0- -dL @ᰍP H 㪍P 4 㤍P  ZP ( -pPLd!`P 0@0P +R %R0s 0D 00s 0D hP P@ Rd P, 0-@LtP 0000 hP%T r 8000D p 0D00PT-0 CR 0R0 SR00 -l?LhϟM080 0 P<0 ᐉ P" 4s 0 P2@p  P@p  P"@p`r ,"/`P 0S U V T x 0  S2  0S` UT8 "PB B U0P/S4P 4 40S 400ST   0&P00S 2 s 8 80S8X ㎌P80p 8< ㆌP80p 8 "P " " W 0S "}0\/S/00LP 0S00@@P2 0S/ PP:P   0Sp "R o*PT   "*0p( @008:*  0@Sp  "" V *< <@t P02 2<K@p0@0Kd,<@T 4  , @ @0S 4 B <0S; V@ 0D0 H0 P D0SDtH0S Hn h[0D0 @0x@K dP  8UT`H :R0@@Zp@4 KHwP P0P0`P0 P R 0S *0S ʟ0S#g#寊0`0S0S*嫕*<!VP P H :0S/ 90S+:R&Q$90OTS 90S9#-9#t90S9  p9 g`9lP@T `g890SDPQ0[S ]fP 0 :SSp`  :wf@P00 Ko7T00 00 7PK0`K 0@px70X p@K d'P0 0/P  02! 0P0lK<0 B 00   0 P,$ǟ0S' 2 < <0s# < PJ30S F3<0@A3`0@<0  00p@K00@ 0تPPU0k<0S 50<6 0S6 OdP`@*P@PUPx@Pd"P00  0@PUPP8@T 50S58  "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P ᵆPP\ %P@@$0H#0@X  P0#5ß3#.`40SL4 Έ P p@P " P K(P K0BP0 P R  00 S S  WP P,@K LK> ^L0SPKPP 2P "0 S00`ڔ`"0@LKP KP @0BP0 P R  00S S S  ㉉PP@ᝉPP0 L0 "S5 V2  nPP,2 @"Pp @P\ #1PP0S18 \ ᝉ<0s<4 'P!T\dp  HJ`|{x(|T p@  D  L @h X      L   3Td H 0      X8| Tp `t  ` d00 S 4|| @ @0S 4st00S0S@ 0D0 H0 P D0SDSH0S HMIP0D0 @0a@, CP L0\P0 /DpǏH B:"b0@PP @ ,p@4HPP `P`U"0S 0S 0S#:#傇H"0pÏ0S0S*}P0SH20S/ 20S+2R&Q$20OTS 20S2#3#K 30S 3 43 >D3CPQ h.x3qr P0S0S0S 30S 3?30SDP 10P2 2 )P\ 6 <0s <7`'2 P8 (K -MLM0X ,0 \ `$ $@P 70Sk,0@ =PH  0 S H$ PD  0SD 6C.K B0 BT4 d$ ,0\: P ,0\$ 0PP4 H D ぇP P0 {P  Ɵ0PD`$0Vpa^P k@PH$R P`$FpNP4/p:`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*TlW P$0S,0\ pL  L$ 0[S]P P0#03V0S @T 0:S*0p0@T# :u/Pq U P00S P:R V  R0305P1 :P:ZPt`PL PW 0S V @@V 0S /bP@@@`@ß0Si(#U0 @0 K  8K DK0 K40KpK埤 P 00Sd40Sa80S^ V [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHCP 7500S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMD@Po86D@ 00CS, Kq4H K1@ţP ,575-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,40&0S le@T f$ 00 p`'D  PP0S((0K  # P `K` |ğt\hğ\p/D 28$P,cV 0t0p0S \,0KkPL4ȓ0S S ß,  ,0KWP |, ) ,0KIP,@P00HΟ@P 0 , 00 $8 X` Tp L PD D0S = 0RS 0S  R00-S 4> {0S> {=0S D0S   \= 04 S< 0@ D00S0H0 , ZPMr0SMP00<0S<80S88=P`P,=`*0<0  8 RxPQ 00|SM P>~$0S z$0 S $ <z8w< /8W@P000T  T T/00P;0SQ$0 S P|;0S D$0 S X;0S  0S DQ(;0S  ;;0Sz :P P-D0S :0 PbPU   POx 0 00S `V%$PH:,0 :`) 00|S @ 8., ,0S  (*P0S00:P9 y, ,0S9p 40 90S,0,EFKeP0S;0 \i0 SLI 彺P0P0$ P0: S ,)0S009  M80S N0CSK8 00 80S,0,FX80<Q $40`S|8 `t8 j#,0lxL0JHP0S,0,E7 rp@Q#0 S YPdU<W0/S' g0S 70S0SB#y&0XKPo@0X0 T@ 0XKS#0S*帄0S000Ef6 'E`PYPPv000 # 60S3 60S 60S+6R&Q$50OTS 60S46# 6#py50S6 5 cy5hV ` V "Sy%0@Uz Yqpnt,E  , 6PP@",9p50S,00#30#,x"p3P "00 P@T@, 6P"0S @0240 S4P 4P 40,N TL00L0 Q N0Sm#xX0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,"PP)0S, +, xT t T 0S,,x0@R刂尢`p0p@`20S000@0!P ,20S,00@,!P ! L0S BL xO010S. 10S <10S&XK0S0S *h10S1#p1#Dx410SP1 <1 7x,1<00S000#3 0u!PP 0 S QA 0@00S3,00#32d\` |D ( ELhX$0@]plhT0L\<Lt,+!PP @Q \140PSl0`Pt0`40,<481@0S@ ,0x0RnD0Sk RQ610S` 4 (1R\ pP V 0` P0`K\0 pKt1PK@P尜1 0(w?@0 S1P 1P@ 10S1<  #Q01@P@@40S ,0S40,00S0xH"0S0S<8(K -\4LWMPpP` X@K8k g$4X  00KT P LP ;p!xPK劼P 兼P#xK 0{P#xK P0x0[S xKX K00KP pd  PH3 004`Q,,#30P ^K E000S  <ܗP,0S2 ev`P( P 0S* 0S 0S  <㲗P(,ˬ  @@`PUV1 0 3w\xq X0040 @'w4 K0@ PB0S (0K  # PLHx@A@x00QS Pt  00S 00 uiPPuwP qw 80K8 ,T0<0 f(KDx |T pPp@ < @|,< -,0ML  0utR|@P 0-LYPH10S 0P 00SA@ w00@P 000 t00S h0P \00SAD@ v00$0 (0  P0p|pL -L -4&46LAM (&(60 S&P 0S605+ 55PP5uP5eP5܅P55P5PP-@P 0S ѺPP ʺP xúPP d彺PPPPl L5L峺P5  40%P 0S50T0S 40@TN @@P 0S 叺P 劺P 兺@p@3@40S@_4P(4  h4p0Sh4T4@OPDTHDHP l660S5PU   P@ş` @Pşş!`@`0#K%0 p90#K%0150``Vdୱ#NKP\ş<şea0@%p0ş_K`pP`%5V;FE  U WX#NKṴ$0 \ Ba$@PX0 b,L$^4B0=ɌBJB ͌BS08BS *Z?K00K3 3 0`^c=iB@B mBb@P^ 3冞 0o@BT-P6@P#K ia0#妳 `ah#垳#^K`T<@<pP$#Ld0k2WV  0gXPڌ24^ 8"R#NK*"aZ#NK "a^B2#KP@P 0 0 0-PȰ@P a0!9 a!1ᙰ#^K`<@᫰<p፰P|!Ld0d1d0S0P :P#NKʳ <2S v]!@BT<W00S 00CS0 n0  0 mH@P 00x0x(KxXp`t@h1P.A`hxp0 -LMH@0s0 K7p 0Swt@ -L@P 00s@ -LANKM @D+`᳣"PP ~K pG'+@Pp8[/S)@ .P K08SS/SKL 0-0L0M0@S DPK0 ჲ 0PD0SHa) 40jP K0 -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxPP 0S`Rᱲ0 S0/R0 S?F0 BnK`F@+(0K 4R/S@/04B+d[PLh !X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PP 0P @,100CcSX108P 0p30$0, BNK0@Dk**P X000a$P 7@Pm@hhm00(KLEET |D -LM0 -PQ00`R0LMSpF ,20SB K"@f,^KbHPPAZPQPOK@D^Kl0!Q`$3PP,EP PU  0kt kPd!7P Tl(0KP@x0[SPlH0x@KU @p KPV`APT @7pP 0w03T0S +P X0 SpP h00S`0  (K!lx| p p-2L0PS 22 .k2 p2 R22PR x2P 0S\k.P 420S 8P(20S 12 j1@ @偡1 @{1 @u1 @o1 h10S1@1 T!0`0PV | ㅰ@Ph 〰@PP 0T.S@D0P008,!jTP$$ ϰP10S 1 1  V  d0 j R00 V   㱰P0" 00`ppP4@h$tl,G|| 0- LM0P@0P  P Kh0 R r X0000 T 8@,y" >j0P8|P -!LTM1Pp`PPW1A0 @0s 0 @0s 0` !P P1P>"000 0000,K0K4K(0Kd@K$ K8K 岐, v80$ d0 40(`0 00v.B\0 ,0A BX0 0D0 T P Ŏ0V0p0S@0@@ p0x\ i V P@D! i@0tp0 KP| $d -00L((\ 0 0ikF|@hl@ -5LLM % , 0-S ``P@CPp00`lp $p d0@ S x`XP$wpD4 U@P ZY $咲W p  pL p@H P9p Hp hpP UX@KvT00 T0 ,,#3b0S0jl0 `pl}`K 0S `0#40Sj@\K \@ *PS WV  p@ @ T  p0S 91p ^ h d `KN hK0P`@ 勬pTa0-SP pMU@P9 Q 0" l0S$  @=F0S (U"  , \EP 4515P@@uB zThX|@h$8|`LD4<L@  -L+ 0rD@ -GML1M a |!@0P$4 X!*p oP9 4!!p 0bSQ`A~K pG0pG4 %P3 $$004 4 =K 0C0C gP"P -P P A0$tA.Kh0 B B\T0$8D ,iXdH((``HL -LM@pP4 iPP 0S nS6 =M`P00QD @ Q? hP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K\/, ?R0S@p @ `0 p000"S 0($P 0 0~xpD<T -LM`PdP( @(K,pK 0 g(0@S ,$Kg0L&@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5  0R1$ $0 0R+P P% Q# qP P`@PP Q bP (0(PS ,,}P`@ Upp - LMp@`,K4K+0 0` 00B1R bP  0 <4 !4,<00 ,` ,00  , 4` 刪40S 0,0   0 R:(K -0LMPp`4K00 0, @4 c,0PS  [4,0 400S ,K:(K 0-LM@P  $ K@ @  $K00P $0K0 0-L@彫PP, $2pP@ 0hA $p? P 4P 1185;$%$0hY0&&4&X& p-`LP֠PӠ P Ϡ (0PS,ɠ U@phà@P -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX00`@TP& -LM pAn0 `, P00 I@P 00X0+4Л PP:d'A n t,0400P4 .0@pH?HC)p>?$(Ko7(K&h&&H&'(' -LAMJ_K, ,KOKᕪgfp`P#0S @ fP @T T | R 0SR( K0ACp 8=f`V000 JKp, (KdD'|* 0-L P2p@z>8 %pn> 0h0`'t' -L@㑣pP`8 0 0 $ $0 0 $ $0$ 00 $ `P DbP P =bP((gP, ,( @❨TP P@`( -LM, P<0<0S`A,i(, 0V 0Vd18S_4a@(0S,M01(00Ea@(0S,A, 0p1(( P,B 0!B0,( ,0q`(0S,#,0@1((P,$ ,( &, ( 0!a@(0S1S (00ԢP, 0! PU `X,P`''|* -LM@P4K H0S   Kp0 0 ha 0S 0S  4@K$ $`K PdP 0S pt @T `Pᔩ4pK@0PS @ UT $1 1P @ሞ`40(K  p (pPK`P ( (m   g@4pK0S  \@ T<0 80Q K'@h't''|*0h&(,(H( -L$M@PPT ppdW @@K$ ឨD Ꮩ8 p  0SC ==0`P, 5  ̷p  =),P@Q#PUT@D0 XP <`,\@0 EP,Kl(t(i$((((h&( ) P-L@`Pp\i. r 0000SR 0 ᝨ``P'R"R $R `R \R `F0 `F P@T:V00P$)XD) p-0L0S00@T,``0@p Pp 00\PD8, phpP&\)D -L Mp@p P lZhHp`U \2\D٢@P<H Ấ,R,,Ka( 0,0 0 2K1p  0S  < P 2[ p ;`P S"0S tA`0S p ; 8a0S D@KP C 30X 04 000 5@T00\0(@^0^0@N ; tH0s TQ>$Kd)Ep)h&|)()L& ))t&)*)x*)* -L M`*1$ PA1@'qP0!0裦p Pa*0pSj` !嗦pPU*``p0SR l!勦pP``0p0I:F1=U(0 (0S $1 AO0!opPp``+*P U {0 lP @`Pp0 aP @`Pe0| VP @`` BpP 5:DP(K{h&@h *,*\*p******|* p-ML M00@S`0 ZKPE*QTP *ㆦ P%*FP  K@*v P\%*TJK@DᲦ 00i/@.Kpt&++0+X+d++ p-DAL0S8 k$1` P@00S  0S $0 P @T00Q P 0rh@kp00S0@ ,@8P  000S0,phꌛ+p&5+p -LMMD1~K pG`pG@P+PK尥_-૥1!0x6 p& V !0K@QF t6 l& =8 46 p@ 06S B0 ; ;KSK?;05 050%50$H0 0 &&&&a  Kp&|*+h& -LMMA~K pGPpG0`+0KS_-N0Kt6 ,0x6 d& <0@h6 0S1!l6 p& 0SS0 ;0& 6 0ˇ0S R0 0 PK @@<p@ 06S 0 ; ;KSK?;050 0505 a0$ 0CST0%0060 666 0 ⊣Kp&|*,h& -MLMq`KP @@+@@KӤ_-Τ`1V 0Kt6  0@0f@P# @1S 10p`00S ŜP@T   00 (----|*p&.(.@. -LM0B0p` 0 pP0  0 000 p00匹0P0 @ @` ?KAQXtX0$0 40 $KΟ00X $0$#R 0?X@0S D@ K⶟0 0X c01S0X2P0X@ 00 @T ~ 0i/@h@0P 00 00 000|0$0 Kp&d.h&& -LM X10PU R  00 0 S   00A`p`@TUR Kj1S0P0 0= 000  00}= 00 00'<00 00 00 00 0,000@%Bp& -\1pL0`S@DP K#rPH @T @@PiK P61S$00$00 0^ ,0P0 @ +0S 00@0@0000 000 0@0 @<UiK ip&.|*@`! p-1LM0`0SS S SnPPfxAa0P0@P|10 \0 0S100 0;S<000@1S  0?0 000@2S  0S  B!   K 000000 R100  00 000 R1 00 00000 R10*xp&.@ -0L Y6|@. -LP H0S L0S 8P $0 [0 K0h&l77 -LM,KKPH,`@@A0pW<PP6 @0S#05 000p WP=SpP 000 E}00=0D0S ݐ@PXL  ㉆0D@`V$0D0S< ,PKt6h&|*7 -L\R\\r\M,Ks`0SDg X@?T,A0S * ,0R0``0c!S0/0S (qA!0 D <0 0KKK40 0S #K DKpc0#S- _0S) [)4 3[ R T0S (0s3[ 0S2[ ⸒p2[ 100@S 0S 00M p0s Lw*,(KL&h&*H&77 8  88D8p&`8* -LMPap00˒NK 0$K( $0_. 4@ 00 , 0+s( P4pK0, BP@K 0 L0 0P` Hp D0 0 p@;( Kp&h&p8 p-LMP0  ( ,  p@}(` 0K`?pn(T0X0@ `0p_( 00@Kph&88!8 -L4MPNpK02 } h`PP 0S :(XZP@P0D P @+(@0 HK88h&lB 8 p-LMLS8 SS<7fS7 bS4 eS49sS- tS% lS-&TJp +4 $ 0s Lp0 QQtx0:p@p 0 P p 0 @ @@$4 (o0ST3 0T00w0S 3 0W pWڔR t30C @P W@cXP pYH H bQ IQT BQLQb SQqsQj fQ lQTtQ xQuT0S"PE- r 000X0SR 0x"7P``'R"R $R `R \R PE0\  PE `@X0T:T0Q"  PE0O4 < 8#" ᅨ 5PY   0!pPKP`@.8C80@!pP9P`@ !!0؏pP* 0Q   PP`@P`UP:Q X` 00ƴPE XDYP PE ƴUY)(K萛;P;; <0<X<|<X|TdX44<aK -0L0 S 00CS00Ӥ0-L L \00! P 0 000p0 T0 p LPQ(0  B000pH**84 -LM℣儃C`Ppp 0  0#Pp P "P*3@P3pPpUP\PPP" P 00 U@T00S Rp R R2匂7\00A S-Q5P"T2PH"@8TpPpY0%xP00S P0p 000D1 T1 @ TA1弁  !0Z\JqH d0 00A L!P1PD!pTp Pp@B0 -P_P p 000 0 T0  p 000D @ T@" 0P D0 P<0p\0 00i84P**P<<H<L =pe -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000D**@<**L -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00D*@**<*L -PQ@`Lp "  0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0PP4****8HD@<L*** p- 18MLA10 P`垍   PR^0Ӆ۸00S H@ F@0P80 D @@ **@0>4>* --LM 0 X $LD @D00S ,$ ȣ ģ K,"@ --LM 0 X n$LD D00S ,ݍ$ 㣣 㟣 K,"@ --LM 0 dd@ H$XL 0S 8帍0 ~( z0SRk$,"@@0p@-@P` 0S400 0 CS @ Tp -0Lt00@ 0 Gp '0S #!$0Ph,&8>P> -LM@P!  epP 1 ppE`P@PLV p0S Kp> 0-L" @P㯌00P. 0T lp2!4-0P0 #0|>>> -L+M p! @n굏K/va 1Xp"K"K( Kp2 1(K 峐0@8PK2 2 2 Lp P \(K0 00PK0 70K@P <@ 8@KHP D@ op z0S7 v 'öP@ /pg P2[S2[S2S2"SP X|KKT.P@ @ (K>T\>?0?P? -L(M@@K`P ph0 `|T0 00 ,` (p pm h$Kl&H&l? -L$MKKOK p @0PK  c?[ 0, ?KP @ 0@K/Kp0 @@PK O/[ 0K 0?0K< /K@@Kpx@|P0 @PPK 9/[ 0K 0O0KL /KP@Kpx@|Pr@KqP 0/[; K0 " "0/Kpx0|@@PK 7p@A0S =03S 9$9T K@@ -LXM pR,1 (1!D  pux@K@ ܉ P`010P D` 0HKhKp @R lL8@K´ ᶉ0H80 0(0 800 $0  0 K*L&`@i@@A -LdM0 X0 0@`XK,KPT0 D @ P L H  0 PPهpu ,0Sp ?pP 0 APPŇp`0 S ~|AT  ,0XP ap`$,0@C $ 0CSL'@B]$K+L&h&|RRRRRR S$S@Sp@-<@< `P 0000PQApT* -$0@LP @ *@ -d@LP t@PHKDg0,0( 0@ 0 *@dS** -L 0LR RP 0R >*|S |00-PPp0Ll Pd,u\Vp@ L:AH0P 0(,0'+ ,S@S*S -DL@ P(0( 00000 S,** 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00X,\* 0-DP@L0000@@0 0 0 0-, -`L~pP_{0 SPfu% ࠟ0S @ PF00000 G`PV p 0@.\Jx@P`0 @0OJS**S*S1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00|pP00CS04@0U0, )0@0CSp0@0B0@p00 >PP \, 0O00****S`dJSG-鄠儐Pp0 0S0 0 BS00R \P@`A+++-D0D@00  R P +++ p-P@0|`00t0L@l0@d0@`0@w0@0CS0 @@00 ph&p耶+++++ -1q00SL-P`0L00| P100CS0#@00 0@0CS 0`@0x0(000   +++J -LMP@0 22PB ,K A@P zhhhrhb`"PYm 0 P40S0`00P, 000S SPp PP aP PTAZ,KPPU 1 ,0Q.0 Q@L00h{ PzH00CS0<0A004 [100CS@ 0@00I,  @p0P@ e P P \0P 00S Pp(K,o+l-pT,T0ThJ -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  01p3PPP0T@,DT , ,+-0 CR 0R0 S;00 -@0LP`rPe`Z !`0Vh`c0SUJ L0SF I0S\\;@U`T x߀P 0`!Sb/*0S@,0@0f;0US8080W;0US00J;`zUB;PX*\00S` lP 4; U 0@0^S00\P0SppT`TdT -LLrLLL`~@0S 00CS00PӤ0<<PuG  Q/0 Q@L00y P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP 0S0`00` 0S0`00|V @V00 00 0 <0 `p+,J ,-T|T, -3LM, 0 0 S@`TA9P, `3@, P00T$0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +d0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ ;d U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT-70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020P,P,V@V|Ժk@tV-`HUVDTк̺Ⱥ\V|S,PVU+VU| ,+U,,h-+ ,P 00  Q X00S- 0S0!S+a0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P e 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+_0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:=Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;%;➇ ;0S, 4; <; P T;  PPt P -LxM  Vl5 InPڠ0000SrSh5hehhhhuhU@sP xP pP00 @ T0  5 (%&p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 5TP@KKP0: S  0Z040{5P } }}}}@P >7*#000S 000S 04P 0oPX30S 000!S 0+L^0S 8000S  20SsRcT0S o'䒟䢟"P 2PB-"0S& <"0S"p820S  p2Rlh2 0E'IP20SH"0`008y"0@09"000 S 10S!@0`00]@00@P @P  @Pt t t$ @!00B,00S  1R 1 0&0 S &#h00Sc 0R0 0&VV-V@-`HV< ,VVVU|Ժk,-+V@h W-p+T0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00eP00CS0-P0/0% 0P0CS0@00\@DP Xj H0 0`S  0o ,LWhWJ , p- L P p P 000 S S@0S~ pk`Pp0P 00S{ f|0P@Gpcp\0P@P PP 8 80刚`Ppp,DTWJԺ( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00d P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00d P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00sd P00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\009d PKg00CS0@00 ,0P0CS 0PP00(0 00@(K---J- -LM  @$" (2 P  Ld0S  0@_K  0 B 9P$" b  ," (2S  S ;#rPU0 U@L00c P; 0ß0CS@ 0 h0KT#00ß0S 0B h K 0P 8"RpW$0 W@L00c P00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 ;hK`0S 2S ,\    ?K圱Pk  "向0pf 0 Q2 /hQ`0 Q@L001c PC<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ g HgQ"(K ,--JW -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K+-- ,U -L0  0%Su0 SqB 0Sp  Q.0 QP\00-b P?[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00apP00CS0#@0?0 0P0CSp0XP0,0$ H0@00,-V-J,p+- -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000,-U -`吀L p Q0@P @\T00Cs0,0 (0000 0-, -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S64\|| 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S:t0x@C d0 \0T800@ \P00 j(K-,W+, -PpL0` Sd 0 @`@P 0 P 0 5$m 0 5$g0 % 00:(V[@@ Jg -/L@NP  0 ST @T 0/S 0/S @T  -L|M  bP  ) !PP3 30CS4 P  P P  P P  0SB 80Se 0$ p0/S0`c,4@ 0T/S/000h0 S" ߷  PP0S ᆻ(K@s ɷ00 ÷  Ɲ00PKp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp eP$  $ p3Sj D00* RT2 RH2 R` 0Sg 姉PS!嗙$ 0 pf0: SF1 Rc0S? D0g: R5  R+  R1 R q3%P) 0S h@3D 0: S  ĺ00 1 R q3,P -@ q3APv   㟺00 0: S B00tP -H l DMPT@ $W `--@-WLXX -LM@Pԓ?0 1 p0#gp5 H0@*S*hH8("1p2`@fT"0Sa 0S !001po2`Dx2xBQ+sU P*dPDd 0 0!KpPw0SkVu8  +!00}1 yo,1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BKr1: S0S BK_. 0 . B0 )kp 0S p忕h引 \ P崕0: S@h-lX---$---xXX@X 0-,@,PL( A =@|Y4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV u`v兔D{0S 1 ,u`v BKPP$1:( SPPj@P0?8 0 y `. Xxp  0T00(J@PU 2 3P/0xp8 t  00 dP)0?PX 00S 00CS00@Ӥ08@d`dP0S 00CS00Ӥ0$ PpyTpp@Y p-LM`PP@L 410SH(10SD10S  0@O5 000 姲P 0S0;06PLQ $Pt 0$(0 \(0$ , 0 \(K uP(Kp2,2(2 f,f8fHf - L(Tf -LMK }P[ [4 0 S0S 0SZ -MLM(%pQ urPP40S J`240S 'P 40S  K P$ 40S ԰JNK`@DdK@ @DK 0H  P 40S  Ғ`40S 4[S /P `+^+O3 3`V KJ3@T u)Kd!KP04#:  SK RP Pጒ`)KD 4rX20S K  0`x tP `20SX`[K(PEPE9K) 4@P `?V00S 10S t0S o $h0S`` K DK0P Vd10S T ``T0S H10SD R ( ,0 $0V f x  P V-00S)>%V00S D0)KS(0D0 D K d00S<0@K08K0 9K4VS B`(K(2 2@2pff 22,2f 2 -MLM99 , 0|igS0,0 pY,@ 0L L( 00D]P 0H( 0 0uS0nS0 0, 0,@]P ]P0H8 8 0@KP8 oN\P, ' P 0@K rP`@p@T k#WPPz,01$ ~r, ,0SU CKI@pKg ID X( 0 0 !0@S0dTL STv 1T9T-LT NTYaT- VT~bT* cTnTI gT4 fT.hT| lT|2rTr oT> qTtGtTZ vTo`0H8 nP M0@DLH gdF,K h,00SZ |娎00?l&BP ML KL 0 0086 @%P=035 +M P 3D( 51:5 *E,p 00.S.0@0KX8,0 , g bM0,0 0%00Il%000 BT000IL $,0P! 5P p@K5@XUP 4@0D(R 40TS4T 0DST 00 RÀś$0s400s030 ㆶP CK.KI B BI`T( H(00 @0-S 0SD8SCC000S30C S;$444447444T4l30S 㙱0S.P,  @K>\P @KT(#0[ P *TDHPD00: S  JD00: S S0S2P" 8TH0S h"0SP h(D8S)0S D+L!0S  +P10SP嚭 @pK !0pm[ P: ጭV`<d!0S x0S810S  D0x\0p10  L8 P P`0S00S 0S P 0S娍V`\PPT00S | 2$22ffD?fZftf`Hg22,24g 22dZ^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S($rZ. -0L0S$. -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #$. 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphpdd0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p TLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4wT4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b JT (0,00 0e0`U`1`!  ;TPU 4e 4T(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4UbS(0,0e S,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗P^^^^^^^^PR\RhR8SSPT|WLXxYYZx[4\`\^PPP< y< !  ;< 0S  0  Z  0RJv`V0'RP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 SRRSS 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HR@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(Kf&[ZZG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝfc&caah 0`$dE:Kz -0L R0 R P0 |P0 |@||M 0S X@` @PQT0D0L = 0S 46 8202|TD42@,iDXihii -L M0@SKh(P K0 R 0`i 0-L M0@SPK0 *P K0 R U0>i -L4MP@8*'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'ߞp= H0@0S0i p-L`"@,P,P0S ,0S @,P0S0S P@p - @L\0002> -L 2 r2`\%R(0p4 0PS% |K0 4L T * qK0 4L R0 000\X h,00; [,0S V,0S(J,@ G,00C,0S 1 0 000\QtPp@P@"# 0d \Qp@@0L \QtPP, ,000L4>T4 -L8MT0$  , 0 4 0  KD0 @0 <0 80 00 0 0 0 ( DK K} -LgMLI0P,0  49Q  0Pp1p#WSȟ, 0RW(Kf.K B0ppppppppppp(pX& H P hv dv 4KL Dv H0|(\P P`h 0@00 00S <8P 40 0@4;D$+4 0fKA? bKII 0  + zǟ7\Ő\ @0P04s cr5 S5qQX X WP7\ 1 0tp   0 8+0P~ '0\Qx   p l& p&!  p0p0t@F0\%0O6 F 6R1 0( 1 0&pt h&h6\%RG 00O  06,6\%R4 004O  E5\^ pF1 0px t& l&RM0 xtS0S ş%0\Q> p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 +P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@0P1 0( R  0 OK,iIHß00 0PSc,[I3 L00 R  OI 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 p)I d!`2 R T寯0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & X0>|4>T\j4\=\\ -LP`eJ0pS000000 `S8#80 @0c 0 n)0p0 `H 0-P L@ tP 0 00 S)0 00 -L@Ah:0,qSP: !0S2 0 !: S0Q @ f0S V&0S v*P 0 Rm*P嚮0S 00f0hd0 PHh さ4 4>>\\=\0]<$],\ ] -LMd%EnK`F `F 0,            d$ `$ h P0: S4X@N 4ؔP4 R 0$\Qp  00p 0S#Pm)P |0S!h 0pL4 X4T4 0$KHt ? @D40 0S (# $, 0R(Kp0: SP+  )P 3 pP@{ 3 O@t O#004KT$ Ht X(AP($3>I(0S $ 00Ԣ0S20S BKNN"1A\0A 2 0!00c000l\#0 0@P$b%P$呭<!0S" 2 WPk 1 PP 1 R] tZ`'0X0C0W2)PI  h4s h!000'0 000Hhp  (h'0000S 0"xBKNN+4K}@T 00C0 , 0 S X\8]=4><TT]>,]]]0^D]0>4^`]]]x]\^t^hj -MLMp0P@AnK 0 `F?`F ߓ 0'U0 U| 0RK7@$(P 0D: S40P ( Xh0>^\^pj  -X2LM (40p  f, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S x( @,0 TP0PPP4@ 0,0P<  ,0~4>^ -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0,P  K1E?K0P  {,0@ hKE0 0 0<. 0SP0SPX4>|j^ 0  |> p-d`L0S TPT 0@1@P;0S;;000p<<> -@LP;00H2 p-LM`@P 0|0h S%00CS 4`LDD%00Kp%%00m^ -\0L@-CL0 P 0S P 0S ><_ -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0vN0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @肶P SWSH@DPK`0PO` 0 @VU1 R 0 40\<0O TP0 R 040 @/  0$(>4>=mmn$n@n 0-PL@T0.EPT0 T @00> - 0LS   }C -((!0S1!1L ! 85H:pp\0Q 0'TP@BĠ``A 40P0Pp0?P|Vd0SP@AL``A88 30H2>>>D24>>T>>>><_ -L2\%RPj 0 0BO?AP PppW1( ?`Pc 1A1U 10aP   @H1\%R00 WP1 P#U 0p 1\%R(0 ?p  ^ $0 W0\%RX0 ?  ^ 0|@|0Qpp 0 aDpdP=PP$ 4>T><>><ndn -1LM@\@c1 \_a \5M:1!P@PP0 <0 A18 @x dpP4 `@P0@ F P1P  , 80Ǐ 87 H$pǏp`1<p P@4@00@#0 09 i20 Y0>>@2>4>>>><H2Tn>> -PLMP1 PL!0SL1x`0 00 @pA`0pQP ,0 000Ǐ7  H$pǏp 00p Z@h@,00 @(@ x` Y@@0\%0R ?@@0 (K  lP*P@x`@ x`0P: $@ 0 0>D24>|>Td_ -%LMpP0 p5U0W:0pS"0S0Wy L%0D@@0Q? ?Sa(+ P U PUP<@P/ 0 0!z0U1 0U00吔 0R00@ P="\4P  P  oXO 0& D0S 3S 0S 3 ??#0?\000 1000 j B V V  V p(K! 0000#@ @$#P0(#\Q &pt"0"\Q t0p  0S00"00"\Q "0"\Q {Zt",K0x"\Q00d0X0ؔH"0P"\Q,00 ,0O 0$@"0 "\Q00!0D00!\Q,00 ,0O(0,@!0!\Q00!0@00!\Q,0 0 ,0O004@p!0x!\Q00$0H0L1T1\%R? 40O0@$!01\%R404h0 404O0@ 0@IW!F60US!0SPM!00U/7E!p00B(00s03e&(URꈑpg40O0 @Ytg(p'=0>4>=U oT$>n 0-LM@ L冲T@1 T8(Q@$y0!\QpVP! mj0 R&0 \Q* ]0 \KQ0(00 :! O80p \QpFXCT0 R L;0$ \Q`0>4>`Th`=```O -MLM,EL 4\, X D 8 ZL(( P D, 0R(KL8DXN04 0 %4QH 00t pǏ@( Pot0@8 Po8"5XHpQ0 0@ @ 0T IQTʊ `L3 R V|P3^r H1 0 4LHQ \LD]PUd Ytx#0\^E H8 1   RLH40S00Z. 0 LNK @D@D0u k!PL"0"\Q 0 0S @0@劥2@@H000\YH0! R L4 03 H(000FHH0!?H000;Pr@hq@Qs!Q<( 8h 8( 8( t0Ta`=@=j -LM$0|S 0, $0000`6 \6\Q 00 @8F0P: S S\ S6^K 0(ŕ /R \5^E  0 RKAA` ,`>($R>Kh d 0 T5 PE 0BO`E?DE 1Kh\ X T8 4 @E Kh d lBNK @D@D0$P]"2\%R 0 L5O0@2 H @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 H>P 0Wh0SN?hd%T P%  0\Q 00S@0@pKl0 %0 L5O0 @W<00S@0 @X4>Taj 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,x<n|H  0@K0 f<4>T<$>< -Lp@PQT$ @0S ݢ 0`@P``0 0\Q ,:<?00i+P 0p : S`0P T @ <0S =ta$>4>T<la\0< -PLMHH RS, @$ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R sa$l0@S 0S 0S 0S oH 80   O   Q ?KP``F0`1_K`P`P`B2 MP`K 0E2/R 0O? 0@l& @Ācp 0E 0bJB K2@şU0S %0 0C@0S@Q 0N|5 R E0,P/OQ o 5 pTş@@_@P004@9%8Po% "2"_K`PU`P@`P`D0`ğ0S 剭|4@T 傭@T 㐈T0S9 tw@T ` p@T ~*#0S40Dp Lp00Dp Ep00, 0R(K`" (?K zPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS4000, R|b tb@ 10\1Ÿ@ ,0SDR@R1@O1@0LJ1G1 2D1!0S pA0S 0Sd0SԠPx &KtpPf 0S7 CXK2|$>= oDo0>>co<cdDb<=(E>><>=><Ld# 8b$dc4cXcb`bb|oldxboj p-L@M P`KⒽ0S 0S  xa -Lb@P᱊00"及p~ N0@+S+ꄺhhhhhhhhhhdhhhhhhhh(عh̹hhhhhhhxhhhhhhhhd1!0001m 0>0!Sdϫ00!000|1 c 0|t1PdT@1 T 0bqD1  8婫0!000 1!0000z0pJP`g J0 RJV 1P@@ 0T0PlJ\>(p|o=`HD0 b=o<o<=a >,>3 $" >$ a -L`( pDP(X-x"1> R.#T 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q  1 R=  / 5P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P 4PPSS| 0`p 0@0@QL\ PZ>=iT28p=d>=dd@@hsL2d -,LpM,0SPڼ0@Pt@ pP D NtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X0P`1> 0P@`UVW4HTLd@b6pǏpX63 -=@PmP -0000h|-|m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l ,x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN x< RJ \,h< R\00S 0C1 0R' sR"Q ,|@0A@ +@0[0  |P,0 @|PK`P`Q|P x` ʈk00?(Kp P`0@0@0A@D`ePT@ D[`|0V ` 1`Pa `  :@ P0@` S0 @ `+ h d *Y TlJ`0\0ZE:Q d:Q  000hK@ h d R0d@SZi00 R:Y l@QC:Y@c0T@A Q Q%T1pP RO:)@00pdl()00PO/ 0\u9@W 0T \9W 45S:  Zv H0S Z 9W 0 0BO?CQ6p3@P2 Z Z@ Z8 T1!(0p  P P0S  \d8W00S0S 7 R 48W 1100(p @7 R 7W 0啨   00poP@: g@ 0'\Q 4,6* k'T7Wa 0S0s6 R 7WW `(0  PO   {7P4V 0&\Q d,5%O?@0\ud6@W605p ` P P0S 00 U0x R ! 8S5WXx P0S 0005S:8P TH5\uW,uT` 00$@0T0R,0 0Xd ) DPt@P4PPU^1!X0   0 S PUK\4W00S0S 3 R ,4W1100X  $5M 5D3W  (Ř Q \3W-  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD z!0 404 l20 \Ph0O0 /S <2APh00  > 0S 6 hQ!0\Q00h0 00O0@Qpq$kPv1W|0 0@#1?@{W1> 0P@`UV# ]` 0`\%R] 40O0@00L 8P0 c54>>=$>\2 =T=<U =>=xpdeela<De@<dH==p<Tep<T2L2p4e4>TTp<ed@@hpp44 0\Q  0  0S% 00 . 0 40O0 @TP L 0P 00 00T) h0SU x $4P44 8 l oL f i -H0 ML< ,0@nP0$ P4PK4>\2 q -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ wPP D@ 0`KS $ @0S,  R00(K=`24>d2 -H0 ML< ,0@nP0$ Pq4PK4>d2i@-0 0 0S@TTS -MLM0,0 00CSs4k |'Prp#P~ 0:0090 446 (6呏FKL0ş !% `@0帕%44K5ZX$ 0h d i0`00 0S_ S;;SV~KpG,3LşL%0\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0\Q 0(0 0p0t@  R01 0# SP R P\$0X$\Q0X000@\0FKL4  AH$ Z3#Pß0Z0 0@00 R 0S 0R s S{ #P[PPZ<40@1`8#0T0 *PP 0S <0P0@V Ÿ, 0R(K< 0-PQ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0`\2 R@ LB 0̠DD9 0S@ 0?044 0 R P!0!\Q 0@0@ !dP 0P0000C0  eZXt HA 0̠T@ 0S <e(q $ P !P a PWW  MB0P0CZ0:PtXlf]f<><h2l24>TLff<=q]0]fXq$]fTf8ff,f@@hdj -LM$$ @0 @"2Ph2l2q -LM44 0, @2Ph2h2l2q -LM0 pTR0,0 `'@TM004 KK,.1K-K#0-A[Si00@PUoʅT6(K MK@0 P 0 RH0S, 0Rz(KQ0.S 0 0X&000QP<PU 0 02PT VP 0S H00P0  0 R0,-1KP0KKp.1K4 "-1[0 00R000 P8#8E c(K 00  0 >0 0C0(K 1(K@@@T0ZP00 0 Pv "00C0q00S0S\$ X4 RL4 R@$]PPv @0: S00S00000CS񟗄h3(KPMK /00@e 0 00C0 '1@!P0 0 R%Q 0.S  PPP! 00S00@0S "20\0P00C000ST" P0S 00Sڒ^K PEPE0RNK@D @D00!1 R a 0kPd0P 0 x0  0P,@0S <P!00n t0(K MK/XqP 80P  00XLgLf0>Thdhg4gxh=<h4>@hhlhhhqhXgggfh0hjg -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00><@p2>> -LM$$ @0 @/P>p2q -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00%T pW 0@P`0:0 @   0@pW,Q>== -l2L8Mddd"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S|ڸr a0S:ڐPTD@ 00CS5@00$`K o P0S@0`!\QB  000S/ `K(T P0S,0S4ڸ 0`K =Q R Q0S R`Kx $A`K6 00 0S 00(K4>=\Tih<i -@0 ML8 `@pP0$ 0p}.PKt2> r -MLMtXO0 KPK(J8!J,0 HK 4Q.> R K0(K8!Lqt QG >hK8aXQK0 ţK8$UUd~UUP~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S^0S  yK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0L͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P P8K01S XK8QHK4  De*0 0K8K,,KL0` P@`R`YK8``L5HKsKD!8KP%81X?^ PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK8(l 0 0 08S8K>C`(K8!8KK 4L!P2 RQXK4Q 2Q\01\XK4QHK4A\0KH!P KP8 P K41 XKR(K4!\0t1 daR\0H!0 0hK4ax0 R0R0 C(KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!X<r\r\rx2|2oT=h><Hss(sr=TU r=Dr4>dr|r(rjPU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHK,8$U'UP P 0Sg cl0S -LM$$ @0 @a)P|2x2ds00 00| -LP ]\j Q-L@ 4#P T]lj P-L $P {]|j 0-/LPT@P 00+8@/00,+ )+~)002j p-LpM/P5@P K}P0: S Kp0`rS@)  P0-L@P0 R 0 R 0 0hW?T?t0 R0h0l uH0 R <0<808*0jO|j --LM0 0  --LM0 0 K --LM0 0 K -L@ތ= hX; -LMH0@K0PP`AK<P0: S V@@ S00S F`PˮP$Kc=P T P`0 R000 ]K@ᲮP l1: S 8s((儍h|Ejjj --LM0 0 1〿@ -T L@H7P4TZ幼W 6edAkk -LM`pP?(@PP5!:Pa0@0S0 00B S0"0a>C0, ,0 ,0 R R2"!2(K00@ S)"', P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00($|, $8<0 0@@,@@8@଀@D ?$4$P%402,P$e<@ @ @ T 00S  0D0 00<$40A$40 0$, $0I $ Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R $ejxs8kd> P-L@ 00 R$hkA=kO - 6LM , RvfFXS$3S Pu T$0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`$ ?|/t$0ttS} \%h4R& 0O044D $0O84>TT<ksstss$t<=pt0lHt -_MLM@ϟ`,@ _=K|O`0Cpϟ 0C pPP%DϟPE+%P/_KA A2ZP5: S K@P n0S > R  0S> NS0S \ϟP>.`@P00`` `` `` h / O c 0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`P &R[Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@PQ5P f0,H5P 0%?>T 0 5U  1p5PXE )T5P l|ş 5  05,5  w +h4 H\Ն4 帓 , 0R(Kx0Sß@T" 0o"ßP@C0SI nFD唓+#P, $勓(`SsVL3-K B BFP ^P S@Td 002P c\54 S0 `5Sy@>xEp϶ XS2ld=,>m>>=>=>0>tn$uTufxuuuxvTvvvwT0wHw=0o>=>>><<<8 mll07Hm$kDnmltuHu4>=<Honww`wwjmnthm|mmm@@h=|ntnduv@vts R< `0 0 0;g\0 R  0 0 0Z0 R @P0 0 0!h 1y,+o@>0L,`p|md5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5WwXX\\\\"\2Бgttgx2x |2R -BMLMp0 0 Ƅ0P0S ANK @D@DPP 0R K24`Pt0@ h0 < 84 4$ 0D  CKH0 A, A (4 $ 6gTײXOPk -l0L pR:X0 PH0a@p0`P 1  0>4>=x -L`@d6c0`0V@ 0-LMMpPANK@D0@D\ 0   \680 B0 0RK0 yXo>\k -RSL8M@P`pE 0S  $K0S 0S0T o8 `3\K(0 <0 (K\0 X0 T0 P0 L0 H0 D0 @0 40 00 ,0 <@ ) < 0L0 @ >|>=X>Dp -,2L `Rc-@p@3 kT1 RO1 RK࡟0SBT 1 R<qQ0ST00CS0SX0@X0FTR T00CS0.0 R0, 02P0 S  P 0S =PP 0 帏峏0@ PyTYT nTNT jYTyT  `0 XE@XE@00=d,>= >pp<ppdp -$0L@ST+ L+ D+ L+ | 40S \X0 R Lw0$0,<P00$0$0p@=pp p-T0`LP@P  0,c(P p Ij =,xdp -LMP@P4@ < 80 @@P [a<</Q80P ,` ,0`,` 0K4QO@ 4@4@P81  > ,<K0K404Q5@ R*0 4#4@ ` P0@_4 0K@P 4 <0K0@ hю0@@ T (Koi(K4<Kt <Ko>> qqoq -LM 0@S `V 0 V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V>@hHq@x4>= -LM,00K, K00 0S3\%RX` B2 R7Br @T T `U@ | PU`Q\"\0Y00/H2 RBT<=X>|>>=<>=hxq>>qqq -L - -L$Md"0POc*!0` ,p p,p 00KH >3Q}H 叢pP4 q   0KH0*3Qn 1HQ4 Y 4 rrx=oq -LpM@d` `1lP PnQT@ X0LL 000 0@7`@0S4>=>< -t2LMP`, 8ZL2/0@TPU0"`jpVq1 S2hZ0!0R# \1S2Y0 Q ,0@p,  P  oWO 0X`!0S 3S Dw,!0Pc11 01 0R`00 0# P U 0O0@ 80 S0$00C0j0$0 Vp ?U TzTz=4>>>U o= -qL`V( 0 dQ 0a8SA QPQ\ `V 0S0S 000 00 0  ` p ` `V `V 0 0 VX>4>>DrA-p8@T`Pက(/.000b0X3 x x0  T0 S0 008@ TQkhk-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`$ -LP`  PT  P P@  P8  P( $ 0 M G O R R l? $0  00 0( R>N 0 > -@LP P  h 0-L@0PP HPg.P@@P[.P0x -\0LM@(0K( 0 @ K$ K0 P K$K> -0L@P  h@h --@0L M,K0,K  G Kx -`0LM00 0@0 K P @|< K>x -t0LM $0K 0  $  K K0P $0@| K>x -0LM0S P |X@0 @00P |>xy -LM  K K0K p@n|ͬ aK,y 0-LM 0PS    KK0up @J|婬0 ;K0Ty -L@V0=.)y 0S00 -p-LM@0`P0 R|P0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ 1 00 0SK0 --LM0 0 OjHj K p-PLP` 4 2  0:ipK rP@ @p0S P P@PpUP@ 0 @pp0P0yyy - 0LP`p) 0S& 0S# ,, @T0 0pll 0hp\iK PP@ V0(0(0$`@(@$`@8P0> -T1L 00 0(Q,p5@p 0`MP0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0$ FPPF@ 00 0 (@T >yyN 0-|0L@0S(@TH0@?PP 40PP@FP PyF0>8U N --LM0 0 >i7i, K -LM@Tp`PK! C-P4 0峅 0 ($zPzlz -LM@6i 0pP,K:(pl PcTp`dP U` (\J,K 㝜P ,TJ`T,PJ0[ 1S00 0KU% ,EJ !)pPhz0S dz0S `z0S (v,(,J* (o,(%J#JS,W0`SʌUH,0S oA,0 $K$0 020 ,N'`Kz,zz p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 phphp>G  -Lpe0@ 00 0(@T dp`P׃py0S P, 㫆p0Sy0 Sy0 S @ T >@hx>{8U 0 0-L P8 0@PU 0sl `0  0$h(@Tlp b@0S 0>G -L@%u+(p$ p&L{`{ -X2L$M0  D2$ ,0 (@  $K,K0mpCy0-SQ1@ 000 0;(@Td!Fp/ Rp`+ P#8@K P 4` 0` 8P 7. 3.P <0!$14`墅,$!1"Y& K 0 @p`P#40S 0:0px0S P&+ p0Sx0 Sx0@ S TP01.@Kx{>@h$|8{x>{8U 0:0P0 K -L$MqRpP*0@K kP ,p (p 0P - -10aS1 @0 8 <` 4p @K} %w PK l`T!f QPm*3 Hp@ =TYx0S  0S( ^OQ 0 0R0$0 $@KK\ |p G"4 H0xxx pQ00 SK${|8{{|@|l? d|8U @hXI -LMCnKЁ+~K+tPÑQPP|(K 0@K(P v tt0p ,P FX<0 ,P ݂<()=u 㳄P 00p$`K 㧄p@ Tw0S $0[S㯁0S p0@T$00 S\X)$D0 @ K8$||},}8U `}}}R -LDM@,KP ֧H D=P 0(|  e)P rFP l fVP sVp bБЁqP !bp`10SQ  + P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@K  4P 0P 8` , ,FFF00=w}@}}~~0~8U H~L~D `D > ? 8 200 "P: -LM@pPg X`P 0S nS0oS` =PP00 @P @Q  0U0P P00 00 X 0000X  DU 0 iv00 ,Kᬔ, ?R0S@pYv0"S4 0C@PxD<Tp -LMp`@P@( P(K,K&F  0mP(0S$K -000 0LS    U+@|h~@  --LM00 @CP 80 jd idbdc | p-\0L0`SP@8 ,!PCphp@gd  0-t L@h P\PP P 000o@P 4,C$@0>edA@@ -MLM0@<0 8@ =P = = = \P |˄ =x* P-] p4`Kl* hz +N0@&S8` ` Pd Pd Pd h` ` Pd Pd Pd Pd Pd Pd Pd Pd Pd Pd Pd Pd Pd ` a Pd Ta a a b Tb Pd Pd Pd b Pd b Pd Tc Pd dc c < +0 `]40S<0x:  x .x dLp RQ8<@0@0 $  < 8 `/4 ;R 1 `4 ;R  1 ` 4 t;Rh 8 `4 <;R0 1 `4 ;R }1 `4 :R m1 `4 :R ]c0 `4 \:RP M 0S 44*TD@(P*ʟ00  P)91 q-Xɟ00)<Kp 80S<0S ] 0s 0 h*  0SpXaP 00h: l*_p0S9P p( 0e 0bS T80S \@K4PT0K\0 X@ L9 (1 R0d: -W pP& l'P! ^KPEeNKPE@D@DH(0<(<8Pp (8p C<70S( PP#&NKe/7(pK `|j J pZ tj <82 =C42 =(2 70C,0P 0sK 1K0" ," $ 6 Rt A 00K|Pt s!  ,K0spP#s  ,@ PPPP P, | ,0?,0 X  P ``rpWZh50S EP zmP g  0㤐|* p: `  0$P| jsɣ  Q| K DP^s彣  pE40S 0: S` ; 0: SL adj@=pPpz  P`P`0P00@ S!| [p 00A Sa>@0 @@00@0d:  0 Sdjpz   (0@Sd*Ph:0@3C 000t30SvL3 Q`0P0 20D080U00@ d j0 0G4K(K@@U ,Dl@ - L0R  P<蘄 -d2LM0, Sʻ,0l,@P,2,R@ d 2 0> 2Q)< 00C 0 ԑP\01 P\0?0 0! @ d 1 0; 0@4D\1 00C0p帀,0Z !0# #,%<+ 0 OS d&0OP `x`0d 0@@0 0P`x00S0 x0, 0 x0,,I $000 (00(Ko@@U ,@@ -LMK@, 0 K`_0@ P A P @ P {Z " 0!C Bp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d e,04 0B KA@@ -LM@`pGK,P= 1@ 0 A SA  )0K p P  0K $Z " ,K01B00@S  0K4ZP L=EK0@0O4;0 dD04 0GKDK@A@@ -:L4M` ?P L0 X @P T@ ɯ08D`;:Q: `: Sr\ mQ (:  S4Z@ ,08x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  ]8`0UT X0PD RD: R48R0?8Y00 8 04 000cH0 400cL0 H00O85,@0TT @ht@@@@o@@@Ȉ؈@@ ĐY U400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000`1PH P=LV>00h0 h0 S:h082 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 ,00@ 0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0 40S0 8<`4@P4 d `p8<4 00@ Pt@p4P`~ @5P`8 , 0ls@@ < @K8 K00K0 @@P8PK`VP ` Ubp` p 5嬐K8 4 6, 帠 8d 0A@@c00@ Zᴐ 尠 0Y @K$'J F%*0)ZTP;T70S@P'D*0\\%7R7\5*0#xG*0P7'8Q0\570S Hg 7P.P HGL8X@ KVp [PxP rPP\80X0 h R01:0-P&{ H *Z`p㤐K9),`0S-80O ,00 /@_d x)P0d P{cP@c@t 0 S M  r s`pP0I,0V0S M :0S :PИ :,0S;P @< ?>0 ?0 ;0 4 D0P  *3J*0`PKTHLV0Od ^00 f0 R 8000`P pV0 008P40 r @@rA@; 008#80(K 0-LMReX0@K P0,L 0P< P [=ePK0@@@ -0L i?|@ p-LP`@T 0@T *0P/S @0P/S00@T:/ۗP@0.S P@Tp0S .S0S`V (0  0S0R@< -1L MС`V( p1 R 0: S \2P8( 0RX$K dd\a\q^0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyU廼ټd0 S7K7. [0 R@@4P40d6 KHP嵺@FᘼPᵼP(嵒@X@\@p@hth -RLM`p, $0 W @P p  ,fP `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K 0S t0QoK2)P`% @2341  ] ~p` K4P  <3S 83S c00@'43: SK)Up T2 S!3 P 80dP =P3 3X@@  -LpM`@T PK(P 1 R c0S 10 @TK0 Q p0S  Q 0 RwP 0S x0 Rh.QT0  P 0 Qb#/@@@@@ȉ -bL0Sp2 R p PYPP X@P# 0A S5 @ @ @ | @ @ WZ 0Sj P @勓 P1 W@Pc0SchT0SD )P `T0 00SB 0AS)ꨩ     @W 00 0S "P 0S00 0 R Q ADwP 0S b0Sl0 RpyvD Pt 22@@ @@@@ -L@Pa80p0!Mp- P0@"S"\ T D ( T < Mp0 bQ!@+:0S I0W 0i0 0|0 t0h0 p0000M(0 R@h@܉@@@@@ -000 0LS    V,  A@-0 CR 0R0 S䲸00 -@RLP 0S Dn 4nTH UF 0@SB 10S<p `(<n0C3@ R 0S, ,]0S|T@ l R @0 S0S400S(>h>h9hpp 0-PL@0S(0hxnBQP xqnt d\00SP e <  0Zn (0hUn$DH`pdx - L | PJ1m @@ p m -LM@/"P0002BPp2 lR dr`XT2T"PPPfP tP  }Lp2 10 bSP PP P 0@SX :P010S Ya@a,@ EpQl 4  EPP `@a0<S 00K@P `0S 1 0S0.+0S% 3KP ,K  04 P,00S F.040 8K[P @00S d0 0X0=㲓 A p`H@P?@Ȋ P -0L 徶㔓|@H -LpMp`@ V,*U&/00]j@0 PsP3U @V P X`KrP0: S M`0 0 $K:P =` E -Lp`i[[!Kp mP2 pP X!yKpL1 ApPE @` 0@S 0P/S @0P/S00 R:X  xPPP )@P m(PCP00 U030"S 9PH-` 0\-?P` @hp`H@ -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @tLW -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @P̋ -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp P 0  @T0S04  ` VC A p-L`@P @P 0S0  T X0 R P 4 0$ 0S5pCC 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K6L@@8( -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0PPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SKt d п D d  | t ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 )0 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0  00M,00S,0  , ,0 r ` 000,00S , M PU00B,( p;,@y\، 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P  P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K ly0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- TT"@TT@@"l p ZB$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q5CAAD Adt0Ԍ8lC  ȍC(4PAA|܎@ЏP,CCCCPU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E f@TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  կPP@Y. 0ld"0S 00CS00 Ӥ0ڱ r@ \w{00010S 00A,K*1P0S00#3 uYPP h1@Y0S Y 0H 0 , P4! 0qa00!<0P 0 0S 0[PP 08`Q<  Qǯ`[~ [~Q`@@<@TU QhhbQA Q4(ƘQƘQ vWAQ -Q -Q -axAQɝ0ŘQŘQ 91AQ۾6Q'A8Q'A8cjYCQV,7QV,7QV,7d' 'AQg77Qg77Qg77e(AQg77Qg77Qg77f9`ƘQ0ŘQŘQ ]A!ƘQ]A ƘQ]A ƘQ]A |qP!ƘQ]A ƘQ]A ƘQ]A 5!ƘQ]A ƘQ]A ƘQs2$^c`!ƘQ]A ƘQ]A ƘQI%<!ƘQ]A ƘQ]A ƘQ]A AO!ƘQ]A ƘQ]A ƘQ]A q28!ƘQ< ƘQ< ƘQ< [F!ƘQ< ƘQ< ƘQ< ""D!ƘQ< ƘQ< ƘQ< \!ƘQ< ƘQ< ƘQW{&Ӝ!ƘQ< ƘQ< ƘQ< -B!ƘQ< ƘQ< ƘQ< eNaƘQ< ƘQ< ƘQ,.A_!ƘQ< ƘQ< ƘQ,._aƘQ< ƘQ< ƘQ,. !|!ƘQ< ƘQ< ƘQ,.2/aƘQM_r ƘQM_r ƘQ,.m]{!ƘQM_r ƘQM_r ƘQ,.|TaƘQM_r ƘQM_r ƘQ,.v!ƘQM_r ƘQM_r ƘQ,.CaƘQM_r ƘQM_r ƘQ,.gW!ƘQM_r ƘQM_r ƘQ,.aƘQM_r ƘQM_r ƘQ,.|!ƘQM_r ƘQM_r ƘQ,.oNaƘQM_r ƘQM_r ƘQ,.h!ƘQM_r ƘQM_r ƘQ,.aƘQ ƘQ ƘQ,.-!ƘQ ƘQ ƘQ,.]6aƘQ ƘQ ƘQ,.Րs-!ƘQ ƘQ ƘQ,.[eaƘQ ƘQ ƘQ,. !ƘQ ƘQ ƘQ,. E>a,aƘQ ƘQ ƘQ,. !ƘQ ƘQ ƘQ,. 쉄aƘQ ƘQ ƘQ,. !ƘQ`ƘQ`ƘQ,. kaƘQ`ƘQ`ƘQ,. j!ƘQ`ƘQ`ƘQ,. nyaƘQ`ƘQ`ƘQ,. >,!ƘQ`ƘQ`ƘQ,. U-aƘQ`ƘQ`ƘQ,.!ƘQ`ƘQ`ƘQ,./#CaƘQ`ƘQ`ƘQ,. P!ƘQ`ƘQ`ƘQ,.RaƘQ`ƘQ`ƘQ,.D!ƘQ<ƘQ<ƘQ,.aƘQ<ƘQ<ƘQ,.1!ƘQ<ƘQ<ƘQ,.ʃaƘQ<ƘQ<ƘQ,.P7!ƘQ<ƘQ<ƘQ,.:(aƘQ<ƘQ<ƘQ,.5.!ƘQ<ƘQ<ƘQ,.2saƘQ<ƘQ<ƘQ,.+!ƘQ<ƘQ<ƘQ,.EaƘQ<ƘQ<ƘQ,.ؠ!ƘQ1ƘQ1ƘQ,. .0aƘQ1ƘQ1ƘQ,.ɛ!ƘQ1ƘQ1ƘQ,.C0!+aƘQ1ƘQ1ƘQ,.w\nA!ƘQ1ƘQ1ƘQ,.3(xaƘQ1ƘQ1ƘQ,.HU!ƘQ1ƘQ1ƘQ,.aƘQ1ƘQ1ƘQ,.T*@!ƘQ1ƘQ1ƘQ,.1aƘQ1ƘQ1ƘQ,.N!ƘQxmƘQxmƘQ,.[aƘQxmƘQxmƘQ,.,2!ƘQxmƘQxmƘQ,.)aƘQxmƘQxmƘQ,.ϖe!ƘQxmƘQxmƘQ,.X5aƘQxmƘQxmƘQ,.{!ƘQxmƘQxmƘQ,.?aƘQxmƘQxmƘQ,.}{>!ƘQxmƘQxmƘQ,.aƘQxmƘQxmƘQ,.f!ƘQƘQƘQ,.aƘQƘQƘQ,.qj!ƘQƘQƘQ,.kaƘQƘQƘQ,.uk!ƘQƘQƘQ,.aƘQƘQƘQ,.G!ƘQƘQƘQ,.aƘQƘQƘQ,.v !ƘQƘQƘQ,.ٳaƘQϖƘQϖƘQ,.[{)!ƘQϖƘQϖƘQ,."MaƘQϖƘQϖƘQ,.cM!ƘQϖƘQϖƘQ,.'$baƘQϖƘQϖƘQ,.N^!ƘQϖƘQϖƘQ,.w$aƘQϖƘQϖƘQ,.AoZ]!ƘQϖƘQϖƘQk`l/tKaƘQϖƘQϖƘQk`l//M!ƘQϖƘQϖƘQk`l/ aJaƘQK7ƘQK7ƘQk`l/ I!ƘQK7ƘQK7ƘQk`l/ 6aƘQK7ƘQK7ƘQk`l/ +!ƘQK7ƘQK7ƘQk`l/ M4aƘQK7ƘQK7ƘQk`l/  $!ƘQK7ƘQK7ƘQk`l/ _aƘQK7ƘQK7ƘQk`l/ f!m!ƘQK7ƘQK7ƘQk`l/ <:aƘQK7ƘQK7ƘQk`l/ !ƘQ&ƘQ&ƘQk`l/ +aƘQ&ƘQ&ƘQk`l/ !ƘQ&ƘQ&ƘQk`l/d\aƘQ&ƘQ&ƘQk`l/P6!ƘQ&ƘQ&ƘQk`l/}l!ƘQ&ƘQ&ƘQD( d Bu!ƘQ&ƘQ&ƘQ]* mBuaƘQ&ƘQ&ƘQk`l/s*B!ƘQ&ƘQ&ƘQk`l/x5JaƘQ&ƘQ&ƘQk`l/ !ƘQhƘQhƘQk`l/g( !ƘQhƘQhƘQh?S!ƘQhƘQhƘQh?/aƘQhƘQhƘQk`l/o08!!ƘQhƘQhƘQk`l/5aƘQhƘQhƘQk`l/ D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭 , , , , , , 8 , , , , , , , , , , , , , , , , , , , , , , , , p  l , , , ,  , d , T , , X ,  [k0SK0000P 0 0 0l0 0 @l @ Sl  l L00l@000S6 ˟0S= 10S? R  B DPd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s hP Ps P K#P4[S 0y䙟䉟PD9< 0U UPVp )000 \P 0SqP" P 0S\ \tc@V P 0iS@0RPaP`0VS80S$$=80S  2T80S`86#3 sTPP~ T0S T q880S0S 8 }P 00] tPW70S0S7| m0SH 7rB0S? R  B JPd  00bh@ 0 ,7Zd\h& 70S0S 6I xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ ZPP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S05N KƐ0S2 TPr 0S0PP 1S0S@T 10QT NtA ppQp0_? P .U?0#K"0KR0(0+0@ ;0-Q6  㲔 #K⭔0@ RU t3MM0+0#0K"K!pK  0Q , 0<I<|Mz6x4yydxP 0-PPL $0$@QmPP0xy -LMPP 0-S- `pC#op lP sP ?P`K9`PhiM`PCP#oppV OA0' #0@| 2  0 `Px @T3 3P @, 0T00S&R+PppT] 01P` KkrP@ pKZP=@T 0%SSP`zM`T; 01P `K0S L@T' VrPw !0LSLL 2Q0 dLXL`O( 8L```TL`O0 R @[$ R @LTL`@p@ Cgp`0QU Dp`0@ R V"T WPDpHe@P `D\0pGx4Dpm@xxȡp\yky̡ -L0M8dP0D($fp LP PP ?P(KC#fp0S DAΈL 弉H X PU 0S xsDl3p0S\jD@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 g80 0x@0 < hnj0pK@`K,K0 < ,0@P)00S "0 kZP<k<@rU DD0Sh !bFLw C\.t10S<<@0/S4ZBT0 mL 㯊P  3D0S> !D7  k1P+ 0D0 P0 PH\0P DP P |Cl<@H }CxCl@P<@XCxxȡ p\yHyhpܭV(<ȫk0fP -hAPL`!e`pp mP <1 8 jC0hC@u`P- @p ep01 PR @@1ST TVp OX b@V tOX0C@0 pR@D b@xx$P -`L0 R$ p@@ T P 0@P0 s 3T R @0 0S  @ T 0 0yx -LM@PKp@6c0@0  (ep ?P pP :P8C 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$K謣py -LMQ@   @UϠAl  _0 Dp K`lO LBd,#!BU`bϠ0 Nl _(0` p(pꭋh@h -LRMPp<K`0Kg GKd P`y @@@@@@@  /`0SY DK0KH YKE 0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@O4 K0@G_0DKPA0K YK W 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,j$KHww?Bwأ -LPM@lPK`ሀv dK 0lp 0e  0 0$Kxwt -LPp@ cp fP/ vP ?P>@@ ycpp01@T `XP0 [Pᚄ@T W,@Tp@x  p-LM 0S@P1  KgP/0S"  D 1`0P @Lf0P0fC10C0 0S0 ,0 R$0xxxyxy 0-hALM`!Pb?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0"@0bP[K0@`@ (0@xy0X  0-ALM Pb?P80AT KeP%  0 0 rR P0S @ZF[\DP0@0d0 R R 00C8S@ 0  ?xxtyyL -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>AXxytlxPؑ\c`kd p-AL!`*a?P8 0Q@P zP# PzP@ yPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@px{ -`L @`?P@ hpM0T 10 00PS<0< Y@sxyxyx -0L8MT0 0\0 0CPX0 XEP%`p2 rP ?P pP,K<PT ,I>(KsP uP@PT  , KF=PT , 1>D0$X0 y`p01 `Rl40&Tp=`$Tm?@PP 00TP  n=X0STp 0 40 0 140P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SkwP 0;0 0S C0lP0\0 hX0S L0 cRLK ^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00Ȃ0`D2 R98 OPf0\0\U00Su U 0!0  80S 0SPr1$ RPkT5P LP1 L PE][  0نfP0==fX0S@x@3u00#T uP0  D0 @ TD0p0H L0 p` 000H>5H@ T;xH;Hw@yyxpyy 0-PLM @C_?P0 01P@PK $C0PS80S08PKCP0x p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0XPx?o X<xx>@xP4  <xoxwy  p-0LM` P@^?P 0AT K0M4\0\  00 0l x4O<xG<yxL R4 5:0Q,Ba -0L` Q\p 0PS @0S 0SP00@S謒t - LR@:Q0AS Q 80p3P000  -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @nХx p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30  p-LpM`Pe @PT0 RKpK_P@ : S I@@x -LM`PP@p1 0A#SMC C dC LC 4C C B B B XB ,B \? B A 4? A `A A 4A @ @ @ @ l@ D@ @ (@ ? ? ? ? ? ? ? h? C KbP0#50#0# KK_PBK_P:p 0RK_PBK_P 1R 1R$K 0O2P000QP0  V_p30  L_8Mp3Gp3KP050#0# R  K_P 0 00 KP\0S0 KPy3 RsKP040#0#i gp3bKP\@ TWKPQ0: SLKPF0: SAKP;0: S6KP00: S+KP%0: S KxP0: SKmP0: S K^p3K\p30!SPPU@\P0 0 e1U ` 0p03 0 0s30S!BKu^PKp^Pp 0R3 HPBp3(K 0,1P 0ES񟗭@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RsP @ 0, p3p3@pK 0 0  ,@0 9 8 xE |E Ф,$x0 0-LM@P$K $Kp  ?<#8K0 Kpq8ll8 -@LM`P@Q $K 00P $P 0 08 K0C4pK4@ 0P ,@ (P P:@T :=k$77DyP|d -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"Zp?@C "PK J J J J J J J J L J J J J J J J J J J L J J J J J J J J J J J J J K 0SV0SR 0RQQ  RP A!Ypp?@0!R i7``WhA\!Yp . ?0B"SK hK hK hK hK hK hK hK hK L hK hK hK hK hK hK hK hK hK hK L hK hK hK hK hK hK hK hK hK hK hK hK hK L 6W |Q @x7QQ@T  8P$Cx0 ,w0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`{AT- p@PP 0`pc@W P`rP lP@W \` -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpPU yPl[ x Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P LThEy -@QL.0  \00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P Wy -RL|MJaApPD0pp0wF P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV V& @`, @`DA A@(@ , 0 KP0 R7`T (0`0}@yyy  0-@ 0PL`P 0c0 -LM0K` l lPp   XYP P0xU*YP lPp  (K @`DA }AP@Py -L,MP L T @fL 0 40 0 H J40T0<0 8 p P:P8@w  YD  0< 0 bR<K_T@Y R   P /00D00D0 H<0  cR<KET@PH ?T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KP LPQD p@ 9@`WT 1 00 R P80(K,0S 0y -RLM<0 ; @3P`4`KvH#8#000 40 , ##0@T T@T"0 !x{2P 0 0p400gCz @W `2  @jY8 @ ` P X`P @ 00kV 0P dP XP @  81K- 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 3<  (K !(VIZ0 P`` VP @PA0<x 0X0@` DA A@,@ 0 4  40, 8y$y`x`ywW X -/L`UhHPDp`@PP@ T iKXꨔ$ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K0S0S 0S0 S0S0S  㫢P H, 0R (K40$  ' NcCX0w  -@TLPL x0S C x  Tp0@ p0TP`\@Hw(x R p0 Bx p0`\Hw -`RL@YPPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  o{P@j DA  A yZw 0-LMPK R@PL40SH0 R l Q@PT[8Py -L M0S 0 0@Q@ K0 K<P1[S S|ࠁ ࠓl 0@zP[yx1[S < 0zP [kx,wyx ht@ 0-L@P}\ 0S0S @p00S@ @xd0 -@L! @@@ @@44jP, 303 0 h 0wM D{,w P@p 00 P 0-0LSP @P0PS0 0 T<0404 00, (0 S,TTTT T-l 0S ^S 0000S$ >R@0̗?R!00K0 0 TDT0 -tLQhd0d @pT *T0`VPUzTP@00,T TTT T - 0pL`P@0 ^000@S@0C@0000`XP  r 0  @PC 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP1>d\@P d0 R} X0 %>wr@TTSTT T,TT TTpyTT -\0LT0L0L0@DP 0540 ,0 7h TTSTTT,T P P p-P0P`0 0LR@ 0 R R00CRphp!0DS m tm m m m m m 00C0000TTT p-08`PLP @0U@PpT -L - L p0   T -LM`@p0Pd K"d@P `00`H0H T wSTSTT,0 (0$ 0c0ALyy -0L `R0 PhP0@z|0 p dۻ@`0@dTPT0T @@@Th xyS0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KP 0TS@Tx4g dv w z u Pt Pn  H Ȋ t y Xt hz u o 0 ht v w y ( n o ~ |x | h t 4z `t g Ԁ  z  -0L @ 0S (<=##,h7#0 h/# - @R0 000  0L P〷 h-S -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0"~V^ 0S2@T@S PP0"1@T r@TUpAp t1@T @S P0}< 09P9U @8 P P0@T @S P0[21C 0@T @T PP"|TP Lh"t@S<x"m0TXܔk@  8̔D -3#ML M3#3#3 `3 S3#帓K@A A@`, 0P48#`0e0||#Pp@@90c00 F cDCD3  00S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S   ]<gN0b0 0C07P0JRSTT TSXTy\ 0ꐱ \  Ա \  Z   R 0SD0\ D0  =Za R  _ 0S    ZPY 0 0 "" "Z  R Y ZS Y 0 -00 40SL  00 Z !  0儠 0C0 p Z nx T `  h | h D@T QA  \0P00S Q0 T,0P 0`S !0J]SL | | | | | | | | | ( L | | | | | | | | | | | |  | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | L | L | | | | | | | | | | | | | | | | | | | | | | | | | | | | | ( | ( R0 B 0Z ZW  RK 0  0 0 R 0 0  䨐 0 00  R0 S0 P(  |9 0 x0 t Gx00| 0 R pp0P/S @j0P/S W :S 0 cR ڀKS= @ 0S 0SS|p0S+ +S. -S  S`T0@Q {Z @L 00 Fp P)0p 0 |0 〠 p C00p p  B 00#0CS X X X X X X X X X X X X X X X X X X X X X X X X l X  4@Tp #T  Q00  0 C 00  000 \QT@T*T#0@S  #450SEx00 R 0@T@@@ 0 @PD0   0@ 0` 5P00S_ -Q=Q ?Q@ ğ0S 4P  0S  R0S 0 400c0P \  0 #0C S @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 0 p * `p $0P $00(   0S @80 cR8K;0Tp00S) 0  `p   $0( 0 0S 0@80 cR8K;0Tp00S)00 `p p  p Yp 004, ` `@TQ P0U*n PZK 0 ( 000 ``, H000 80 4 Yj  20Szuz7JP0 t 3 0 0C   0  oP  R00  P0UT*`ZP(K舗PPPEW40 P@XC '   0<0 0`00 WS(pp@`Q `Q. 0S K- I` P|P  ;|n0 @20h$@> 00 D`     v` ` 5 0 | dPK@K0 `  b0S @80 cR8K900 R ` `PV 0S}[;P 0@S*S0]S @V*Vo5@ 0Q  00S00S T  q94&00 >  P   R: AV` [P?0 00 \[P 0@S*S w  =R f 7^Pa@ 0 :S0  0 0S     0 R  #70SS PLU @` @0(Y`0 R0@T 0S 00Saf 00PI`P|(|  p3X@ 00s03S0+S@ 0 ]P)a@ 0]S  #0BS 8p[]PP@ ` aPU 0 TT@g DA A`p@#SKW@G`UD:0` 0R=P p`90` 0F=P`EW+0` ( 6. BpB K041,Q"( 0 0% P I0 0. >$0 P0R@@^F0  0S B h0  -`$0@;F 00yyhyDH0x -0LM  00  P,0 0P, K  0 ".\? R>0 R@ 00 0;0  0S O@P< 0 @ ñ0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥 L 0-S 08 KpP<0S! WN= P @0SP  YQ  ;P3X jW 0S 08C80CS4 8 8 H  X X   p 4 8  < R  ,pWw 000 00 S<  0S0 00|,0,000S 0  P 0S!M< R0(Kxpy; R 0@H  kWZF @+\0KAS C\K003Wr\+AmPh 0Se 8;Ra0 [0 R  0J0 R 0 RK6P0: S`0Sz ?M0 Rt: @@d:  A4 0 29# R& 40 R" VSZP q?40 R @440 0\9 0_?40 @Rt ;40 R| 40i x0 O0 0 R  C0  + (\0K R@^D 0X (XH (8XX@@HD 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006V@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  5Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @J000 00 0S C0 A0 0  @}00 0 4 00 0 @Y4 dJr*04 0Sx|@4`@UXPP 0S0SLS 0 0P0 @=C0 !8 K]p2 K@P@"0S 0SH,R|0 @& 0 @ @`K2@PVTBP<0P0PT @8K &1 00 07 20 0*4K\0K ,!P 807***0 00 60 0  -0  @$@0 0< 0< 0 0 P0 0=PPH|PJPyyx xpw8 ypxĬD 4  8xxw @4H; 0@ 0 Rd 4@80[ R`  `0`SQh?TW0SPPl5TWY P(TW0S 0P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0S U0 y0 40 RH 0S40 40 rU0 e0 40 R48K 0))A LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- .PpP(0pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  x>Y<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 ;00 R   0WD R I p Q0SO 0 47@# R WDS{V4 ;@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <FW }T7 D 0@p7W Q0SPU <0S < 00CSY P   8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00Ļ@P 850$<<#04 <00< 0< S T'  @0,(K6. XH BXLD <0 `<0 R <0m@ 08 ~0,0 < 0@<0 R <0 0U)PqcE P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /P  ( 0,0 H< 02Ģ@W`D@ B\ @0vŸ<0  @  0`, s^ ,p n04M  b l2 , d XN 0,0 ]2''<0@?0 < 0,0 K0`H0 <@ K<0 RS <0? 0( ~0,0 7<0  < 000<<0 H< 00<0@  L1@ H@ 00 0P0㢾@0 0S @E Ey <U<0 Rka   0,0 , d0 7'x 8  x@w@L8yyyTDx\y|(+ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ɪp3P000QP ^ K K  L0S0K\ K00{<XD -8@L Ӽ?0000 y -LM0@00Q  6 & &0BSp d \ @ ' "  | 21Ch 0 X 0K 0 K 0K4S0 Th@, -0L(S 0S     "(0!B "0!B 봗 -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f L2@;0<000 @ ISPP л'0`0`@0 [T5 0S(Q ` "2@Oᴻ&00`Pp+0 0pS T21C   P0p`040)00`MP`(  Pyy$ 0-L$M@8 0 0K, 4 $@ @ p%1ظ@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 R4 8 Q$ [R0C(0  K%g  y -0LS@P 00S p `RP @0u@050R0 050p c -`Lp@T  00@@0A   P  LRX @3QX @ - QL M`4 .@TPP!0DS00STk #T T&0DSpQh(K4~!T 0p0 0 "T^ U 00c 0400C00 @pPDU%21C0 40RaT  , \ 0D,0 Q, p RSTT T 0B0DTST U   8    | l \ L < , l \     \ ` 8    | L < ,   ,0 S(0    Qp@PDUT$21C0 40RwT ,    0  ,0 ST  0S 00 008 P 00C 0 0Rö 0R 0R 0PSPUv  p0%SU 00 0  00C 0 0S 00 00 0SL 00C 0{ P [ t P P m 0Rh 0Rb 0R\ 0X 0"T 0P 0RL 0H 0cD 0@ 0S 0SS 0 0 O> 0S. 00 0  0p0C 0 0S q q H p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   봗Ԯ 0-L M,P0@4K4 0@ (00K00T-D0D 0lCQ  /10 00yxT - @L00T -L P -LMP@:- ᯦P00PT"QaA0 10Q*(K媸0100CQ*00 0!  BR 0FP!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PKa ᕦ0 Z 0$0*xTyyxTU -RLM@PB `0S  U@PER p ` P @ $ 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @a,,0  ``  yxx -ML3M 3R, , 0R(Kl#00d#dK]OXP L.,P -$@P sTl 0R܂P  0@P0p` 0S0SZfJp J@ @0S00P :S      P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!5-常 P$ cP@f @d DT/ _]P[i@t000^@0 J0T 09-P 3IKAAP$00yP8'7xXUUUx TTyy -<@L0S (0}/ }0 @ xyxy p-0L R PP P l`PdphpuL0@D@@娶80( ,0 B @@UUTUTxxy -`PLl0V ``p0`C!VQA8 ɶ0`0Qe @vyyxx 0-L L0L@P& P 0dCPB00P0xy -LMQ@,0 ``pዤ PhEQT00?@AP*Z:a@ 僤P X@0fPZ :,0S MP 0hCyx -D0D 0 LS:PS0C  0yx p-LMPK`@D*P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xUyx8$ -$!$A0LS`: q Q0 R 0B0 呵00C0 V pP oP@ 00 R0 plP@ @0 ,TP 00DxyUxky -:LM$ `R pp p p p I)&pV 00@CS                                                       8     0        PPHx(9&p0XA P YW pW 0S㴀 Q Z0S0S  @TK X  7  000 , 004 080 pP ^00S  8  bR#P@  0 PpᰢP `g 0 .8KQ}yu(K6 3^ # Z 000   ᗢ$6@  * pFW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A0@0@ PP0 d 0Q00`Z  X 3RI,h|dp`d\^ 00S 0Y   ZJ =㡡P 3P (00c  Z  `0P3F/P`U RoZ00 @  $F00S00@Z  X 3R1pZ UG ?IBWPPP 02PP K Pp0T20 (0,0 儳00@ `4 8  1P08 @d\400c00b S8Kژ"8 @` RP _Y   aZ  @0 j5 I1004`"4`$@W5 481?80`@ cR8KT"P@ M4, `2>q@45 gb40E'([@ xxt(yLl,Uyxwkp̯Ly8lP0     x(0$0PQ00x -0L`0V`PpϠ@@⻲P,@ p0PP *1r P 1$0  00 yX y -@@L |10 x10 Dt1 0 xw U P0-LtP lPP 0SP@0  0,@P00P00x -(@L0SS 00x -8@ LP0SS 00x -0@L0SS 00x -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PuP0&P00S 0P0&10P0` T 0 00P0P0T0P0 ذ -LpM|K@Pt0: S K --80LM R 0 0 + ) K Uw P-L( `@T PU pmPp0 -R  *.@T PU 0 S0HL. 00$0$  -R  h.y8ywO --LM4@0 0 ;+ *)Kw --LM@HH-0 40 "+( *)TK5w --<0LM R$0 0 + KTy0xw --LM0 @0SX)0 0 R   p0  KUP0 R 4@-0 0 * {*Tyxw4yxxO --LM\0\ @0S<))0 0 * V*Tyxw P-L@ ?@P 90 S@ H -LM@KP0P@0P9Kh 0-LP3@P0U0 S UH P0-LP@ T U  0h0(T0hw0SS   0SPS00Q00Q R 0S 0S R U -LM@K 8㉙00 R000  0xU U 0-LMPKD p<00S@ @0@S b8xU -L`\M0V,0  0p#@00d3 Q\# Y+0x t0  0 S 0-0t0 0PUR  p R 0 |0 0 . 0"#4020lK@ b@VR 00Sn x b,Vo VG ŸR2 T l K0O,p PU  R0SVb V$"Q$2 0  6,PUp0S -,, 0Rl(K0 0@:V0@60 SS@@l K/l0[S x!Tt1 0|l K ,0p0 V0@l0K 0#40/lK@@ @00S $ t0+V  +lK@ ݍy 20lK@ Սr @Q 0@ x P@+lK@ -@ R x+4hP  +T2/XU{@̱ܱı| - \\00S^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $rU@Uy$U U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  b(KU<0@  T0$0!xxwUx  0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0Uyxx@h -LM`00̂000pSp Q  Q2 R  5P 0@`00@ 0060@00 00/ 00 R 2 R 0S Q[ 1Q/PБc 0SY 1P 0S4 ! 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$p$ 0S 0S U 0S0  aPP 20 6x0;P0h;00< 00aP@!. 00xyLy4U 8Uwww{ -L M0K px,,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  ݔ(K ה@Z@ 0SrP>W`A00 R ܑVQ0PY  㱔- 0@0 t- hP0 -  㓔0@ hPPb-0  @  —,0!@c#k괐< 0S0n  x 0S T0P@,- 0Lxxw4UUdز 8UH   -LM$`K@p( 0PTP  KP0 0S$ @ T0d0K0P 0 P 0S 0S @ @  R@ $0!n@xypU  0-LMPK ؓx0P h  ͓}@8008, @ 㻓8xU| p-0@LTP` `@T P @P`Tp -LM$pK` P吓 K@P'  R 0S )P @ {KPH, \@UU   _ 0! @x 0000 R 40S0 ,Uy -LM@K 8640 R 000 )xU -LM 8g@, K%`V00 0 0000S D0S $p0``0$ 09<PP@h0#SqTo 4@ Rjc*PP@@T vT$0S Q  $4 R 4?Y0$(33 T_;V @,K 㳒#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K s1A>0@!`X.2    | 8 0p00% t(" 0S DD %0@T $(%@T  q"*!@1 0lp!(@p C^ E ,KX!0S = @!0S 1d`1@!@ 1@ @@O92 M$M 0S ^1 Z1_@P  ,@` PD@D =1Tx@UUUPXyx4U p"1K0J1J0  p6: ᾐP0/SX6:KJ0J0 \ pXHwy|TxXwhpt VEwP8yx\x 0 0 0-0LMPP)@p690 0 / ☟P 0  K0p00`AP-040P(E690xy\xpy 0-00P @L (@= 00y p-@L@`0DSt0 P    $ < (`8 , 0 4 p<408`B400,p p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0DUy --`LM 00CS< 00CS,@@0 0 yw -0@=C0 0 L m]y -<L@Pk RVi Xh Xh i i Lj j i lj d0P 0S R  p, ; bR,P0W0PP} P0S0So )0PP0@0S <4  X`0a0Q Y 3 R 0S  5Q $0 bP $0N <00$ $ $@} 00S44000 00  0R 2 à<@@[2 RY0,00e 2 P `> 0R, SK 0 , b  nR,PL 0 R Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 Y  <@yxwxwyPPyypy p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00pHUyDU - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `ğw3$KyyDU -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 募101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKZp Vr `r Lw tv Dv v w v u u $u t Xt v 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0SXx Hx (x Hx w 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  m.P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`X0FXbSB(@T0"0PQA  `෉T0S   N#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⹛O 00 p0W S WV婛(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;XPxxXx`xXyyyx$y HUtxyșyyDUX, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRKf p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @W  Ѓ @ #Tp9 D3 0p2p/ p+W)00Xp P\Pa t0S00[:P\ %P#Pn VVS0 Y 0`0X$0 1 cRK P@P`$0[TKP @0S @1 cRPK P00 R$94 P\P 0S00 ":P@00 P\P 40S00p%P#PK0 Y/ 0`0\P `Pf\X6 `X4 X2 )X@@D@ \X@00  &00C0@@00{ X &X|<<0008& P\P P0S00 P P00C00S0&0 0`00C06 P\Pe 0S00_X >P00S00 &P Z00 0|P0@00 000 0 写7E`KPs 00p0S @1 cRKp00  0pSP(]A0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dX00( 0C p( B`0 ! 0S   0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRK"`@`P P\P0S TT @ UC 1 cRK@P@8  P\P P0S0P0 P U 1` cRK@`P; R P\P+ 0S00%(P( D  K0PC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH  PP1 " h=R }R(d= |0(00 00 < ^0`!<000C02 S " :2,,tx  KP  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,0dU -LpM`P`U @TD P僗$倗00 `P> K:`pP000T\S/ V%P@PPD0 R ㏗00@`P b P0: Sl0 0 0 00W0P `?*@P 00$KLUxx 0-LpM|P@Pp+P`'T 0T  K, P 0 0K0|0: S\0 0PUx p-LpM((!0S00cS1PU3 P K `P0: S 0 0PUKpP L0 `  `  0S h0R|* @,0S\P/Q)`  4*P 0 P`UdULULԵk̵PU 0-@PL 4P@T  0R@T0y -$0L@T @Ty p-t`LPU R @0@8C8SE @Ty0 0PU 00py -(@L0 01h膖y -laLPp0S  0R90 R @@ T 0Q A@ T 0S 0S Wo 00h. `V0 R:0 xP0@CTT WNHP@0 P42 ywxxx{ -P`LpG&P@pP P00 Q @y P-@L 0 RP0S 02n T000e7PPh0 R \0 RHP0h9y@Hwg P-L@Pp*`@U0S)Q |Q00W0S V  ,}@P`U`V*L P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z3|P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P L -LM@PTp p0 `V  Rd @-Q@ 000#0+Q0SY00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 ` 0? X? (K#V :|P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H{P 00({P`@hyظD{ p-H`LP@@%T 1S {Pp&@Dp$0 -PLM@ RPD .R*@ ZD 0D @  ҅< < @ S @ < RD0Y@  RD 0SD ?SW @[S S D 0R< 0 (KS:SI0CSD  P D 0R@ SpBP DP  Y, 3 Z@!':,0`C@Z!: 0P   0P *SD  R @0@C D  0~P T@:,PX<0SD  P D 0R@ S`B DP  Z8 :p@@@Z: 0QP  0JD0P C  0V @P@Z*8PXuD  Po @ pBZk:`DP  @ 0D!PPX  0P`Z*O<0SL D0 RD 000 040 [Rt R R8 QN <0S < 00 R00S 040 QO  R [R 0  S   R( 0:S R@@`:hzP 0S 0S l 1pf@T P zP0S$ @T0-S 0S0 \0]S4 00R D D R0:S<0S 0P0S40  s R0[S#0:S 0 @0]S  S  0^P   0UP 0]S 0k !R> 000 < -pPLDM䀟00PQ0S$ @ $ 0R) K%z`"zT@P0e@@Td`K ᇹyp3 0 0` Xy 0-LM@P K0S  P00Q0Sp008 0-LP@P0L p-`PPLP y@ᴋ P2jp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0 X$xy p-LMH@P4 `0T0 @ Kpx, -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ d0 Ȏxyxx -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  @$PP%U 0T0  s%U l(K<@T  PS0S 10   VV<00t1 VGphdS@0PS PQ^@%T<Y4( !ixC* Pix䂟Jψ0S 00 Q0W002|1 t0-S /P 0-S`RLŸ | bd@PpA `AT sx1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<UhU$8x xwX 4X ( 0-@QLPÉ0 00h?0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@w P0 bR,@ &u80S<0(K40@ cR4P@4 u4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , v0@ cRP@ t 0 S/R/00P -MLM0 c1\, @ TPA @/T@/T T9 />vP `eP V9 V:  @/00 0 0  cR@B^K pPEtPEp _P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/S0SAv`0XL -LM@2v0     00 K 0  fP 0Q/0000 `Ky -`PL@$ vP0Up tT t0T l0h讇LpP P tT0@P@x\yyx 0- L @ 0  0 0S[ :Q0 a/ 0,0 0 P0  00h 2 U$0 0긺 -`L p 0SL;z ( S , 0P@aT#T KPP@`)0S[` k`  0Q$ 0% ` 009 0~`j`0i `0` F000 0= S, 8@0  d0d`0 0 `$00̺ -P L`pM WP@T 0P Wd@ s0 0 dX`0 WXDp X0Q@ q@`Td#T! 圊P`@`z0S#0 ;0q 00$ \BWL <X r 0 0h0 0 0-@PLP t 0h0 p-LM @`, v  0`KS' PK+ EP P#0S  ;00`$0x R 0 B `0xTH $0`0p`  $ -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSL` H  X 0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )+A0G0S 0LP pc0G\L S  t H H H H t H H H H H t h H H X H t H H t L p L L0;@L0 \\ `d0GS \  V0X0 Pu`X ,Kh  0d |d0l 0d %~ P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d rdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d dXy\8L --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  X - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0p - L@ R 0 B 0,Up Rꄻ -P L@3 T6 pD `Q!   _8P 00a0S@@ npW   0Xd0P0 `\p Q V` T`蜻 -P Lp! X `$R9p R V@@ |n 0`d d0Vp0 V f4X ` 0;谻Ļ 0-0L@P 0P  0000   ,00 0- 0LS@P >P 嗣 0P 0P 0 0- 0LS@P'P 倣PP0  0,宁0,婁0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE©k(;0l❁@yػ --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0 L@K0 0 0 2P4Kp -pl`LP@)# T P (0V0W< `0``0$     ⧠dT 㙠P PPp P PPpPp0 -l`LPp@% T9 V`+0 0,0$ (` p ` P  \} SPPP P PPH[рP 0\ǀ00@0yP -@`L#0p᱀00 0,0< (0P @P T00ӧ2 0 o3Q00 X@,Py@- 00Uy0  U -<0@L b  @     y p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@X0T0@` DA 7A000 0@@PUUyy -RL0pS@3Q0@A0ZT2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA A000 0@@P41P``(P``Q 1gm`p`3)P``0  0Rm`p`3TEP0  0BS Q` L `P H040R@0@ `wUUxyycDX`] -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  YP 0  QP 0x  XF\ 0KT  0<p @A}= @0@40 8 < 7}ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@{`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA n{&A0P@0`P|P T1@@ f S{)]%0S d0S  O\Q\ hp p0\p Sx5 t oD5@f DA "{A`P _ %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $z  0 0 4 3  PwU*00Pp3@f DA zAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA zzA@p`@ 00Uap0PhP|t, <80 0c0SX2 R40\?*(00< d P;PppT;p f 9zd yU8h1@` DA ,zA @4@ @8 < ,8(1@` DA zA @4@ @8 < 80 @` DA zA @4@ 8 < 0@f DA yA`P)P806`t w0UgP} gPx |gPLryUU , < yԼ  yxfxt ܶ -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00$Pp  000{ 0 @Yy0@Ry P0P0 :00 0p0 p@;y 0p PyyyU 0-0L0@  PP0S p0P0S 0 P 00_,00txyUyUUU 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0$yxl R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Lx0 S@P0SL 0 0 R0S0eCA 000y 6f -L\ P0L `01P@U 1pT@P4U 0S fP0 -p@L BxTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mwwgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,eP(K0Szʊ x_w,e@w000 @0 0P, c00C0P|R    T8 0S 0  0R 0{T0S R 0S 0  R 0P { 0- L @P 0Q0   Q Q 0 00  0<  0Q0    0000茽 p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 }KpT$ K}$ 0R    x4 UP d} -P@L1  !R 11{ 0-D@LB^T @ 0 ! T @0{1 0) 1x{, -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0{(U4 U|$|}{ 0-P LP@2v0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000x4 x 0-t0p@l l0LB^T @ 0 0S 0S T @0Py{XyLy - pWL` % 0S !RRP, 0@@   p <00l0d@PPLu  @ 0  0  xpxx p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0Py{XyLyȽ0 R Xy |0p-"L@PC`T0 @ H0  0S40,  R+`p{PyXyLy -LM04!0`p Q 8{P ccP0U) P@T WcP QcP UcPbP| hPMP L0UP K5P R R0Ղ"Py{ p-LL`P@T PpyP 0@0PpxXy -pPLPH Pt0S P @tP0t0S P @tP0t X @T `Pt PtPtt@T|tirt -L0ML`K@ B 00P S H H  \ T T h L ,   @$((P P))@$(P P)'K|@(@}P@$p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S        $     VU@ PEP@p0P@SP Ts0TSU S 0P@SP p-L`P@es ph_ -LMP`0  s0 00  S  00R  0Sb@s0@0P PP00 R00  0Sb@ts0@0P PP00 pW7 @Tg@WsPU%  , Ls ,@0,0 00 R s 0S m 0S oPU0 0p0 pj0 e0000(KLp -LM`pPG %P?;0@:S:8% T# T# T# T# T# T# T# T# T# T# T# T# T# T# T# T# T# T# 8% T# T# T# % $ $ T# T# T# T# T# T# T# T# T# T# T# T# T# T# # # T# T# T# T# T# T# T# T# T# T# T# T# T# T# p# T# # ?P(K0pP @2P p?dP00S b -00@@@0SppX @80CS,* * P) ,) * * * * , ' + \+ , , \+ H+ ) ) ) ) ) l) 0@,0 0P SP& ' $ & X& & % % p% 0& & \% ,0@S `T"T\P,@  pW@0  ;P  7)@}P@${P} PP @0TPS@@"@0,0 "@0,0 |@(@p$}(z(wP P)l)iP@v$c(`P P P@] 0S&$Tok @Y @ @@D 8TT 1@T,~)d0 %0 SG 0S x%  0S @ P%0S 8%4%0 % 0Su @T P  @T 0@TP  00S @TR[  W0S  ڨd$0 P@ 0 <$HX:0 $? $08 #00P0#  $ #0#0 #|#0 R 0S @ #0S R 0Sv @ "0Sm ""P 0  "Z "00S @ "00@S x"C h">X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ HVPfy (0 R00PP0x P-L@ 0 p-D`L0@ PR  a8" e 00b 0pV p-@QLP! R `0 Q 0Q 0  " 000pT`  0Spp0 a" 00 0V 0-hPL@T\@D P0R  P 0,0 0S0C0000fV^V 0 0  !V(o(g 0-4@4P0L !0 0 0V(g(o `,0R- 0!fV^P0 0ɿggpy -pPLP@`0e R0@00U0C0P 00 0b@~0U00P ~8 0U00~0U00Pfg -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  }000PU@08 0S  +@R<@ P0S | 0 }0@0004S  , 00c0(KP @>@$gV gggxgf g -`0` \0@L bNT } }$0$  0 ggggf g -,@L0S `0000fx -L}h~ 0- P@Lj`0hf`x -L0L @R TT^b}@@$h^} @}@x  0-@P LL 0 00h p-X`@Lf`Pb` L0 0 px -LM@Pa0SW P 00|q$K(K0 @,K @x`PJ (1 ($9 $0V0 P,0AP-N 5xP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P<lVVc fffff -L MK0 K @KK @$x@P |/yK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @wP U? `EX80SE40qMP@0,0,  !wP00S 1T0 S/R  4x1!1|1|!@@Q (K40XPPpx1 @ 40!A< RxXpPPU U 40ACxLP40< pꌐP{ D00dQq X0@@_\8 4{4sx <pVVc fffff -PQL@0 U ᴥ믥`V TLtp@0 P0C 0 - D0 P[L$0PZfVf -LM`PP 0 |? R) 0@yS w w w z w w z w z w D w z w w w w w 8 w w w w w w w w w w  w w w w w w 8 z w D w u w w w w w w w w w w w w w  w u  | w y Py w w x w w w w w |z w y w y lw w | w w | w w w w w w ,{ w z w w w w w x w w z D w w |z w { w p| { w  ~ w <~ w w w w w d} x}  "30#`qd͟d-0S00PP=  Q $?Q@@NP@$= ,00CP00S̟T 0 PP@^R pp00 f`PZXPṤ봤P|K@0 P0C 0 6 00L,00H,``@<P < R 0R0Bࠡ0(K@<$ @5 ;+;;;" R% [y0S;cP` 0 @c\Vwy\ 0` cR@0S0C0DJ0 0 :  `Z bVT:`V@ :<*00fc@A,ZWP*00@r`J0 0 O@0S0C0c9 *9)@@ =9@bx9x9d)x9VH9@)lYD9@@ H 4P`FVT \9 0S0C0V) 6HXPn0 0 08! R;`8(L8X( 0S0 00<8 㛣PIV QB \8  q 0 QuQ8 \, 7'7@@\ 0`x7@P7帧@'L7 0S0PW0HW0D P`FV@0S0C0~@7 ^ 6&6 RFP VoP0` 0v0P<64&P<6V@@Pd0dX 00d0mL6 @T Vf5引5pPQ%00 @ p0DP0P0U q %000 Q\%00ӑtE \ 4$4\ ``0   m V4 Rc4x t4 0 c`P$4`U@I H4  wCTfP?0 0f 03#3@@ 4# 00@3C0 qsP 000C0 l@`P00T0SP0 䒟pWF 5IP 0S T2Ÿ2P2 P@2P0   Pc\! 0@P`@0`%S@D"h0S `V  q 0 Q Qm P1 P00P0S@Zd!pGQ 1 @ q 0; Q9 \@Q0@ 0 0R00Q 1  `Q q 0 Q  POPJVH80 <fff@^ffffx,Vfff^D8D`x0d(gy@fxVPq 0 Q[Q+l `U00S' PHP" ` @0` 000u0 P0^V  P00 PP0E00 mH0 0c c, @,0p QZ  pzF00Q0 , nF1 Zppd GH @, 0WSwS0  r 00 0 0R@s B 0d -L M\PD H PՠD/D?8/8?,/,?$$ϟ/P3H ? / \ˠ#ODΟ,KP @ P PPP0a̎ ,0 N0b. P0>լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0YP.Y   B > . >.@@LvQ4  P 00 S v@t) R ] 0S 0S 0S# RP  d Ȉ 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  P< 0S P"0S S S00j000S 00LPm 8 ̎ Ԏ T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t 0u .uu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@E t t tBuH0 SD Q 06D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0>600u P!s\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTd @ @ @ @ В @ @ 0 Ԏ @ @ Ԏ @ @ @ @ @ @ @ @ @ @ @ @ b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  a 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;f^ffff^^ftV(pyVVggggfgx g g(og$gf0w<<8VhV ,` N@P"YnKK`F/>0$K0 ᳀ r NPr( 0R $KD, r 40]p(r$X\BœB$Bh -LM 0/KAA ,0 + {POKℂ/v>;lr 3K; TK00 MP2Sd St ZNK@D@D/[>0 5 M@PvZK@2SXڊK`J/ F>0 8 e M@PXY l>P;5S8ڻ^KPE PE5@S0/%>08 ; i I lMP*_1( K+Q0(K+P( K0+Q8[S K+@, 0R(K2`S܏tr.K1`ҏX\Pr0+@o8qXL$B B"B!B -MLM/NK0 /`q(0 =0 2 M@P0K00S$^^KPEPE2K=P 00@S/=0x 5 P2"3K2#K3K<Vq8 ,n0 nXL%B  p-LM@a0_K@/0 = !0d0C S , 8 D D P  n0$0 0 @LP-K30gS 0R|| 0RKp0$0 0$0 0$0 0$0 (p$DXL#BdD8 -'MLM40OK /,0 <&Ɵ0 3 K@P ٠0So 3ş, 0Rn(K;K0SjKAAI  I / <|%|ş0|e6 9tu4 (K0P)\0PK@PG)R K<P9S (K06PK8C8sj@K 6K $'<( K0S3S` X P H @ 8 dA?KK $<3s s 4 R K K?C^ c^ Kj@K6K 0K8K @F3S c'}KpGpG`/<#09 9 g 7 cKP' K@U 7S0 (    p G 3CSL GWT3 Rt  K>@#(K<0( K0#(KFK#;6[SW V@K ,6[SI PK , 0KχK2 RK3`S)0 S) *x 7K d"y;3CSGWK@<"<2m;40,($ bEaC bAb?a=a;PK ~,V@K x,0K@!PB;  0P勬OK0K0@t!P/;C^*h 0KKjKP!#;HHHH!H1n 3S0C9 # 0KKK6KjKY3S9 WoToQoXL B,."B”H!B tl@h\t|$$ -0L 0a7|@ -H&LM0@Pp,0 B VC P`C C B B B B B %cp> C0@3S3| 8 8 8 8 X 8 8 8 8 8 8 4 ( 8  8 8 8 8 8 8 8 8 8 8 8 8 8 8 X D 8 8 8 4 8  8 8 8 ܻ л x 8 P @ $$p$0cP1 @ P`T ?K f:tp0 Q"#U U U U0 @ 0@0 0@0 l4 {#0 @P`0# 2 q3 m1 K@"3R_ 0k Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ A2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /'x, 0RB(K?V=  /V08LTMp= 8..K0@ H@P2K1" 0V cV" 0@0 P #-k*k|'kt$kl0 D0k\4 {mXL`HXTP\Bœ,th -LJ -0L w|@  -LM@P]I!ᭈpt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( RP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00@h gfffB 0-,@,PL(  @|0P -LM  P: K 㰩p* 0#4 P; K 㡩p 0#4 idK^Yjpjd@dd d0%TjI @,8 ,0x,@ -LMp D K`P= -KPr UP< @ 5R 0S㘂 b@P *p2^NT ` Pj xPU l l(KH0 0>3P@;j@D5j< @ dk@0SO ᩱPG 00L ᘇP4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , iNP kP  i ik iDP Di iЛ0-SL0S i i<@@  l0 R \iD,ir <i@Mb\L<( -LsMMxKH0H`,0 p`P%L3Q iP03 R;$3 RA P, 0R(Kn0S  {iviH7: Sl mKAA|`P 6: S ፯PPvH7: Sm mhP, (v"hP mKAAMP;K8n2 [1 R A@k PJk0: KP`R렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {fNK@D@D.P! 'KkP{K6P喈c f^hYZP| p}JL@PPXl@Y@@hthp | -GML Mp2 P@, X"p fP. iP% ,"p 2 PbaU5m2IKpJQAA疼P4: S X1 11 1sBKAA +' P: Dgc6$ `0V/S /004`04 X p5 p@/PP 0PST @T 0/S 0/S @TPo60 S`ЇpHX  kPpX@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -L[g -LM0@S K( (p 0 i|T -LM0@SKP + 00  -0LS@0s30 RP 0s3 -0LS@ h** -L@0P 0\i 0-LPw0@P bP 000Hi 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XP%5P <0 e 0,0 00 0 0 0踁 0-\PL0S S0@ S 00@0)뼁 -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPX0P Sv` %WP V?K|P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯( T I `dIPpp`VIpPp`IIPpp`;I`/Ippp3`" K輁 p-L|`P0S @PP 0PS p꼁 p-LT`@0S PkP 0@S pw꼁 0-@PL Tl2PX0H0@ R0S(ã:ԗ@h| ! -0L |@4-0 CR 0R0 S`00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` 0@P,00,0 -PPd , D20< ,0 0 @@0P \UfXK 0pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPC40[S  5[0Sl|t `@L0VU D00S8 W $(K`HX`xp@ -0L =|@ -0LAM @Pp  Mp sPp  Cp0` fRAT +2JPNKPP WƖ.1PPeeXm -@LM `Py1 u100 Q03*,  0,, pW00P0 U 00 @ep 0 F"P02@0P5 :0="P *0@@,0 PdW p` 0-LXM@PI! @\@0P00 lK(T`00\0P0  :&K0|FЁ -LXM@#!\@0P00 hK(/\00X0P0  :n&K|FЁ -Lp`<(P%@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9  T ` x 40S0000 0 0*}#p 0%  (00?0bS fS)0S00 (< 4<̠Č8#Č:K"̌,K$,4, (*K 0K 880S&0 0000 0 0:K P$ Z0`<`:KdK #p 0`04Z@`3|0  0KP T d K[P @T`P d &p@ d0Kp @T `| 0%`Г*K@˓V@Ǔ0SS h8J'P 080(x0 0S$k $@`PO dK 'dK<K)K*3[0C3K:K3[dKS3dK ) R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[S$`$$VY0 0000'0S<0 00S 0S$000 0T`0 000 00S0T0 0-0 000 000 0(K p-PPL@00=&`#@P L00040 P0 :#7#@F&p -L@M` P. .0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 }P02@0P5 :*0 tP $*0 @@00 PdW p0@ TP3 : 0S 000@ 0@,0qU dP"(Kd p-LXMP@`c0 |P0P00 pK &md00 `0P0 @@ :f@ #T  00Y@Kp|FБ 0-LXMP@3u+ P>@lK%9`00\ \0P PP :1@#T (0 $@00SK0|FБ -L@000  PhFG-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ -LM@ D1>?  08^P0Q8 n< ?^Q@ n< ,<P@ < 8 ,<P8 < ,<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h},0 -RL`? D@A1>?0( @PcXPp: +@0!0@@0D@e*@0!0@@0D@y@00 @@0D@@H@?X X  P*@0!0@@0D@ 0-PPL 80P $,@0@0D@0 -LXMP`@Ep+ 0+P;0 S 06 0p xK#d0 s000+l00d0 KQ`0 S0$00DS$0 0!$0D -L`pP1#y @P 0V0 P0 W P4 U\   +`P  @(#` -L0M`PpP) K.0 P 0S ȏ0"S UD@K +00 K{P(@{u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*K8M4.K BJK$RMK(@D:KD*KDp DB=K(0C4@ A$$(0B44P@CD 0 S<  x       00S0,040S l0SJt0SGp0SDx0SA\07@"0"S000`0SS S000d0SS S S000S4 PB$`0S S d0S S R  h0S S R  r 000SS\ 4 <h0SS\ 4 p88q < r qr h0S r q000{0000S2WeEP\0  % DK"DK 0P0<p0S=,0S:70 "p DK P&0sDK0S$,0S!\0 000.ap0$0 00&$0` R$01D0s0,0S00 0i(00?0bS fSa `0|S$01D0P S 0 (S 0 0 0S 00 S 00PP: `X0$ 01D:K$3/P0 K pp` @ K=P`K >"p@T T \0"  `KP 0 S 000 0 0 0:!P 00( r0 `@K$!K #E$:[0C:K:K:[Shh``K\JK #KKK :TRP0"(@K0 SJ|@T:K*K!,K)( K0K~DCoP|:  |K7)*K$^ 4 | K { Kx0 ^#JKDtK0|K{0KK\0 :K*K,!JK):K$(K0~4@ | |KP`9[V(/0 S 000 0 0$ 0 000 0 R,0000H0H0 0 -0 0 000 00M0(K$Ax -@LP 00  -@L>h> -4@LP :P  0-L@(>P0P@ P>0  -LM8 Y< pP x4 2n ǮP!X20S002 PP 20S00#30#jp3Ps 0m,`  v(P00CS00 Ӥ0 R r ,Kx 80SW00S b(P<,K0,K@P 0K ,z00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 0004  0(K p p-LM@d`P=P@ 0  ;,0@0S =TKp  rS-@L`P"@3:܋p 0P@ы@ϋp p-LM@d`P=P@  0  ,0@0S =TKp  rS-@L`P"@3:p 0P@@哋p 0-@LP 00=,@r.0 }= 0hs 0-@LP 00k=,@r.0 e= 0h p-LM 0`|R=0tr.@lL=PXG=\00SgP  0`P@6=Kp  0-K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 S #  # # # # # # # # l p# # 40P0 P 0000 SL0SRL0S 000 00S0  .V S:Vz` 00FV08 KQPp40p@P  dp 8K pP@?0 00dp 0q (00?0bS fS0S4 0R  0 :K(4x5<*K 0880S 0K P<:K P(t 0S<`:K(05`P0`0*K84pL*KpK %p0`0>:K8S@ p KP@pH KP TpH KPHK P`P l p@p0Kp @ T HK ;p`K*K@FV@P`A0S 8P 080(pw0 0S$0P04 $`J@Px  pKpKHKnK`F4[0C4K4[pKS:K"rX*KpK:K8"`VK0S SE& S S@/Z:K -5*KOP1*K"+Z)*KAP#:K KZY:K A*K Z Y :K 3*K p 4[0C4K4[S @$T0 000090S <L p`뒄0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0.`(K -L@`pzP 0X@~ -`PL@@P00bpPP d0T04@0 T0L0+P0 YVPe   -LMB^KM`PE@p x0RP 0 @m@P <00PP<4p84@ K% -L@P 0@0B -LMBKMH@`Hp 0 S񟗶t& & ) ) ) ) ) ) ) ) ) T( ( l& 0D00W0 pS048 rP@ 0M0 0J0(S 000,@P. @p0S( 0S%$ 0 0D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p+P 0@/ -0-LPM@a?KC/_K@0 Q Q 06Kp@ `@ 5,0 pK\ L0 ,P l  K0|) -L1M`0pPKA4 8 0 p 1S01 R rP P 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SP  00CS0P0 r T000U񟗰/ T0 l1 2 5 X  PT0*0PdP # 0hP P 0?P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SoP Ti (K001SSPTd 43p043 BX @ 0@ B0T0  RFP 0 r U000 !P@ 0C00X0  0S(P 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#G80#   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000<PX   _K@PEt~T-xePEP txq;0 8{0p@ 8㓖0p8W0p4# 4# 8S 0e4P4 4(KP -DpL0`S@P8n 0@S2np -L M0`ჀpX0S 0@P0Gp 宪@ d0P0Gp@  Z@  b$K -L \< ,@ > d< ? ,@ ,@ ? ,@ l< `(7V`Q0 0 C Rc 0*S `  (6V`Q0 0 C Rc$S00 V,K ,0Z dU,K ,0ZPY Q00B S U ş00B Q!bjPh0 0 00B S$RB=@<0hSK@@ 4J20lS @+ @)L'K%00F@  00U,K  ,0Z P    00U,K   00U,K ,0 Z  00U,K  @ 00U,K },0  ZP 00 U,K o U,K i 00 U,K ` U,K Z  00U,K Q  00U,K H @ 00U,K ?   00U,K 6   00U,K -  00 U,K $ vU,K  p00U,K  i00U,K  b@  00U,K  X  00U,K  O  00U,K  F  00U,K  = 00U,K  4@ 00U,K  + 00 U,K  "U,K  R+ZM0@ d1P0Ep@K ,0 0S3dA dA dA dA dA dA dA dA dA dA pp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A PD70  c`D7 p, 0RD000`D & 0^0 0dP`V U00DD 0DO/KD' H %2 D>&B aP`D D'O?KPbdU<7P7 kZ 0K⠡K)0KP7 D P)0[Pp'PS*0[L L SLL  t' ,@7L@lT(`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,@L'@bT㜨`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKP7@eTL`$H` \0 R0\0 ` xdKvPK@DT 0@` \0 0R\0 ` xdKaPKp D!` \0 0hQ,ァh d'R80S\H:000`  \0R0\0 ` xdK8PK<7Sp 00h`  \0R0\0 ` xdKPK80@cTkP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK<80< a<0D'\G0bT@T` \0 R0\0 ` xdKP[K\? @cT,lP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.KD<\'PD p7 00h`  \0R0\0 ` xdKPK<0DK000` \0 R0\0 ` PxdK-PPKDX'0B0` \0 0R\0 ` PxdKPPK<7X@iT$`2H` \0 R0\0 ` PxdKPPK@DT 0@` \0 0R\0 ` P D00`  \0R0\0 ` PxdKPbPKXK`` \0 R0\0 ` xdKPOKp'* @7L@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP L'@l1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdK|P0`0 x'0@0l7 Ttp 00lw TY h@P 0KP DO< Ml(K -DpL0`S@Pb Z0@SbpQRP000S0 0-L9@P& 0S\00R001S @  0T 00 X%T00S <0@@ \ 0 0:<0Flp -LMGPPX 00z`10>CNKTa@D @D 0P3KHH v p* T0S \ PT3 4`K Xp{QK0D@K0@3[<3K03K\ Tx  (0!"(80S s00 @3[P3<8P@<0X0P(K j  0- L@KMpP  Ap  Ap  ;p Ys0$S Us@'CQsP@0 p-`PLU@`U P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@_P2[  rW0 02["[[AmK0`F@`FT@D,Pd 00S  r00 K -L0MP`XKBhr@p0`h p^r@0BZr0w@0 dp"pOr0 S Kr0WS00 0 0s 0L 1\p 0l0lP@@ X0*K8#8 $`#$0@"K<0 8 TX0( K0`0   0L0 P +w]p@ r0Sl X0 0Rl  0 00l 00A@al0S'p cpD l00Sl07#!dp4 0K<0  L:pq0S&P l0`d 0Cpc@ ֓pq0SPq600 l d0 0Rl jvp qq@sAq0@0q0SZ q0 Sq00RL 0,1\ "d0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`pSP 0F@W -BMLMp`?PP& 0 0<@K*00  X`\`TpmK`F,Kl00S p00 2[34[<03[80P@ .P K j .S 0S0( <0R0(0 -LM`Kp&@P0S@PU_P -L M `p6P2(>@P/ P+ PP&, 00S S0L,0 ,0P4P 0 JPO ,K4K @P C``(KT -LMp`P(K @PL( 00S S0B(0 (0 P  -0LStpPB`. T@! 0PU`pPE@TU E000 L -PQL`p@P j P) 00S.S%b P 00S.S 0.S PP*L  P *   P*h> L -p LP >`@:TP@@3 T`h-`P@ P00CS0 -@PL @@ 0!@T 00 h p -LtP =00D00H00L0(0 P00T00X00 \0 ` 0-@PLP P 0000000 000 0-MLM0P S ANK@D@D @0CP @bAP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`' PPBT0S ZT 0[SOK,] P P0:S 5P 30K 00S8#X VOK`p W1[S S04%40T0VK1`X![|T00T0D PZ 0ST  P\Vp 7p@ P @ TP Wpy<X KQ 0P @  P0b @ ` P 0f@< p W8t<@Tp  PP@P U@ @ X0K@ TWx P*Z00Z0SP IXKAPh P pc P= U`@PX KX PDP@ U$!0@0' H PXPKp @@ P000  P , 0,K 7,0SpP W0SX[T@HAP`*(KPlpD|8Z p-LM`y;P0:0/JPP JK@D** * |*  P11;d0PP JK@D*L* $*  P11k;Kp 0-LMP^<0SY T0ST 0S OKP. Ph 0S @ . @P@ P TK0@h -AML8M0PSL $K3pG $ 0bSR@Kℏp:  l0R6 pP3 l00X@P# A K@08@ C0`0S020# p3P` v A=K0C80C  ypG0 P^ pK踩p p-!L0@S00K`PP6 T:Pi@P@0P!S[P Fp P w 0SHP T3p DBP Pp& 0-@PL\\0 0PS@T0@ 000 0p -0L@S4Ă     $ h py<TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@ol`P@ el`p -LMpP[l`(K0 S00( 2K 4pJl0S @P Al` K0A>SP00 r 0_R -RQAP0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<,(K0 -QL MPp` Q QiPc  a$ KҾPZ@ @$00@PP%aP d@PF  f008 K⵾P :8 K⨾P0@  80K@ X 80[S70[0SS 70[0S SᙼP @0(KP 2(0S K p- `LV@P p 0P*(0 0p000p -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0p6000p - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0`ST8  , 4 8R100 5@1(:=S 8 P60D,0,@ T0*X1@8 T)p& ZY  R !  b0X10000 40 PpU0ZYPv 0S0%50 r(0 0R0 0(K -LMkP"{`@p|yc"Kr 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  P4!Z;   !P! K'# 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S  0-< LP@ P0 -0L.S@P&P-QR00(+P00X0`dSp U `V@1@! WP P0@0S.pJU000 -LM0p (0 PPUoK0K/ KP@'L1[S  E0P,KKL1 H1 D1 @1 <1 81 41 01 ,KoW0 d K/KP@ 8( 0R$K X -L@,00S )P -LP@ @R0000 0  -@L]8p- 000s00 (p-"HLPp p`p -LM   PS0  X0  !K  @PK@h@"00 K p@$ -LM pW@P 0\8#Ƞ0`P W@PU ("(pP@00 p-LM ` Ƞ,H@PPx ~p 00fx -1L`PV@  E0pA("S$:V: 00P  000x0 *VT0   @a J,0 @g"0 0 ? -82L8M ,00b@ 040 P#00E.U  0 S00S R40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< a00 (KR P`800S80 o A1!O p p1  0^0 QQ \a00`Yp L1  0@!100 , 0 K 9 QP` /  0/V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   Uja"00zp4 ZPD| -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  8a"0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8V V0 r/, 40 0 8B t4cQ4K 064 0  8\ _Y04K@ 4 0 40ds04K@ 4 0 | -LMȠ0`p  (0 PPqK 1P 10( 0R$KUOK 9 SK9,KK9,KNK/`KP cK]0傎X -LM@  K K0K  @@LPK -LMd`0@V,0  pܠK?PK@  T@060#0@@T Sb h  h *i  8@@D0\0#0@@T 7b  h h iT, 0R(KܠK "b@@K h hp` X  -LhMD` VZ, P@ , 0Re(K0Cs P  VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# `V |  | d刍  0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 zXR-A ^ QQ 0SL\* -LßMS 0@p8@ 040 < @ 0@ Z0,K00<僴PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R0080 @\08(K00@P@ 0 , 0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@ ( p-LM`0`@K KKK`K/ZPP +0 000Kpt -0L: dYPt -$0LM KYPt -ML M⌢0划`,0 +PphRpP 0/Sf PKPj BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SHBK@@P 0T ]@PV00SV00S040 t, 0R=(K0P 0+Y:bP 0SPBNK@D@D+IP 0S BNK@D@Dt+:8ZPೱBNK@DD@D04  P: 始Xt4T<V`, P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMS x P @ 4 l 0PUUwWx 2 Q PP U W1 PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@Ex±PHTHgfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7B@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EPXHZH L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   0F 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&F2x'x )8HR@J*RJ@@b1P 8#8R0PE*RPE 0U0D L H0 RLK p(KT `V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HR`y 008 0pp`= 0P-L7 -`EL MpS@`Hp D P>R[R0:4R005%0\, 0l\9c%>*x'x )8HR@J*RJ@@b)` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b` 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 j @ Vx@ 'x0!8H,0RS@@A@ >:@b R `>0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F\R0@-@P l^0,00 nSBS\N_0 0- L@0@PᘒP $0W0R0A -@`p0 0V@TL  0@P 0 sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < wX%X a)8HX@*X@@h e Q 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0A -OL@dUPO66d"*`"*-R 0R\ p-PPL @T0. @ p  @U *P/P /P BU:R  BU*0/S 0e` V*p@ 00p/P  BU:00/T/. @ T@?00±1 xB 02 #4xB 024=> 0&@-/@d4xB 02d @-M)Ѝ@4=> 0 S -L 0KM#' -LMK  KP K -LMK  KP K -QL M@ K0 0#0  # 0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K P(KS00\H88Z!* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP00@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PEDX -PRL@`pP@ 00PPPPPP p- @0PSL`R p0S 00 ~  01 0 0pQ)03 0 00  F, *FP4 < D L T \ d l t | xtplhd`\XTPLHD@<t\@pH( * M0-LM0 0 0@ Pu:K0\Q0@-P0@  % < ^9p x x x x x x  0 8 x x x x x x x x x x x x x x x x x x T ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@P p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T 0G 000jR -LM8  Bp`4 -PK 0e@YX: \p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 A0eS`40c(K@P* -@LP <00Ĺ p-LpMP@T b KpdKwr`P P L0  0: S MPO0 0F P Ĺ -AMLM0唣,0  Ur@P |_d`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P 0DT P 0 P04SBNK@D@D +D @P +PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `季0DT`  PZ 0 P螣04SQ%`P& `P `|P `vP `pPX `q@P00, 0R(KT` <}XĹĵxȹxT@pز 0-L@P0PP 8P0ȹ 0-L@P0PP #P0ȹ -80L R PP ĹȹP@- ^ 0S^@0 S 0SS00@0DP0  -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (KPN0 0@< PpPp< P@`* p-L`/NPP!p@ @ ^OP T  0RpN0S p*yy*QQ*vv* 0NW -0PLM 0 K0K0 [P  Kj*f*( ==Z*iiV* P-L `hWM00::E*))A*$ -0L MK , K0 0 0 P 0S$$$  K#*SS* -LM KPwt@* 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P AM@?00 -L M0 0_5 K -LDM`\`, 0 \ M/00@, 0R(K^PK2 1PZM@(000Qq J00A SGsP@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"00A S  Z R r@g P!00@ TQr 00A SPL@00/@P00 PT@ 0@dK 诠d0S@| L@00w0XSxS Pr 00 D} V po Q( &q$ !000D  Q|!00ӑlAadPH0W02p0 `VI:00pQW`F/Qt Q@Z t 0h1 T'V00h!. 0T 0Q %{zv 0&0S SS 0h1P@@8e4 80$ 0 XPD( -LM 09U<@ -LM0 -I@x 0-LM4P [[@[0[ P@tK0""]*jjY*++U* -L$Mp0`QP 0 " @@K0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKAP `yX -LMX0@K`P$0 p# ׺$ 0R KyX -MLMK@ , p p`PB@F XN 0QMOKHHV !+ gmpP#  ᚺV'0OPU`>K@ :K@ ph, 0R%(K U CmpP&K@ "KW@UVKAAp X4U0eʶW$Qy  X 0-@MPL 00}K0 9iu - LMK0 @ @ pK..`* -p-LMP0U0  @ 0 ]0Q a0}`PU 0  Kp` 0Pd C ,K K$0K@( $@ P, PP 00|O@77** * * p-LMP4K@1 K70! K,@ Kp`( P  K0 4KePa$K@ :W ` KTQv$Kp K 4A8pX 000 P@ 00ӑP 00ӑPD0 S000 p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` P0S PUW kfH 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SD ]S5 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S& @ 000 T   R: 0Sk 4 0u 40@^Zq9  0#@TfJP0` t4 ]040 4@ @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r `ǟ00   r 00  PPg7@T ` fP0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<, 2P  ,P  000(K0P  000   P`0S  @  eo0 `R P .@P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, /*0,S  T R" ^w p0`P  00 2 0 00QP ^V 0 @R4   bB"(Kos 4 %00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S000 0]Sq(P 000   PE v040 1PDL p-LM0K KP` 0 ^00K K0C B@0K K#P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@PP -`RL@PpP  0!T000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! BW 0Ap -LP`@p0 S#T TW0 W000SP```@@@@@< @@@@@@  hg0f0c0  f00   fA  f" 8 B a  h.@0 fw  f#  f"  B a   @pG`@  f0R  fh-@DpG`s&@D`m -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  i R *0Q0\S \) j V1 0H  R@R*0^0\S0)Sn Si3UbKa F\MXVR ;N 0 M J/  0 hb  h   h0V  h@70{S1 `R*0,Sa P 0`@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSa*((()())((+(((((((((((((((()(((((((((((((((((((((((((((*(+()((((((((((((((((((((((((((((() R*000C S  R*@*0D0?TS{T `| R :` VU RZ*0|SW0, 0R1  i00 aC80" 00 P (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  x(00(0 00000up 0@ Gg R*00T]\g000C Sc^g+Tj 7*T  R`**0A0?QS{QN0\K000C SG A ` 0  fr  f   f0f  f?T= {T& @Q*0,S p 0s Rd:    000C S|Tp  +T   f0&  f 0  f  f  f/"  B a&  j  G 0  j 00 ,0 0}S00I0}S  \  R:, R (K0  a  i (Koo -0LMS@ `  PPa :P  0    P   (KP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K00C 0 0R*K  0R: K8 0A $00S0 00 ) PP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK)6KK K 0R:K PP Ee -t0 LR  @T P0R000PtPqPn<PkhheE * * * -QL0 M4 0 0R000(K00* 4南PP- 0 P0S p`@P `@ P$ pW21C0 R4Q  000W |_PP(KY  0W0021C0 R 4 R 4 0W00P p- LP@P` x`P T,03040S000 R   R0 \00pT * * * -LMpx`P 0SLXQ0LL!PP00P00@$K(K ]P (0 RP@Pʐ T,LP0SMR kR mR gRPAx,GR KR R P,L(P8PK,PF@h  ]E-p0 @  R`&@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@gfff -LP( <3aL1aa Q -LMPR, `VP `ZpA  P p WVP,0p -SL M` -= =  , Q qg ͟0 a ,P0s 0 00  P,P r`QP=q@ 4=,-0S0v>C 0C0 000p4 0v^ Pj ,3`20!0Ǔj   0C\0 1 0\00 pp ` 0 K 0 0, %Q`p ,P0S,P (KWp%0AUS\=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=p=@@CB ChBBBBp=p=p=xAp=|=p=p=AAAB,BBLB(AFp=p=p=p=p=p=@@EEEp=4E@p=TEEE`CCp=Cp=HDp=C`Dp=DDE>,~pʟP,P ~ 00 +0N, /StH GtH G G G G G G G G G G G G G G G G G G G G G G G G GF G G G G G G G G G G G G GF G G G GFWU,P0p X 1 0@p P Ap ᶔP Q0 4W2,P0p  !0h@xp ᝔P 8@np ᓔP Q0  ,K0KH8P 0  8v.B B 000 ,K;0PW,0 ePP, s ,K =0PjW,0 ,K0K50P[,K0K 50PS0(, W,0,P P,P 000C S<,K 0P3,K 0P)W,0Wp  ,K0Kc0P 0010!00 ,K 0Pz 0C000Wp,P r şP,P r 00 W]%@,P ̓P/0 SM Pp,P WG,@0SA,K0K 0EP: 05 B`10`c000 ),K0.P# 0000ğ, ' ,KPc0P,K0K c0PW,K 44P 0C000WB WI 0 ,,K  0P x000d2,@ .PiP ,P X@#2`10!0U D1 V R`c Q P"? 2c10!0 c;Q0 0 0.0MS, ,P0TS,P DQd00N, P@0@K0pp",P p0P,0 ,P"pPq 0 0Xz 0P00,P Zp 0P00,P 00K!P00 0@E{EA!/0C!b10bcd0 B!a10b cR0 0+0 0P,P 0 Qw,P!000 A RPPn:Q{0,P @mp ᒒP0 S S 0P0,P ,0L CA0C0  RSP,P l( $PQ8h'$InHh$X0aj*f*uub*%^*% Y*G-Q M 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ -LPp@Q qP D2  0=QM (b0P TMLLLW8Q@T W@W @W@ X*0f1@0 Z0f A10# @  Zf0 A2"0 Z0 f00TLLLNM=QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PSP0*,*  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CS^ 00  ^:`pV`` W0S P`P```00 p-0L)S@ p010CS^ 00  ^:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V T P `0 B  d00EPP00 Q-LPpR`@@* P 0S @V000 B  e00 0-PL @0 0-PL @0 -LR0L0@@PT@ lR0  0 R B0 0 D -LXpP`@@ R0D0TST0S: 0 TP` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P  " j0@@@b00uP0PjQ0PE0P"*bb* 0-LM 0@0 @PK0**0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T60 0(K4@K00K 00 R@P@ JP8 P00H S 8P p0P< 30D0 a0H@SX4_$\$\$\$\$\_$\$\$\$\$\$\$\_$\$\$\$\$\^Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 `P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦^[[[[[[[[[[[[[[l][[[[[[[l][[`]4]]l][T]\I@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < `Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < ``PI 0e0 F pP8D H0X pH W:<00⃑ <0 E`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,KV#,0P R>0SK l5"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`@Ppv C808 =0 08g50 01 -L8M4\( p& < R R S @9WP  ( 0R'$KR Z@K2 |PU`@ PU PZ@K024 QZ@K2 K@bXL|Tt99.* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0A  -,@LP -00 -4@LP FJP - TL0S D ZVP  ,P q 3  00 qQ#Q cs0 0n0@S0000 0PU L aP q 3  0 00 0y OP q 2  0 00 0g =P q 2  0 00 0U +P q H2  0 00 0C< P q 2  0 00 01 P q 1  0 00 0 P q p1  0 0 0 0 p P =Q yPP@Um0#S+ #U) @0PS0 cP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(,P ,C p( 0-LP@P %P0 -LKM䡟0TK(0 p@P4K@P/0j VXW"( 0RV$Kx fl 0@mPP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"2 *@P +VP 0R 0GR -SKTPP L1R H1RO)K)G),`\X8<0 0-TLPA/H0P@ @A/kPP02@P* |H!!* --LM0 0 -H0@L`P8 4啈T   嘈be|@O\\*;;* @-LP78mmmmlllmmmmmmmlmmmlllmmmmmml mhmlR0 0" ؾ lҾ X̾ 2 00,   L||ds* --LM00  K p-L@P1X0` PPT  4吽4 0'b ph|@Ok p-0LM@P0 ) 0S& =S$ 0 S =S00SRPd`K P X0 ! 0S0 P x1 00xA -LM0@=SS00S $  0=SS00SP$Pd$`K P! q$0 A$  ~P $0 1 0S0 pP B10 0p R`  0S0a`LPP  0(pS PP@0 0 A -0L M`Pp,0 P" 0S =S 0 S =S00SR@fP, K PH ,0U00PK00  00 0(K P 00 1 0S0 PP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P -PP < 0S  0P P4 ,  A -L@$y@P0 @s$ -pLPf@Tx` $*P00 @ƥT R<T",PT0 H$( 0-`L! 0T<P>0!@PP@T 000P00( * *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/\0` TT3T  8崻8 $0 K`  "b|@Ok -LM0  K ?0-Pp1@ LR` 0S .P P@ |0S@D0Sޢ00Z0 7`\LP ?0-Pp1@ LR` 0S TP P@ D0S@D0SW00Z0 tp`P]]*Q  ;8??*IϠ$*E-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10S`yy$z4yyT0SQ R<84@Z,<$!$$, T*0SLP -LMKnP@0 ! -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K K,K  K K K K~ KzQX0K1   @0PC⅀K  bPPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  1PPp 00.L0l XKK, 㙛PHK &K "K K K K K K  K Y=P@@!T 1S *7T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp-0SX0S 2p !RK  v X K!  ?0KK1 厑PXK L00L0 60[X KS060KI0@K0 1 K0 0  K K,K  K K{ Kw Ks KoI-~F-0 A 0{A-0  0u [XlzPDO 0tt p-L0M`0@0 P HK@00@0 H KQ Q Q -00 0R Kp0 $>[Xt,t,t,: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00 -LM Q00    K  Kdd*KK**oo* *zz*R0S 0S0S0  R00ZZ*GϠ*''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-0P P000P R* -`LP p0W 1@PPP@żU00Q R @1@S  R᭼00 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0{ U@R s00P=  t!, Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU /0 0 ,\P% 0S4 U, 0p 0  R=*@0p@P  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z* @mٻ ix*0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:!*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@)P 0PZ~P)P0SNK@D@DD+ヶ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 Z4* @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ W^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP|  :)P0/00NKXL -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I0*K, 0b5 8 (K*K 08 <R 0 XX5R P50PP!U00S !U[ @DP 0%< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SPğ0i@T 8Q:0 RR0SF @T 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0y :KK0 4 0Q"0a1 0 0P[Up`^0:S  0  nK`F0F[*KV8`@*0S /S  *K/S 0 R@ 0S00 R P* ̝P*K0 PUP" U R^ 0*K S C  0R0S0 U L1 (KP\/PK0P ]U@Mb< S *K, 0pb@P@ W(Q@00 \  0 0 0P@P  00**?[-]:V -LM0@{SB {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0 wP  000{\ }\V`F` -ML M@,K`pPMS P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N @9R8#HA@L.0K^: X0 Q  R00   G\@ro80 R00CS000}~~pRR*R0S0  RR B0 0Q0 0Q*__*V|*A*//*aa*P0 -$0L! 0-$@LPdPa$_P\0hY p-LM$`0PK@.0.qpP pP 84,00SKp,0 -L8M$@ 0PR 0`00\pK@` 0` 0DKp 2P 0 \0 2X00S$K,K,0D0 \` X0 2P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0PQ>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr,  0@,  0},0 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ᒍP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` VuuP -L,Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ߋP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` VuuP -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppm@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4з0 8˷, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(KP -LMp S, WQU Q0 Q Q Q Q  \A0A >Q>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr,  0_@,  0W,0 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VΪDP˪<ɪ" ẵ urD L0SPX嵪 H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ۴ ` \0  H 0XXpWԩDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeEP`0DGP`X M<卩 <D L0SaP_X@O`0D+PpX # XoDm<kXgDe@0`0 R T`0 CR` X0 X0(np0R RXnpH`0 CR` X0 X0p0R RXnU*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0P -pa`LP @s`P` 0`jP0i~V1P Uj!0\1 X -LMßß8 < 4 =@0 `2P j @Ty Pp0 ,P P2@pT&  ~PpP2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0g`H -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4影Pn 048 0mpPF 3#0 40P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4%P 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP dH`H@hTl -LM@@ZK -LM@@OK -LM 0D K*7*7tt* *$$*6*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwP%P 0Q @Q PX P @TP k@ - L0 0P|hH -pL P@ 8`P0SX P @TP k@ - L0 0PhH 0-PLP k00@@@ @@0hH -LM0PS ,K,i@P ,Q 0#S S 0i@P $K0 S RA,  #wP0d,0 ,`P , ,0pp'P @p0 S S0 S S '`P 00(K 1(0S ?R0SP("(04"48@#80 @PB `8l'P7 @00T2 P.@]'P( 00@T# P P P@ 0@!0SᩨP 000  b `lliP0^q0 0n ,P@. @_  -L70PhH 0-0LS@P 5% 00 00h 00 00hH 0-LM@KPUdPPPQ R 0S0S g:d@@84dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @Q0 K 0KቩP   0 K|1 1 8 喕p@ 1PP 0RKP 01 00O@ 00@XB$ --LM00  K 0-@0@LP 00jhT    0hlh|@O -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0p00D S t, (!000& W070 cV \Q00R00S!! "00@0T  Ѫ p㽪 `,0\00S00aS \0E(K@ , 0XSxS@P `rP0P04@0|@ -LM0  @H p-LM@K`P90 x0 --LM0 0 K -LM@KPTK 0-L@Pp Pp T U 0㚾0X p@   T0lE @b2b 90*{{*0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL 0h -LDMP pħP d`Pd p 0S, R00U@ @@0K LP` 00 X T P \@ [`K7[P0S Wޡܡ0d0 *0  W@P04,"40ˡdɡd@ P0P H0S00A0@!1HuZP! d(K &\P P00  0@Up 00100@ 00*00d@ 00#00p 000@08p 000d 0T@$I< -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF lPN l0SO `Pd RA 0A尡L0LPK0<0 8 B XpKP ZP$P (KX0Y$Y$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0_Z$ P$0S0$0Ig -RLp`PU Qp@`P`. 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2K}@K 0K` r4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  0p@ P06 p$0( 2[   000S 0p($0 00 0$0( pMb@@2* R-$L  00 P-L @T p-@LTP 0@T@80Sܟ$0``PPҟПΟvP (Pi@;e@p -$0L@@LP`ph0P@  @0(`004$0H000D0H ᯨ 0- L<R@ P㏟00.?0 00庣PPP P} P -LpM$0@0PKDP  +0P0  P# P 0  P00K P 00p © 0 p`P 0`pH00.S, 040I0S H040. S  80S  80S,0Q00P0 00 p-LpM$P@PR`"KTPP T@ @Kp0 0R P00, 0RMPa `PP -0LS@P`#V0 P 0U`   L0\01000(pPpP㫞pp -L0M X P `|P X0SZ $ 0S X 0R  T <0 8 @ P 0iP30$D @0 P0$00 S/RL 0/  0 P 08yZH , b , phL H 4 _0PP3 $0 0.S  @P W8  00X$0D0Sv < R 03D  03 P 00,0 S00L ,@ @H0L@ 0H0 +0PP h40S  R H0Q00c 00 R,  Q00c 000S0 80HS$0 0H RS000C00 0 00@0S X H0SR H0S 0H SR,(KP0 4 00 R< X @@R  0@0 D0 0T 80 N  8 ><0SI 8 R P PA$0H00c ;< R{0@8PS B< tp P R $0 00  40 4 08 ph 00X$0J፝, P0 #$0 :, $0" ?00$00H00 03> 0S 040. S  @P P,i P0 #$0 :, $0 Pp0( 0 0HyT ,P 303 D $@ @ < $D T P 80S$$0BP> P 03$0 :, $0=,(Ko: P 00T R0,0 - PP0 P0P X0SP 03 P 0, 0,0 P0 #ꠜ -`Q00 V@@TLP 00p @$0 C T T P V$0@:$080S0 /R $0` P ݺpP P!L 0-0LSP@ Ꭷ0T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR t80Se 4S S 0$  0R/S@/00(  Hx`$0  `# 0B8S P$0 iP 303Q $@O 0 0RK 3P 103P80s 0$ `8QC$0 0`S003P$0@eP( H$  ;x/m=P XW @P ,x(P00 00 `\P  % :$00P| `e34 $0 )PX = FP6 04N 0P T 3 03 P 0  Q nI0S  0xP} $0P:$0Pt $0 ᨹP 303$0`:$0s `` @ @$0P:$0 0 #0 0 #0L -0LM@p` 00 00(K(PP0P  0P `00$@0 0$0 P aPW hPO 080@T . AT%  P5 R@PH 2 080 $  P03VY`, @, ,@ ATVX# ,P  03$0 X ߚ 00 ך՚Ӛ 0 *   P$00$0@hL -PL0@S0( 00Cp0嬚 媚0Sᥚh,,`0S }p -LpMpK`P 0: S % 0P0$KP@-P PlL0@0"P  0 ( `(0@`( 0 `0`0@,``$` , pQP 0-LPp"  00R00S 0㟻p  @P  0@ 000q@0 0-LCp@P  PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*@`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0  T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P`11* M0-LM0 0 0@ PYK0 p-LM`PQ @Q ]P0fCKp000C S0 Z -L(Mğ PK<KP0 L@ Pe/h`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 4 .K0 1K, 4K(| 7K$ hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K)P@F@0PqU``0D p 8ޑdQ0@ < *@K0pH @ 5T P(1<00a(K00F<.K PpHpF { @@xA@F`< ypD080#80;@ \dhH~D<lptx|P0 WEV 0 @-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P! 0\ @ >.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@dBP`d 0@:SS   P0PfdⱙP `d P@f ᤙP` D`V b -Lp= E@P@dP`dP 0:SSo ^S \S0@ PUPfduPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD'''('''''''''''''''''''''''''''''''('''''''''''''''00U@f  P`VD`0T0 00} 00z 00w:00t00q 00n00kᯔ -8@LP [000 0LTHP 0-@PLpPP㎔d0@@0}LP00740P (0@ @劝00D@H -MLM@d  ^, ` h8 l p( @0S`WP lmPm  P 0pS LH T hL(Q\(  h T80T8 X 傎KHH`YP 0 S 0Z@PY+h8YP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0p៞P@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@ۗP H0g gg0 0H( `pPH @ eo40(o ዓHDH ;PgᷗP: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL JT(R@@WAX\K@ 00BNK@D@D"j P)*2 R% h 0ExP l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L WPh TT X hgYhV@h`Y@ 00TT a ⓘ0P  p000\H H8 X Ph H/X\!ƒ@ZÒ@WWX(R2 ṒZ@ 00JPp@Wn ᫒kᨒ@DQ? `P0`?SP``L0@p go艑@pb@ ᄑ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K %X 0-PL@U 1  !1P\ 0h耒0<<3*(-*=)*=G$*G 0Q0   -RLMPpkܑ0SaW0 P @0P ׇ0000 R r0 11@```CNX@' ,K0 KXW@,p. Z, ,0WKX@0@p0  g00 p0S&X(K,0W`'0C0 0 00S >P` Z@假?R0S` p$`p@E-  S 0S@nhh*$%%}* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SM`K pP 0S xD x( @00 p| p-LM, 0( rSwS@T 0@0Kp 㦌 0S $K0P2 RRpPB P#1@T 0O@T 1 R , 0rSU ?$P[(0!㺢d1 R6, 0rS8 , -N@$%0(a@ P0S00  0 R$ @㔆u Pq  000Q0 g d a $M@  @$T $bip|8| -0L A -BML Mß0P,0 T$  0S 00ß, 0R(K/ҐPP0P4 L 04  T$L00C=STdaaaaa8caaaacaaaaaaTdTdaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaTdTd R  1!S  b-1A L401!0T$%BNK@D@DP  ᷐p0 SP&1KH4 1D A  @d < 84 4 BXK`P 0SDa BNK@D@DPQ ; 00UBNK@D@D }(0K@/04L  t(K 04BP"0S<8w0@P@j00 c-!!R0$ 0  πBKA@@DAPT L 4H" 00X|8L|0 A -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0! 00X --LM@0 S       0S0! b-1! 00   0S0   0S000 * 0RK!g 00X -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0  0RK0h! 00XA0l --LM0  0 ~ K 0-LM@P?PK0 AP ?P  ?P $@ 0@Pg -LRp` @PU  PP@ -L@pPu?P `V0S p ṋVU Vp @0pP00@V00S P0S00@T TpV ᕉPP  L 0Rp(@` `      P0D p-LMP` P P |P0l ֍`0 0 Kp@"4P0( @Í@$I -Lh@ -L  hNHk@ 0-LM0@ K Q0!唍p@\ Pڔ!劍|K0@\` 0S-$n$n$n@n@n$nmn$nm$n$n$n$n$n$n$n$n0!hpP,؍P'"0 WpP0  Jp0 P0 R@` p01S ` 6pT0< -pT {a@@ -Lrh@ p-LM Pˍ|` 0 S 0K,0 ( $ 0 R r 1S0C1,KQ0@SKpp -LIM0 P$0  0SQKO_K`FNK@D "@ᐍ gl0! %$ 0R  KD! ~,0 MoKK_KQK@ <1 8! hX-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$ᏅP $(0lH0 (0, P$8`ᩅP, 6<PᡅP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoN @08No 0{No @ 0- @LP 0 p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00 -(0LSP< 0S2VO0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0fq 00`p0p -LQڪ W00 p - L@<0 R0`000000p 0-HPL0@S0`0000`00 R 0hp -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0NPK0@p 0P @0P ~0000 0@8 0@0S E0S0 0(KtN0  P` 0S  0bO`p0K0@0 @ @008CJKⒽP0: S0P ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P }0@0@Y 00Ÿ0Sd + j00/`VpP <0 O`Vpr XKP&`K K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04# S@ 0` c00 P @0P }000 0D0 R lNq0S  Pa_ 00   a0@ P0 Bq_ 0@p`pq ADP T0 d00 S0 0tMp0/`P  0S SL E* -2MLM|$@0TP,0  <S   0/Sk @P B.K B B, + Wx X030#` V0#ScVH < VD / {P< PP#@aTQ~KpGpG (K0YC`d   Y,@B0 /S ,3X5/00,8[S XP SPP0XP /,0VbPX A0/S/0C0@0@0S_`, 0 R{(K%?00,R,  {|0<  +#rPKAA 2PPh<: S Qk®KJJ  ;pP( K`\F,<[/SD XP /P0aY 00pXL, 0-@P00QPLTP  p 0z@00 ㆁP @P{@*||* --LM0 0 j K 0-L M0KK 0PSꔌ`x@ AK09"000@@@ 0$0%K -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K W4 K `ㆎV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K 4 K , - W# 8 V0& ,@^00S0040 ` `Pp Xw"00P`q Vm"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 CP -L@)T`p@P  @00#:k0cS:UV@ 0p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SXh p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P Ē Z@PD@ @P D:H A xo@PᲒ 0mD @ YQP` 0j@T 9 DK]oD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8(d(\(`(X(|"00 4 s&Pƒ~P` ẃ (tP᳃x8L d8 0%P` d \ X  X \ ` (Pd `0  ! ⭁DK, K00K)P8 W*P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \a*P\ c 8)PP_ 8d(8P T8Y)P8 T XdJ*Pd L VdI)Pd D W\A)P\ < d8(PX 6 0 0\'PK X\;% 1@P7'PKYe u` l h @5 Z 0Q0jZ0S lKx%x5'P lK詏P l h Y l0K`pk6pjDKt 0Dn 0DKlD @ P@`\050Zp 8'd'\'X' 4&nl h Ylph@@PQ"P`p 4l`p@D0SH@ 46SE 3&PA44 ml h l`A0`p | ]I0@%Sf,hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh,hhhhS@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` m@PVD@ @P @05&C@ ! DKtmD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#P 40 (R D @ 4@KL#P 40C44 #P40\!04 @ D0 Qt80K4K< K2!0S@t 4  S S 8 RL`K L`K#8&0DK<  PP\ ~\cʄ0 DK mD @ N?AD|h2`|?5?558P9?࿔5&HDK@PD`K@ ` p  0l 0DK\kD @ @h0 0S56@0 0pW @0 0D0 lKye-f 0lK/kY@PD0S46S !(1p%Pu8\&dZ&\X&`V&XT&h!h1^%P|!p1D$P\l`hp0A;h@d 1 DKkD @ DBZ T30j0T0 DPK`2 @ hlP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0jD @ 8%d%\%`%X%Q #0 0 K DKlD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX&0PX0 \A%P@ ڌ`V L40kS7S8%d%\%`%X}%Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKkP e kD @ D0y jP0s$|DKL #jD @ DKD@K0} 0i @P0D@ @P P2 XL K6#PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS <\ȧ\<000 0100]"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 q4 K , P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL wpP- @ |0 @p000CC000 R0@ <08 000B 0C B0S [CP, 0S0%0 0R0 R*0\SL xP 00π0;0B #A03@ #0000htMp -`R00 F"R00LMS,  Q00 ",P0 @t 0-T@ +T@ v 3V00S=R 0T ``Z[ ~zzXfphp 00D S t> ? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kox@, x I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1 c, ( 0 #2>;8#8`t.t>bp.p>`@ P|[\.\> b 0`@PZ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ ?`0`p@0 T P< HKP aH D  @H K "`X T |^ XK4< CP00Q00S ROXK; na0X T 0L0 8 4 ZX K _a; _40@S UA ;XK_ 0`pP 1 P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@S<<\P( x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAJ Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S `4P` [ hyPPW h7hP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! rP `` pd ` ` L <hP Q U00S 0S X^00S \W UbL 0`R h  pPh d`\u d  ePd `  ^P` LL \hdhH`\A@P 00`S P Q  0 cc p 9Y0 _P00C0 x\ 4@5 (Q^ 0*^@ < XKiX@Y 0XK^0@ pP`@@K 0PP< 0 ^ 0@KDPv4Q i^@ K M4 P 0jW_ @K 04~_ $4@ < w_`P-X@X 0]0@@@ K `P*P 08 ,P0@ pP0 V_@P 0]X`X 0I_ 0]000 0@PP 3 P\P  0]@P  0P  0P 8  w9R W8008  000800 hPh 40 820^  XKW`_X 0XKa] 0@P~PP 400 p\00W 1^P@W`?X 0A] 0P@^4P00 000 <1KB] 0|P K &] 0_P0w0S 8p t408`0 \0 @nT/X T   H` 0cS0Ct @4S2+  P` S d '?aCoc?`(?yPD??$@@@?D0  c^Db 0@P0 pH0 p S^@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \P0w9S{ W p100  h\vPh  yPh UvN  \010I 0`l^,0CN@6@cSP` t @t E0SS\ MP\ \h\;Pʔ}P\ W\|P\ xzhtPh mr`lP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h5Ph U \P `:V `>9V X1``8`3 -LTp3 -LTp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 nPPH , 0 ITPPAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ U P-L@ @ 0S@iP@ 0-L@PP 0S0   0S0U 0! !"o3P񟗀       $$$$$$$$$$$$<<<<<<<<<<<<Tdt41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 ,@hhX 0-@LP8"pP(000pP00008QRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P-L Q T00 Q 0S0S QbP0s3 -0LS \0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S 0T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP @h -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:Nl 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp l 0<K <0 'i0 dK0 HKD0 @0 H0 峆~X p-0LM@Pt`U@ T%$K 0K$ @ PPmp 0 S 00 0P0PKp\ -@L0 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK  mph K@KpK] 喙p@p@ p  Ӟ0saX P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(KD 0KN@N0,$P Vl 4HPP,Qk`p H<VF``p  @ R@ 0#5lVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<5V 0FP `aC0S: P 0 (P`pm 0j , pPdP >2lPPKn@1AlA 8 4< <\ 0L NH^6 D 0!kPD@`P  0@,d0a0cK8< 00< @<AA 4 << O0!kVF``pY 0 S0GQ D<|k07S^KPEpPE p 00@ ~^KPEpPE<< 8L :P 0'@P07S v8X@h H@$ P|X 0-LM@00 P>P8 -@L w -L@TP`pJ 0 T0#03/70! >\W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@d 0-LMP40@ L0 @K0l -LM`p@P0PP@0  pt@TPPKl p-L@ P  BO`  0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ Su W@PP@ LP 9H A R@PAu 0PP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKQ@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PKQP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! cD0% P  D  ! c8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 IP @P2XKN 1`p P 0P[ 0@N 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S N?V瞯<A?Dh2`l0S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pcy^P` c "TPc20S60P40 Y RD0SR@ 0 SJ @DTʳ 2NW @@"2@ P G SH@P  0SMX T ^ ^ ^ 3P 0 00c 0 6H@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @N`FVP L L0# "*/B B V L pP@K0D4 ` N@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 Z"00D@@KP @0C@ |P@0@ 0 40 D0 4 9"00@`-A0=@P9U}R@d 6 PKxLP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @M`FVP L L0t' "*/B B V L pP@K07 p` M@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKL\e LP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL J 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L00h 0-@PL0 C@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- [P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`^YPPPF ^ 7OP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0N"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. 8I0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0G$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 t|x0-@P 00? b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 008I0S  0 S  -4@L,    h8I$< -L>` -L>` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! Y  0"1008#8S"("$"""!   88S00000P 00-0 S 100 0C\AP: Rࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hO4(10 AR 0hp -pL0PS U AT01 0S0 00 U e10SUP@ @T}0eD!<0 0c1S10@0`p, -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! W0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S @T 0S PP@ 00p0S |PU 0S \LgPP 00, 10 eP,pqL -tpLp"n0S \hnTPT@]n`00@XPC/00WUEO00tM0d@E 2-C PbL SPp 0@`U0p(@J0e1P<X WV00P100C/W`VX@Z4 -LZL 0cP R@P $m 0@@hm -0L R5 m SZ RX@J0S m00 D0 HC/aWQ<m @P $~m$ 0@@@NtM 0-H+LdM0@0 PVPOQQ0POOPP4RPPPP PPlQOOOOOOOOQPPOpPOOPOOOOOOOOOOOOOOOPO(PQOOOOOQQOOOOOOQOPOOOOOQOPOOPtQQOOOOOOO POOOOOOOOOOP(PPOQQQ|QOOOOOOOOOOOOOOOOOQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQP0S0h0h0 0-LMP@)P8P 0S 0*8  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 N 00 00 0-0@SLP*00b0 N 00 00 -LM0@S0C0K< 4("4 <0!  N 00 0 0-LM0@SP0C0  KN <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< e@P! M?Kf@P8!ҽ@ѳTK?KS N/K⠃Pij8!彽@, 0R(K081 4A 0p 0ePꣳ@.00<K_K<N/K81 pp 8!+A[`OX 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0@ -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U _M fB00 U 00  HPP  0@ -L@P`pP @T PU * iU 0SW $B00T WGPp 0@ ; -L M⠠P@8K0`px ( 0+LP00P0#S  O=( 0R$K聰00X -L`MH\,  0 \ h/00 ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ppw YpZKZK`,K 0S WR `V00P0#S w WV. @T*:0V0) |KPdd0IQ00 h  qG00P,T !R\  B\ yh0@@dI> ?DB> -0LMp,`K,0K@PT HPe 0!00P XZ@`PTZ .T00X0S Z  ,K G -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' D@ >D D@ @T|t(ax -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0>P  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0~>P (0U$Q0$1}00,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 *>P8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 >pPU 0`㲀 XP<0LS8 @ D0fPq8 00014 00 `Pv9(Kp!  P9 ,  0=pP8@00004 gP<Q#D8000(K  D0_ P 8 @0008 000,p8  ^ P8 0008 000 L P @ D0P 8000 0SD00 00b0 -RL@1  0hi00,1c00,1 0-LS00\00SP@ 1 \ 00hE00,10?00,1 -SL0@ h-00,1Q  0R갵ȵеص 0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`8@$KXUPp -LM0 0`SV  0S 0 0P60,0 K U& , R  Z p1p!@P00W0S W ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ p:  ' U@1 p190 0g @p0 0 00gS0 PdU PPz  0 00PUb UR:,pPG@@Up0@p` 0@T:4P3  00b0 @p@0 K90 @0g Z0 e6P, _  P0h0,0 : .9000PH 0 @00l 90 0e p@0  9000Pt p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@Sp p p-@PL ``0S0 P0SpIP 00php -PLp`PS J0SX@`PUZX 0-1L @R P Q. 0 0 0c0 0000  0 P @0P W/0 P$000 08#8("(00B< S 0 tM p-LpM0@8CP`Z0+0 KpKtnP0@: S  Q;  0  SL ( 0R   p-LM0@C 00   KpK K`4PP h 0 SPP P 0000C0  0lPP@E -L MpP`0S9쀟@T@0S 9P 0S$K$Km9 0@P0ep h0 F00!0C 0@000 p 90S 9pxM -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4Km78 0,9P Z 4@ 8 t9Z4@S00P @8)xT 00xM -L MXP`@@0!0SG$q@T 0 0S6 0@P0ep0 FR    0000@10 0A " !B 9P@ < 0S9(K 9P @9pxM 0-LMTP@T K0 L K 0K  @@6p(l -L@Op 0PT:0q0:0 p-0L @`P 0 N0: 0phFN 0-LP=P/P00@P0T@00:00 -L0M4@0@K0  0RKIX Gt,@R 0S  R@ -L` 2pP @H1B@A01 7 P d7 020 0 0 崜8q -LBMcP< , @$ D4 y8 *5iPx BNK@D@D0"=7 Pa*BnK`FBK `FA0A 04 $3 p ѯ Ci 3yj  02R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PZ@$00@_S c4R SQQC 0<8$PHp. 8\ GO00B?00, 0R:(K5P@4<`%0BTD @ F@d : :<0@JBKNN``0( K` 0T 0@@DXX E -LMp`xQ@ 00 0 0C0``(KSL RK 004 0 64 P 00000 @0000 0 0C0` 004 0Sʆu P80 D0 P0D08#a`V F! D10DDAuD `P{P 1 JȘ00 -P0`@P@`H$HXpL %XJ0@@bH$HBPX%X 0b0C@0P0@ -LM`8 < @0 尀X! 0PSGpᶐYUYS<@ 04 00Q0 V*0 S80f5P7 `尀X0S7 8l@P+ 0S <@0 0 0  Ro< @08XP000808  8 8(Ko p0 S80.5P(KX pp<@0 00S<@ _+@0F@bH $H, @<0@0@cH$H@@ 00,40᷐@< 0 b c004 B  00@00088 8(81840PӞʬ <@  -LlM@ 0  P4P\ (K 04Ph \0` 00h8 #8  x0 R0Pl0 tP Xl 0@Sp pxPp| t #81@x@  |P| R @p8ڰ0SN0 00c ,0 x0K 0e8 K P8 0080 0 c4 t08#8t0 P08#8 ax0 0x 0c |0 lP txP a("( l0E0a0  P\000h0   o\h `t0 p0 \0B8h p#X d @` U*00C8Sr^  08#R0SP%0S <0 D 00SH Ps 0@KH Kp800008 #XR0 S@ b< 00H0 0 cD 尐$\0S <0 D 00SP 9 `@KH K000@KH K@KH KdP XK d0 :PT\  XX Pd d RL P@ 0 8d`p#` o\ 000h0   pP0e0CxP8#8 E `0 0d 0P0d3Pd ` 0d8#8Px0 @ `.  08# d0P`0 pP 7 P#`Q  -LM8 `p@4 \OR4 F 0, 08 DF#8, 0lR8 #X0 0$ 000 儐  bT, 0S0000T 4(1S4 0C(1000 D 0, 0004800C808   (K(Ko -PLp` Q@0@^  Q Q \2PPP0S -LM@`Q 0  P n, 0 00S02P&p(KpP&,P Z 0(10S$1 0 !$1, 8#R0 0  0 pPvp0000S 0_2P  0P$1 0$1 -L  @RPp  R 0 0 0S092@P RW 0` R. 0 S00a0 0S $10 (!$1  0 0S 0 2P  0(1 P$10$1  0S0 ᰀ `1P0f8 (#"  02p 0 S 100 0 0S01P  0`8#@ Ҕ00 -L M@`AQ 0  np, P 0 00S01PP(KP&+P  0 <P   0PP, 8#R0 0 ꁔP00 0-LMP @p108 -LM<0 @ P80K0 K p@P 0(K0,  <K` fP40@ VX 000P`08#8@ P("(000 P0@0< @0P00Q<X000 < 1P0A 8#8 @`0 0 0@<P` -LM`@@0 < L ȠT, ,Ƞl 0 4@ 0Z@0Z` 8  T @PH$HPdX%X g0PC,  ,  d d 080P0`004 0P0C8#Ƞ8 40 S 08 @8#X@eH$H 0908#8 l@0 B 080 @ <00P000 Y 4P4 0p@,T 00BZ ) \ 0 08 Zp,#X" @ @eH$HZ08#8 ` B @0 00@000 00(K@ 0Z0E8#X00 <>, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p/`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0/W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-,P  00P  -LpM@.?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>*00TZ! Z Z KDWP$X@000@0(K RP 0S @ H-Ap@0S 0S@@@T -L @P  - L@p0 S0 R0S 4Q R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mE-@`p "2n10!0Tp 0S' S1 S  W43Cc" a*B-B ;\*-3n20!0Tpp0S0$#Bb20a  LZP3!2CP43C" cb PPT1 !/ b21C\c(1@D$"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\2l 1C 01 SS Q 43Cc" a Q*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -LMR@0 < 1=0 \J02X 1\&0080 4 H&@v0Ca P,p ,&0CqU0K0p P,p0`0g#A@@!F@@dPGP`pPe,` U0%Ϡ2l10!0W03l20!0W00H1U43Cc"` 54ĠL l ?Bc  a$<#B0b8 0l0b"0 a`SQZjmVH4VjF4mFVX(,PK,pP4Ϡ2l10!@ 3l#20W0W1 Z/P 0@0 @(K,pd0#Ϡ2l10!0W03l20!0W001Xa^0@#Ϡ72l10!0W03l20!0W00,KAP 4 8 \20S80 040 1"0080 0L1lb P8U 4 \d2A  Q 0R=0040  0 0R 0 0RA4  R4 @ pPt@0,@PD{ND@D/0C!bb@ae0 B!a10b c@R 0D!0Ϡ0l $ "Bb 1a `34 1Cc@0, 2n10!0P3n20!0P @ 000S @c 1 S@ 0 0 < $ <-E.²ScQ?Q-$Ių R 10bSP001bSP00 -PLU`p@ G'0c0h=' 0R 0R 0R 0R 0R 0c -LM0`pK0`0S\@K \@K< PXPK< P (KTK PPLP%0౨%??0cc( K2"1C0c P0 tP\oPT\*0T0P@,0 05T“_2e10!00 3e#20 0\ \ 4!0\T ʴ<P P@,|4\ )`4T“2n10!P 3n#200P P #1 0cT0 PwTP@,3_.2e10!00 3e#20 ^0 ^  21CT0!0 R b ST P0 <P@TPD` ,0;R L0 v>" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQnh  -LM@P`pJ0S 0@-H01=0\J 10S1 0- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Zꑋ0 0nh  P0 0 Pp P0 0 Ip -?@P0SL?Q0SQ 1!0 0S d0 R0 R0 R, =0G'p3 -LM∪0@`x,0 a pP@ 0T00 XPP P:U /U .'P JXP, n, 0R(K:UP/U V' P*/\K(PEPE++'+&.&P@ @tXPg:p@ ()PZPUK\@ $(2Q P P\K\^2^*K\?SSTT1 !0C  K0\0, 0KH/0 g0 bR\=P*KH:K`KPH?\K:KPHK`\ KHd:KH? 7KPd  U*K d/T7Q L:K`?KSH*Kd/R 1^:KT00 S50*Kd?KTH/SK0*KT H?KHc KH0S0/%&Pd^&P Ti^:KH*KH/ 0$& ^:KH0 S5ڶKL KH.KH)*KL/KH0*KK SLH Kd*Kd/R3^-  0 KH?K^d  :K\?S0 KH0S0^^-  KH:K\d T@ KH0S0 K`A 0Rb\0S KH 0gcPKH00QXPM0 SN  K` K`P=3@PK`@T 3  P P 00*K`/R JBT3K- KP@X XPE@DJ*KX UP 10P 001K` @0 S 0*K`?Kd0 S/\K(PE PE @P0S 02S@@0 0 \0 0 @0R P;0*K`?10 Rd ^[ 0 S1K-0 Kd @*K`/KR" K`0!S:K*Khd/`?*K0`?1 KhK`:KdK`:Kd?^ͅA2@@^M@ PKdKd2 ^^K(L P @*Kd/00 Kd/XHqP`E+ -RLLM`@0<S p@ d0Sg(K@>0 >Sp@ d$(6p@ P1!@,  pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p Z o l g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0J0 >Sl@ dn\0@`00A\ 00A[tQ -L@ P  h4L -LpP`8 0S@ t8@ 0V X0(0T=H00(0(0000@P  `L/  - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @$ 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!NQ"Y`X -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pP!P_0@0XZ]PpZ0^=0 @!PpDo!P00Z$000X`+L -tL0Sd@0 0R  Ph,0pmP/ -@L&7h#7 0-8L}@PA (Q0S!P2 h!PP+P0S. \0   B,0hE PxP 0:S  `P 0,00h, PجL/ 0-4PL@6  @60h P0 0 p-8`LP@6 *@6p -@L6th6 0-LM KG0PK@@%A0@`TK0@@@ 40@`T0C@@D@ '0@`T0 -LM K@0` -L,M@<K K -,L@, 0E6P h  -,L@, 046P h|  -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2 PQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  ld -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Phl p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`hA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vpl;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000l -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0ĀH 0P0 0    0@ypV@@, 0R(Kv00 <vpW00 XE L    d   -0L@H $0(P H hPL Q *0S00S0 Q -LMTp,@KP` 0  "  0RKȤX  -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ | -LtM` \, Pp *: 0 0 plh*d: 0 p l 0 U 00\ %\z^`@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]`@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]<`````d]``bb@]@]@]b@]d]@]@] cc8cDc`cccc@]@]@]@]@]@]d4dPddd@]`4d@]de e`ee@]e@]ee8fPfxffff_, 0R(K 0So$@ T@d Ϡ0lP0 U  ^00U#3   0 P[  p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\ 8 -L M 0`^K~`r@P x10鎠:p@PJ XT0 00 Q 1p\ ,&("(30b,>0A!0 S00Q8MP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K 0P -LPM0d(0  @0P ,0 U U  UXh@K? #P$ K0DPCM0SJ @<0C>S񟗶qqqqqqqqqqqqqqqqqq pqrqrrqrqqrqpqqqqqqrqqqqr|rprqdrqqq pqXrqLr0rq$rqqrq r0$0t 0SPU$0SD3   P0 Pp 3P9P@    t *@< 00 2P9P0   R@0x0 0Z $%Z: U0 @0 ( 0R$K0000:(00 0000,00,0,00 S,01,, 1 "0$00 0~0 0{ @0( ,0 t00q00n00k00h0(0e0 00a00^0 0[0 0X0* 0( ,0P00M00J0PPUJ>PD |s00l0 R 0Sp 00 8`,弞X X 0 |Ml|pJ  ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0UKP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04 KPh 400a0ym40 9 04 XC0 00 0P -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a A P 80 004 0dL( -L`nVp P0S0 @0T  @00S0 h0 0CR0 }np <0< @80T 0S$hU p |00 -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P026pp{ !000v D   h ^A 5  v Z PA h0@P05pD p000p ,0RA$r= 800 0 - PL M8 P6(0:CZ*`>0N&@8 ppe 0 +PP6(Qx0PSb ( a R^*0S98:b0Qp 0S(K0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sb (0c f058#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sg Ze u`p# 1lp 00Qa  PxlP3( 000/di(  bQ< p4 p4 W:370#2000,0 < 0, <0 `00V00 u Q000, +0V 0a WI< !q114 4P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a(0 c:37 '8#8!1q14  kp 0044*p@ 0P0N4p@  0,00 P 000S0@00P@0,@0`a4*ZQ0``w<`R 84000( 0 -LM@8 `kDppTPPU4 @#0SG"0S2 䒟00S0 k@k4  (K$0 T,0 p(0:CVH*`>00`  Tn`\:WZ0TP0 0/pP$Bf(Ql0 "S- ,0SV (00 c b", p 0dPP `< FP<]phFPS|!U00d0,k 00D1 0R0C0U k4 @ 80P 0S  k 00 V!1PGPwo(  b jP 00a vP`( 000H< ,p 00 0J0(P -LP`jLq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 EPt8px p080bp0x040h0TpW'  3@P TUX0 0CR0T iH(K/ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@ho+a3*+I@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC10A -LM0 S=S  0S=S` K@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >0*NϠ80* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P  ~ 0xAV0KP -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |t0Px  p, lPg  $1S0C1, 0R00001p0q =W0 pU 80x03 >PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 0P QK -LbUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6dateztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnameЍгԳԊܳd@@04D @@\unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainز4$,4usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainز4$,4usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSDmainp@@t@h xp|p p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 l    Q :  #3# 323$3,#4@<@U@D@LT\dpx  @@ (08@HPX`hp|  \$,4<@D@P@X@d l x  @@  C$CC$C ,8@HPX`hpx  @@printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeledit|mpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor E@X  `  @h  p @@ |  @ (@  %- @E @ `Nh @ _E@@dE 04@<HT\dt|{,,@h@h@h@h@h@h@h(X @h@h@h @h@h,@h@h    $,            \s6㿂;{v&tDZI{ "UN{$8;d"@g߿9~^׺|qq^llW[Uw-kUyPy;N&o_&/w%gOa*Y]M$7eLH:YI{L_SNoer'm0 Zgjֵ5Ʌ`/O2yKerߝһx N)V[( )62Ga_*8j뭳% iA !Ro-6AL/60ΰyUFæ bZt]WZE$H XL&5+UoX*e~Ъfq% lWQu2b@1uЋo{Uw8tdٰ3pF< deۂZVgvVӽF?>0O~":7 +}BdFp'_X,2=Kdxsg? 1uUߨڠ&xc&{%Ǔ &X.q?ʵA]E ӽ7BK1ۥɖ`[270벺-yo doz4 8$3٩eB-tUQb{VTpeFӹ5͒D'fI(g1 &&M ^6_VV71\U+2ֲ2pz=f'&6Bz_t a*}lA(J#\Pުk_g QR傅o?o \c ZچOܻoYUII[LiM6 cfMaizbj&߬&z܇ĸ=b&K_syPI@M'@!#VDzGC]Gռֺ7#Z1#VP"1>h¶j>$@h WӉal0.|+662FI}ByPyN'38D:: rT EI܅Z=o}Gg#k8SYjOQͬ~SȀ>tKH(4.|d>Vnt,v";*+4f9kHߺպA禶MzvRb>@VAb{oCal0yfj-9+Ъ'%*ǍvrY q6!p,Z)l";.A+Urِו:b@%cpW]& ZeKĊBaq0ezRp`V# Yv~%lZTBg骵oϑ.&Bx!bFz X8 #  O4=ˆݛ5m0 &Fs;JJe9А eI++m>l $c#DE`ـV]|EEI՚հ0nY I I><ɼjk8=L-܀Zs37]ER6h yA+[p'`5jIj9;e*Oٗ ]G?X&glݘb5sWEsqT8`'L7*'teՋx.?R (Xb ~ LrTy,`C@ &{dC]oui jёf* V-}|`c,չj*´.'p8&-iGղny%@Sk|wV&@.c2`W[=Fޚ]v[b0ΧblXgbx5V4Qp,HpU|C`wgRjZ=99{(k8QIIŨ\]]EFgf$bh+姺vl^>iEP[\`ZպRq]%]Dag}Kؽc]kF`jQmlVP"OZ #c +LzsUP` w}aWMvەm;Zy@K\ '7 +.ܹ2NssޫEr8&"!%EIq42 Ӻ USZ'y#d0 1y,ܙa+4?.@Ņyr_14g]X7*84ξk2g(W1Ȓʷ8PɭFW( ήa}])L#~ P.Ӵ^/rdAz.va˃))a~+$N^RR$#2,kpB~2~\\S}Jb4 ]يR8 JQ`2RnYI|*Bb @b< Q}}kXy\Ey=LpqK Gm'@A]Yq !  x1rZ Y bR# Vjhr+QYr<bu?,#g;2o~8300Jbl’%oAC\.qsrN%$dbpu3t^-O/vf dhx*hĈU/LC{=!/ʪܧv(as J0H!o[~4 HYP5 HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!OɧHY0.$%=:X˜\CȤ`3cF잧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R7LJoBy sVLDAL. B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvҗ_lt8l}pI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=vޯ\ON2~(B."I]jviB ȤPj}~efkí]8Jȓsl l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !''Q3?S:S b* cL{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}z~AƔ]H?[ 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh1xMG>oy`E| o7n/r%b$`t(z'A:fX' JhQԏ;38ϓ3Ayp[86SEKf4eÒ$N`hcE|4SeR0ke>jŠ.$U˸ҏYH) ]^"N CU߂D&|C%a'x0qT+]pnhߩ@dX+9 F#%FtY]ܸj\/H\|FI)Yװu$(פ򎡟jސ`Y,}del!~8o|0{~6O_O ~5:kje7uD怉?_˅pاGC+D<>q0|֙p=rz|ZWIȿG_<ČIzt8W0(9SrrgχVς'~-3ݪmz&pyMțg#]-y ޚOa;)yxoԔDLe`9o#4vC_ P ВN6GGG՘[af3pc0,)*WB¸zW)vE|g;b0q؉[]@ck[k'FVr0!.?5cBkN>ZQ6)R?`hF~C);H5i(9AsAtT`{(1R´ؐu)}\ U$?d|IkjCfCn#}k:# \Wċml^>Qoe2'2in#}glK`g%^Z80N[KRI:}ir P6RV*cQ#ڰ@eNJVkiή+oXnK^B[|'L\ _]\~zi8w~0wFp9iB,N:6sMtI]8P4c3yC1F;JKF\xfS?2-: `<ݛij3U^ΉY;;!p^/2.=g'_ܧ+/(лLkf&uÿhwꆚUzyO=2IMӣ@#HRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %j is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup4@<HT\dt|{,,catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv X\dltԘ|ԘԘ tt((Ȍx̌xԌ܌H   (ЏH<`(t0آ8ȝD<LhT\htlčl̍ԍ܍  $,@4<DPD\ؓhؓppx(i i@S4Sti ixSXV  `#Ȏ#Ў#؎#܎$$$$%%%%&&('0'<(D(P)X)d*l*x++,,,---.ď.Џ/؏/0000 11 2(242<3H3T3\4h4t4|5566677ȐcАcܐdde؎e$,4<DLT\dhpt   ,8  @ H`P`\`hpx ȒؒGؒT$,4randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain$,Rusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d ?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainز4$,X4 @ @(4@usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R8{>:YW15?<Ȧ2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.Xinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmainز4$,44@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorؒGؒTnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %i/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:L  KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainز4$,4@4X usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5t(="0=@=8H=P=\=%Ud=t=='= ę5 =&<=0=#=P$===== = >! >> (B@h,B(8BDBHBDBXBDBlBDBBDBBDBBDBBDBBDBBpBBpBpC(CpCp,CdDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)%s from %sno memory for info stringpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %dUnexpected format code %ceof in string constantstring constant larger than internal buffernumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareignoreinitial-intervallink-timeoutmediumprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ RTM_DELETE write: %sshort RTM_DELETE write (%d) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %sadd_address: imsg_compose: %sadd_route: imsg_compose: %scleanup: imsg_compose: %scleanup: imsg_flush: %sdelete_address: imsg_compose: %s 08`Q<  Qǯ`[~ [~Q`@@<@TU Qs( bQssAQ?%ØQyƓ6ØQyƓ6` K5AQdl/Qdl/Qdl/a R n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScshh@hhhhhii@husage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup4@<HT\dt|{,, @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvX   \ 8 L X 4 ` Ȣ@ l ̢l Т8 ܢ8   H H 8Z@  c_umaskȤd6 ̤ ФE Ԥ& ܤ & D/ 8 `(  `( % (7 0# 8. @5 H/ PE X `(J h) p$  (-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$@4hlܮȦtܦfcds l4mDnTpx_modex_search_histkb_addx_bindx_emacs4g (z pH Ȋ  t  Ш̇  l |x hz $o  0 4m fy D Th 8 d p( | g  dv u w Щu v w n y o $4h 84z @~ L \| x h g x t ̪{ ht ܪԀ   Pt Xt `t 0z <Pn Ddbteste_isa4(H;++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_print(4doppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }ܶ(ضgmatchgetoptionsLaXdclxeiklXm̹Cľnعf0bu pPr|Tsh$v\,4@P`xdo_phys_pathshf_vfprintf (08< D   L T\HPQ`{t}hdhlptx  mrcwz]]<>!let||&&()str_val \E    ̵@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqmainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlenlogout/var/run/utmpimsg_readmsgbuf_writereadlabelfs@h@h@h@h@h@h@h(X @h@h@h @h@h,@h@h  /dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmphmac_sha1pkcs5_pbkdf2\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdefp| 4 (0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR|[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL(0<LXdlx ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks  %m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory p08DL`p|,8DTh0Hp08DL`p|,8DTh0HHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory Td4Tp4HdRPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaN^[Yy]^[Nn]yes646NONEUTF8 $,4<DLX`lx|SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG4H\p$4Hh| 0Dh0Hd|,Pt(<Pt4H\p$@Tl|Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedp08DL`p|,8DTh0Hvsnprintf !#&(*-/14@h@h@h@h@h@h@hL@h@hABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdefTl"P)"too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt $,4<DLX`l x|-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():arc4_stirsnprintf@h0l,|`x ̯ЯԯzܯL,wp-{$0,04u@HPX`ht|PH H[@P Ȱаdذddn> $Z    4 0h  |  H $ , 0p 8$ @8 Lunblock and -DNO_CONV?@$4<@hT@hl@h|@h@hC@h@hľľ̾̾ Ծ@hز@@h  @h@h1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:0`88@HL8P\phdTl0p8tP|/tmp/EdDk.aXXXXXXXXXX  $,4@<HT\dt|{,, A !$ !0 &'d UԯL$!$ !&'d UAnT!!! !&'d UAn !!!  &'d UЯ(Ľ(SP(S8dA(|THd@8?.? ɚ;^ ...БԑܑؑSDSdSTSShVVVP$.p.dA@gg|o~/>~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory  aPDhbP@4йBPcPDppdPAتeP̺fPȪ4FPP|gPhP <iP4`jPh7мJP!KP@LP`mPnP"ĽܽpPH5PP4qP|DprP"ܪ̾sP! $SP!ԪDTuP"dVP3wP"̪ĿxP(D2T`XPAlyPzP"Px1(~P!4X?P@1#P6xPAĪPP,H... (interrupt to abort) (press RETURN)@444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU|ԫ8P@hpd4H(@TlpD̫ī(00+DtLT` ]@l|$4ADB4HCDTEdFtGHUVabԊcefhiLlnqqrsv,w8xDux|     \xęl !"#$%8&('<(),*4+<,D-P.X/\0d1h2t3|4L5@67@h,X4d priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP E<(D(L ST@@h2( 0(EHC P E(  0(EHDHC *$WH$@h^ ... ...kkkl8U ز4$,4@4X@@@%s: can't read disk label; disk type must be specified......܊  $<{}abcdDgGhHilnNpPqrs tw xy !:#=LCPC Pܶ(ܶVܶDܶtdtķܷ ,t@DаHHP,X0|\`hl7p7x777 8H8lp88d889,o _ xx:xx:xx:xx:xx:xx0000000000000000 hT@hp@hx@h@h@h@hP@hll@h@hd@h@h@h@h,048<@;DHPT` d h  l p     d !"#$$0%@&L'X(l)*+,--..|//,0123456789 :;<$=0>D?T@d[x\\]^^__`{{|$}0}D~LGMT,hW8Ddp    J ,8\h@hhl7p7x777 8H8lp88d889 ,?@h8d|  $,4@<HT\dt|{,,8yrxy||pz*kh455RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~0hpxl d@\@T4h0p\ 0, d8J dLK @ d`L\XtT0THTXxT]]]]]a`d\d dcLc\ccbbb dcLc\ccbv`` AAЂ@.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppn,./Da%XX$9||R?ttIxxN|cW|c|$\c ccjcs]xTT . ..chownxdhclientx disklabelxdmesgxfdiskxfsckx fsck_ext2fsfsck_ffsxifconfigxinitxmknodxmountx mount_cd9660: mount_ext2fs: mount_ffsx mount_msdos mount_nfsxnewfsx newfs_msdospingxping6xreboothaltxroutexrtsolxumountsysctlbioctl]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio R diskmap vscsi0 ch0 fuse pppx hotplug ptm local wscons uall R rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 R tuner0 radio0 video0 video1 uk0 random lkm tty00 tty01 tty02 R tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty0a tty0b apm R crypto pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 33 $U 600 ;; systrace) M systrace c 50 0 644 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 R usb6 usb7 ;; ttyU[0-9a-zA-Z . ..MAKEDEVconsole tty memkmemdƬnulldƭzerodƮstdinƯstdoutưstderrƱksymsƲklogdƳbpf0dƴwd0adƵrwd0aƶwd0bdƷrwd0bƸwd0cdƹrwd0cƺwd0ddƻrwd0dƼwd0edƽrwd0eƾwd0fdƿrwd0fwd0gdrwd0gwd0hdrwd0hwd0idrwd0iwd0jdrwd0jwd0kdrwd0kwd0ldrwd0lwd0mdrwd0mwd0ndrwd0nwd0odrwd0owd0pdrwd0pwd1adrwd1awd1bdrwd1bwd1cdrwd1cwd1ddrwd1dwd1edrwd1ewd1fdrwd1fwd1gdrwd1gwd1hdrwd1hwd1idrwd1iwd1jdrwd1jwd1kdrwd1kwd1ldrwd1lwd1mdrwd1mwd1ndrwd1nwd1odrwd1owd1pdrwd1psd0adrsd0asd0bdrsd0bsd0cdrsd0csd0ddrsd0dsd0edrsd0esd0fdrsd0fsd0gdrsd0gsd0hdrsd0hsd0idrsd0isd0jdrsd0jsd0kd rsd0k sd0ld rsd0l sd0md rsd0msd0ndrsd0nsd0odrsd0osd0pdrsd0ptty00cua00rd0adrrd0ard0cdrrd0cwsmousewskbd st0rst0dnst0dnrst0 est0d!erst0"enst0#enrst0$ttyC0%wskbd0& apm'apmctl( bio)diskmap dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: / right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian 08`Q<  Qǯ`[~ [~Q`@@<@TU Qw``bQww?AQԧ*ǘQZYǘQZY`ސ>AQ:q,Q:q,Q:q,ao"AQ3Qb5Q۾6b]AQ3ŘQwŘQwcs$AQD14QD14QD14d)YAQ5Q5Q۾6eAQ88zQ"zQ"fN=/ƘQqd2ƘQe04ƘQe04h )ǘQbǘQ0ǘQ0gǘQ ǘQa ǘQlpxPH}AǘQ&{w ǘQa ǘQlPdǘQ&{w ǘQa ǘQljO":ǘQT ǘQ/bǘQ/bkEǘQͫ,ǘQͫ,ǘQͫ,/tmp/fstab.shadowǘQǘQǘQ/tmp/resolv.conf.shadowR$  ǘQZYǘQZYǘQZY/tmp/hostsh=AۘQcj$QQ`űAQa! Q< Q<aA Q@[_Q&$_Q&$bvcA_Q.(aQTߡaQTߡc'͆)AaQ%kzQ3ҡzQ3ҡdjmץAzQ"Q!Q!e&e_S V_'DpgSnr]26_M w,;&|$ԗ\r>$&4!6.DhbVUJsDv|ړ. {1EQ#7_F@_©r- +Nynӝ]CT 5s<Q9-ťŴY5<5$%;-n~^=q]!v Sȧbء 1Lbl4jPIk/p,*-XSzKbzrB&//0E*vT\%;[)XWMٜQo{tCӎTZkة#d1}i v01ŋUJI8CQ+1Jwgroup> protocols-d;passwdtmpspwd.db servicesP-asswd.origpwd.db fstabx resolv.conf( hostsx ... . .. binmdecKCsbinKDshare . .. ftpgrepxfgrepxegrepxgzipxgunzipgzcatxlessxmorex\sed ... .D.. . .. bsd base54.tgz comp54.tgz etc54.tgz- man54.tgz- game54.tgzip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs $user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up he root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$userpass") uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/ . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -ne '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -ne 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp -Vmo - "$_src/$_f" | $shacmd | tar zxphf - -C /mnt ;; *) ftp -Vmo - "$_src/$_f" | $shacmd > "/mnt/$_f" ;; esac if (($? != 0)); then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && ftp -Vmo /mnt/tmp/xetc$VERSION.tgz \ "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "After rebooting, run sysmerge(8) to update your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi [[ "$MODE" == upgrade ]] && run_sysmerge update_firmware cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') ((COLUMNS == 0)) && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "Tf1607bd2cae9354f07ae6c624f0d88716e4d66d56ac51e1b8d15c0c6a7196e8a 720999982cd9411e37277b0ceb970977a170d5126e91875fa73e7467c2ab432a a6f0e3743fa2a81c46ef5abfe0cc07a2fc5bb5dac4640b53f2885e7853bd8782 58befdbcd13d8e88d247819ae3ddd5f4b7b12a1ca53b1e5344c02b52236c60cb 591ad76e94adb4fe2ccb772a0d8569690dae6e6d0077e08a748998f53f009902 4435503e764c9826190423723fe01711b7cd0667c3b4554a3e9f091fc6da86af #"<)" )"p;thh: #h:ܐ$h:%h:8"h:`8"h:48"i:di:7" i:1"|;8"i:7"i:$9":09"Pp:9"(:8"$i:8",i:7"4i:4"">">"xxhhPdgkn:d}"n:d}"o:d}"o:xd}"o:|d}"$o:Pd}"<dh dhdh"""" ER"CE"ST"SLD"RRP"CE"ST"NM|""CL4"0PL4"0REt"@RRP"CE"ST"PX""TF"x"PNP"RRP"CE"ST"""H"8&"xk%P"x&H"xk%k%""P""ļ"xk%@"t"X"X"p#"4"D"xk%xk%&xk%xk%"x""xk%""H"v'"Hw'x&x&x'v'|z'""v'v'&v'p{'|s'Pr'X"}'v'v'D"v'v'&v'v'"s'v'4'r'$#d4#dnative2K d$#'$$'$'#d#"/"/$$$$$$$$ # # 4# #$ ./m#|$$$04'Z#3'X='$$$g$#m$i$ܣ# $q'$ $$$$DH&G&'5'$''$'3':' 0' D';'LF' 2'x' 8' D7' 0'p.'$##hp#pp#xp#w#Ho#r#|u#|o#o#l#o#8# o### p#*d*d*d*d,d+d X+d  0 L###,,d4,d<,dd{:{:|,d|,d,dp$@B|:|,d,d -d\-d-d-d.dL.d.d.d,d }: ;t::<l/dx$$/d%t% " |:>;@:::Dr::::l ;:`#;t:::;0j:::;o:p;:: j:tT::d;:<;|::;;%|%%%%L%ȅ%8%%|%l%%%ȗ%H% &%x%ttyclsttyopnttybgttyinttyout%%%d%%Է%%%%%$%%Xk%Xk%Xk%Xk%%Xk%Xk%%%Է%%%%%$%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%Xk%Xk%Xk%Xk%%Xk%Xk%%  $0@:X3d8q&X3d8q&X3d8q&L( (((@:g&0a&2dX3d&(&&&H&.&P &&4d<9ffs9ext2fs9cd9660 9msdos2lockf@` `:h:p:x::::::::::::Ƞ:Р:Ԡ:ܠ:::::: &&ȸ&k%L' ' 'k%4d'c'a'\`'_'a'f'&&ȸ&v'w'Hw'x&x&x'v'|z'lx't'v'v'&v'p{'|s'Pr'w'}'v'v'k%v'v'&v'v'x's'v'4'r'̄'&ȸ&X't't''k%k%X'k%t'k%'X'&X'd't'l'''t't'k%X'X'X'X't'T'X'p'. .. '''8&x'(''x&'0','|'t't'H'(''l''|'p''('l't'`'&D' 't'''$ ('l''l'' (X(l8d|8d8d^^3333l:((#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ X;d;d |(( ((h((t(:(;d;dd, >d**D**,*>dC+x+P*`+++>dl:+r++(+d++ܐ+>d+@ +@ + +>dh*@ +@ + +0*d*>d+@ +@ + ++>d)+@ +@ + +>dHp*@ +@ + +k*Hn*m*k*>d+@ +@ + ++:Hd( dXP>dT>d\>d`>dX>d<8Q @X,>d?d?d?d4d>d>d>d>d>d>d>d>d>d>d>d>d>d}i(@AAA==(A* dd%(i @@@@@@@@@@d@d<@djj\@d@@dh@d|@d@dl@d$(Ad0Ad,Ad8:d},l},,t},|},},~,:\,L,,, :,,,,:8,,,, :,,`,P, ,: ,8,,,@:$,,(,,,H:$,,(,,,P:$\: @0,(,$,,@, d: :Ȱ,̰,,İ,l: X@\+t,+x: \@,T,,: \@@+,H,: @8,4,D6,:001,,3,:@@ 5,,4,Ľ:4|,,,,,Խ:4|,,,,,:$4|,,,,, :X\+t,+ :\,T,, :X\+t,+:\,T,,:Z,ܰ, :Zа,а,09090909(-3--,#-\;--t-d-8&D--Du-x&D-0-ha-З-$x--Ī-ă------i--- -a--ج-&H-l-x---c-P--t-d-v'D-Hw'x&x&-v'ha-З-$x-v'v'&v'p{'|s'Pr'--v'v'a-v'v'&v'v'x-s'v'-r'Ȓ--Ȓ-|-Ȓ-- ... ...-t-d-8&<;.".-x&D-l".h .X9.--4).|-;..".--.-#. .$.*.l&.<%.4.-#.p-и&-t-d-v'<;.Hw'x&x&-v'h .X9.-v'v'&v'p{'|s'Pr'--v'v' .v'v'&v'v'4.s'v'-r's.y.u.|..... PIdIdId:(//T/////Z/xLd)0E0D0<0xLdC+x+0`++xLdl_+u++(+ܐ+xLdD1x11@1 11xLd:0x11@1 1H0o0XV0xLd<|A0xLd+ 1xLd, G0xLd)h+x1@1 1+xLdh+x1@1 1xLdD1x1@1 141:>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy ;D55\5L5 5$55 5|55X5d59<5D55d555555555????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 dGallant dd&d!dԕdwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpd,d?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ;x;|;;;; ;DШ6 66|6h;  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  ;6<660p#\ :ܲ;;*6t66`;;;# # 8;|;t;;{{;D;,777<7777p7<7777;;T48d=8|;H|R8Y8;`S8x^8l]8h]8d]8t8t8e80c8;w8w8e80c8;{8{8e80c8<;~88e80c8X;808e80c8;8D8e8؄8;8@8e80c8;88e80c8$;8(8e80c8h;H8p8e80c8;88e80c8;8̜8e80c8;88e80c8<;88e80c8;$8L8e80c8; 848e80c8;888e80c8;88e80c84;p88e80c8;8H888t;$.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs   ! `D(<`( .`d`D4`d`D9`D`DD4D  Fn  <`d`d \/ F 4%t!q$L,&4BĹ"M78Vx9n v07!P[2'~$hP}4|[*P|"<5Ppd X/$$/14)XI<%(QX 8Leh.Py2 0:X(, K7p.l|d>dd+dy2P7!,*8;#F?)Y%0f8{7XRd)\%$M&8q% <(\<$,  \g1dHdN`2,[)!i4{n#\j6D5<p(<0/|-hde,d#)  0p60P_k:/3LDd`'|Lm&W11d8d{6X0jo*10 7L-K#3hLCd$7*|ػ!8  t  42/@BL)pU@5d<[40i?7x58`"8@"$)P|,m!8m2 u(3'8e5"hW43T!J7PY|A0e$8mdv4P0"hR6X^4+p$ph803X0T54tW*L##PQ!x( % xd,*(@65|'$Dd3Xl6tr7"$$ -"h2 r#P4P2=#@!h.;d4+8@8 AȰ6L0XZ'DbD%Hr8" i$4P3>%$A/D=8dd'D$4e3@*.4+d>.O8-\s6XqU.1(Ll#<*H|)l09"6`6&/3,.(;8`D4#$"00AuiQ/ h4.p\]6$~50 ' $6dO*"'Tt'p#dld"$S* #<H> `i+`d5 ,C.S_6@h(G6\tX4.Dl<%t<3\ 1:Nȷ" n4L|1D9`Bd \R7@5k)Q&6t,<G<%<O5(^1e@((l7$z$w2 5lXx5L.T(#D4,",T~5 i (d@R6$2D04=X.$O2h%dp (}l7tXfkdV,hL((dq 6%#p& $77<6\6 ?d70X7LL6$e*H,8;d5,]|#dmTisx*88H3Tt.dX$d#68p>1. L6 6$(J(\;($Em#lS0d_ $gxX3Lvhti$92XXj*LU'@!O"(d`_k0r2`G(pi*"<=@8I8v6W)|vdP!7 Ȣ5,4dn,`85,`6@Uk7tf5+j$8 -OQ*Tj y$LvM!(,siQ!Ti4#0i,xX!ts$   &h$@$0 1#EO6(W$.g#LtA3T |jx848{"`Ld),l@dȒ)#p,X(3(&;3@05dCX hOi^ziPl3Tvip%<3d$8$ 8(4LY3d ?dș2,q/BiL)c3oD)xf.XLJ-d*P'`,4}i|' x'B%,38 .50, jiK 7Y Hi,Ti 8w l\2, 5 )$ ) 8 6 !!"<!8<!dd*!j$=!HdF!إ#DR!d#X]!#f!p"Dr!B!!5!$!d"!6!'$!tq!D!l$!hU$!Nd!\*!$''8 "8("p2)"&p9" iA",O#J"'4Z"Hn*0h">#|"2<"lei("p2 $"6"hE"<"l!"4("7#i4 #86%#$1k8##(>#n&G#+DR#x$ Z#C5h#.y#E"# j6t#5#Xk#q2#@j# 4#Qd#th`  $j$W0.$(5;$d+M$5j$}2w$7$'$$$H2$Ĉ/0$p+8$ )X$ o#($ d$T#$P2%Pp2%_+&%u-p6%$g3G%`>dX% +3`%LE4ti%u6P}%5%$% 5"%08%*< %%(%l+d%$H%8T0|i\0 q0,<y0d0'80$x-@0u7h0Nd0W&0,,0p7@0P.X0 4D1@t'1x&$1y$L-1-;1\dE13@T1T",g1wdq1R#8x1T/T103)H1. 1ji16x1l,01'41X(142#d2Ld*2lti12 B214S22 i22@~262x242,/ 2&2#28902L'2x&3.<3l%(3d33B ;34/HG3D 5Q3L'\34lm3x"0}3c%p3P#,3h8@3@&43- 344 3Qd3dBd353Pd3  4xG*0$4&;4T#tB4h4`X4$0l40&~4P14,4%,4܌/4*|4<2\4\944(485d5,Ad#5L6T754@K5l9/l_5l8dh5@ '{5,5W7l5q250(x5@"5#555qd5,5X!@ 6! "6l.16&LE6dK6gkV64-e67"w68V 686U"\6@3`6X66U'<6#6|,@6)87s.7h6D#7/17&97ܣ#xG7)XZ7C"pd7D40r7p27Tl'74d77\7̳)87)7(87@pd7H07x6 8p28@!08%< 981P?8 $U8P': b8&dj88,x80"t8@480`87x8J78Id8 .8T78D78Gd9- 9%9!.9H-|89Pk'L9 `6h]9Ļ8h98 v999&l9l*9/398%89T(90]'T9*9_'t9d`7:l$:14 : `33:p1:;:1,PF:`5 ^:T6hm::&t:l!:d_k:L?.: b6:40:Di:g6:di;|)!l;<(;<$;Q79;h<.K;E,4S;(#_;L2X{;T ;( ;",;D/d;d/d;g&;"/$;0.x;4;" <HFi <&P *<,4@><%G<<Q<8e<9x<h34<T*$<L7D<!*< $<-<x1 <1p<rd=/04=% =4\.=5(>=>4dS= V),n=`(Px=Pr'd=#(`=|o#<=x_"$=x7@=5=>d=pti=$=5'8="0>2>@ & >Q*t&>b(P0>!,I>DH&xW>4j>%t>!$>.>&>q2>H.,>->0 >l'>Xk ?X>: ? !?t8)?(2X:?t/pN?а, X?uic?H#xo?P),?47l?>5l?|))D?=/(?/d?|m*\?$ ?@7H@DY'<S@($`e@D6,q@%y@$x&@8D8`@-|@6H@2d@t2/@m"@08A@d@lF5xA@/d A`2(AL4 +A(o2;A6HA"YAS#`AhijA"luA@;: AjA7A0dA?5A6pA0 AI*A8dB$BMd'B,R*XBBlu.(OB}*\B`k%bBq'oBdBdBhdBJ5|B$JdB3 B?: BQdB+B#pC,XCb6  C72C 7AC /SC5D`Cqd`mC},xC8 ChBdC}"$C<4CX34C$'C7Cxw#\C$)C]6D4y+ D>dD| H!D9x-DDq"4@D88DND k3XD('HhD 0|DBdD$DHz7Dc6@DdHD 0'|Dj#DpdD8+d D/"D%|E H EQdE".($E': 6Edk`AE 2HVE-_E gE5'8rEp8E/ EC%E$E7lE 5EZ*E4&EX^5(E5@E.F(hF9F,7&F 2,F<$8F%DFR4VF/gF`8 ,sFg7}F|9 Fpo1F4GdF\7 F03F#xF$8 F6F@8G7GLD48)Gm1`GG0SGTE#ZGX&*|rG %G`$Gtdk4G*,G&LG7`G6TGx-G)lG#H<)H'H+H&$6Hii?Hd HH`D6[H*fH)HD=: H0dH$1H|=/0H %lH@4$HM$Hu%H-#Ho7dIS4HI)L/I4%x8Iji?Il6KI%SI`"0`IDC8\nI0dtI4 I;3I#I04"I g!XIl$IhI(Cd$IPU(\Jx5| J8dJ%#J`%(JI*@JT"NJE48^JE(uJhJ|8xJ,[5Jt3k JF!<J2J$GiJ.`Jj&JP_&xKO'K&(KT$\(Kh%`/KT2=K6IK48 ZK3),tK$ "l~Kha-`K 5K$96pK`d K>d4KG6K +3K $K#XK7 LHj3pLHX7LD$@*L'5LP,4KP0dYP<13LcPn1rPdz1X}Pܗ3lPiPd34PH?.P2 P@&P8 P$ PXkQ9)Qa&<5QP_7EQ0PQ TbQH :jQ7uQIdQP-xQ>*\Q,rdQL'QDdQTH64Q4,Qd!Q|8 RXdR@6*RD5`BR,/WR 0cR!4puR$/R9Rk$\RL#dR\"R5R`,Rp&X S@$S$04|%S5d-S2BS(OStj"`bS5pS`Tk}SF,LS-PX@ +[XԻ#<dXPudxX<;.dX1X>.XX+dXY8X1XD5X@ XG%DXh.dX8{!|Y1YliY\#1Y$,x@YĈ+8QY8(\Y4@djY(uY\4kYdY(Y(}$lYD `Y3Y1kYP}dY 1 Y%xZt ' ZP1 ZS4'Z8 +l5ZC'H>Zh'FZ`(xVZ;#hZ! yZ`7hZ3,Zy.Z}2Z,#tZ(g.ZDd(Z*(Zp#`[ j!\[,7[&3([P@d 5[r#HA[47L["8`[ Hr[8x}[P&D[,"t[9['[hx[($[lR&[|%[,[c' [\U! \<8 \6$.\Z'@7\xddW\h*b\\dk\&r\Id\)t\.\<\ /\ i\Cd$\(p\ /d\4]#]+"8#]954]T5dC]XkO]64a]#,n] 4]p?(l]p+d] Md]']?"D]8u2] #X] ?#@] <^P*x^P6)^5T6^Cd$E^X*<P^T}"8b^-Tm^"|^$'^,p5h^x'8^!d^9^3^#l^ L^+p_ؘ6$_l&4_`5/_.+>_l_kI_7" [_p#@i_ #{_"3_9 _(._(| _xo*L_T#P_T#_4<_ld `(#6`L5@&`<d:`P>dG`*@\`'Lj`%t`Ld`%/,`,8`9`d@4P`(& `:%t`4`Yk`_5$a$Y*a4.+aM# @a8'Ka@/Xa 3nav!a(la,^6|a\4la;/,a&aC%DaO%ap#,a<"\bd'b5`?bHI5Tb*pab${ilbo#rb bt)bSkPb7lb$1b3\b$&Hb%b A8bJ, c\tic6\'c$h3c(BcLd0Oc7"cc0Dmc=%tuck"Pc#cȡ0c.XcPdc#c<- cp# cM#c8 dd"dr(x&d73d5=d<5DOd:1t`dT%edirdk& ~da/d0W(tdPGid~2d3Td7d3dT0d,&dP" eUke(Hed''e`d5e`E8HEe[(MeP%RedW'D^eX;*qe`4}e$ he)de7`e@ #dehethedede4%Xeh8f)f#)/f2;f?dBf(JdUf>/tdfv*mf,~f if~df|k5\f$Dd(f,Fif l4Tf-f;#Xg@!g03#gE%3g{*p@g|$PgAd\g8\igdC&<{gEd(g`B,$g#g: g̰,gjg|igUkg|"` h dhD(th$.L/h}"8@hdJh3DXh9*nhOdvhd"h!h@/h%hhhdhD40h(/:hihH 'h4& iH#` i0Fi,i|6:i,`Jif$([i8si2,iP+0i^'<i#xi !i/4iȏ)i'i@%t jUkj% 'j<+7|1jfkHj. Tj$(]j(mj|D%$}jD,dj$hj2j/Xj(j#jl"j?8Dk:/Lkر/,k6Bk|6 VkdD0jkQ.xkGdkE(LkX84k+(k%kY'@k7,k =3k/xk8@kP8 l-l/+l$L$D:l,Jl$Xlp8el`K(<vlTjl+dl4K!4lp_k lL(,l|!l4l <llrdl`/@lP*m<m 4@NmBd$]m(P%mmYk~m.m hm6m,8muimlBdm$B7tm0m2m49m\#Tn#$8n""d8n. FnS8xUn)in<\7|tnX3n(ni3nN'n#rD!rL#d sdy-\s<'0#sZ#L-sk$As8 Oslz84[sH7esܰ, xs%s8$s4,ds 4sl6s?ds)s3dsp)Dt \iX t6`,tk% :tLFiFt5[th8Tot_.T|t`Fdt& tX8dt`.&Dt|.$tTV'Dtjlt3,t\1tTku;duP44D&u5d0u$!i8u-4Hu30Wu|o3ju/{uM# uLduP7"Du u2u.Du,Y!xu3Hu41v%Xv$Y#!vT408v5@Bv;dMvx<fv9nv8&lyvhiv"vTh3`v8v(<vL8v3dv&%\v<v4(v/`vTK8 wTGi %w3}<0 } }/,}Ԍ7}3}p(}`#}3}h 4~Hpd ~-~"L*~ti7~ H~`9_~D2s~, ~pV*,~08d~X#\~Id~o l~Hd~P5,~"~]6~P9@thd.%6h/D&x\Ho#4l$4}Z 605k1+dX0/pi ,!d+, Tipddk*15'@miHi-Q%8X%tg|4\y4,|8P)ɀx!4؀d!(38i %X$<$*$1\ &HD%dSX" _dy2n1t |6(~2ز/D-P1<Ӂ#ہ8(~/<dpA8&$31/X>(LIdN5Y:3 c`/<nd8X4t4<,H6͂,)0zi.0!x%H Yk-/XI9R/(_h6t&|pt.$P#&Tlu!@jXЃv6 d9@:*H)4c.4\'@=&Y+bt54niv 7h"7"L P#'X<)"ń9τ`r4 )`5'4`?#@x'-01l7`4k?{3DM̾$0W`4 n/,D{<( @18$p6Ņ̀68ՅP6lG1Td. D!D 63l".0AxL*<]o6s< T0/\8% %LdL8Æl%цШ6@܆Md /t{+T,u%Lw,a.T*$|53KH2X|.Lg$|p( @x: 58tƊ04Ԋ.&$.|L"x`:'<4D|[.(Gi!D/"A/4RI.<n09y/d~2) |i(ŋpd؋$<\i',6'rd7؈64(#$/"`6@6|D0lP8hX!dx+L %D745ьP5Dr$L/ %  /<&/36PF.,Tp8\a},8i$#0xH"8(.3+Dd60ʍqdҍ/0܍(4_6gkȗе10З 'ٗ$%DH1i.l. '(P#4_.-T,;d"<E,C"hP <X5@dk%xmD3$wF%#6L 78$'Dd(LΘz(ݘ/d p)hd ?-(&K(P&|_k /Py&7%@l5M2[},`e@ %Dy6-A4L-  'd1, ͙,1"ߙ&\sdpl88|3.x1<2Դ'T=H(Ik5LZ0 f5z vi_%pL8D`<( <0ǚ'К">)H;&$Tdd<0%'6ui>riJ6W̃5 f},s7~3t(Pl'T* 8 ƛ0D%L؛ 2'87/<X9. 8(HB8X48&Al/N83d[5b&<884<0$#<L8A5ǜ<8Ԝ 'L_6 Hm2,40,ji3+d?8DW4'c"tz!@||s!<|)PDdL & p4˝3<ӝ2@D_6m1 30X>d A(41P@h .PM 5dU'_7k]%\}L!XL6N(0udd.j%`ɞV,$ ՞`+t82<5x8p(5p4-$Bud(PH+_Զ ox68}XW-{&lt'Z'@t$p/"Pџ}!hS(P ) 6h)()8%=8#,Gxk%R\8_ - o %"i.7/lȠ4ؠ)<|w4 /d%(,$4:h:hE(P&HW$'),k3Dt30@d\ g*?#@@d##̡&"Xס|% ߡ`V5 &300d%Z(P+, #\@ė$DQ.,a%kغ |̶8h748`&2PL_'@ ;#ˢ(%l05t'T7` IdF'4#!<* Lpa6l^dk[38zxLd482Hw(dɣ#ңt4;/8p88T5'6d1dP<P )4S K.@el(p8d6X|w3d5"5Ť,hФB(ܤ8diiy.7H8$ ( 4%L@4(Lr'\Zw+el)y"8Hȥj<#)¥P)),ۥd"p($d&  C!pa5p" 4Q5LC̀2[+dc<5oLd~&|#855d$<. ui¦13L̦Qd0$`( 6H4, !\!D/+9@@dHf(hO`3P[03g3dw.Dp)0z!@8b3P4d|7H2ҧ.L(|D"T}7x$Xܘ$&6133dCh4'(Ol%,Z؄8i"Ly<- 'dei,'H< \+28Ĩ01HȨ7ר d6z-lW8 `2lt104"@$@"lN&PY3pbX1@jE,Lrl&lwYk`24t@d/d$"ɩ0r6T٩)$j H-\#|*d*$9|6I\~2W7fȣ4~2()& 9'uiƪ9PҪ)h(4+L#% ' Fi!H%P+/@8\(lFn6Z,8iyits4Lu(Dfk6X40*@;'8ud+x928=['<I6``$4nT#'hyq!h[&Xhu88(L4P2kҳT/0M)xQ  0jD@d1a)K Z)ld64p<,P(Tz$.'(3*$ȴI ڴԍ54(.t+d d*['L"؍&0*Dl6=D|5lM({3Z1k,s,|a',D7-ܐ$`d܎%põ͵%0 !LdP,"`! ($d1<$t;0g4QD*ta@)yjJ.<)<N8HhTkζX4<]/ t ԓ7r+tx(-40#;,GH#pMH!LYT5`i'pPX(G.Ļ."hH7dη@80ڷ#0N3<Fd(D',Li""4L2 +<B|Z3dOj]L!mĬ34uGd0d$Txfk$ %lĕ ĸ6ϸ`4`T.j 8-\6$h,<<: 8;: D1L>d`diĎ8DwDiLd6@k&`6Tǹq4߹(`%P%'<hRdE\,RH'$`T?: lH,}Ĉ".//T&3TA-d+ļLF'8ϼ (%p2H9 P672/dC<1"Ww6ih+dx\': 4|DL67`48Ukƽ+dӽg$ iHO3Tx%<5$t.$x@d7 <H)HZ4xm ;s\(Pt10( x8̜8Yk˾@Fdپ`)'$Td3N3$)xqd3%X<h!K5a6r4LPi 7+$4%/" 8Lο9``n23d6 P30&̬1T;(X!PIgkUxH5l0~("$$@8j8*<h# hd"D4h5$d5 & X2'4-D&(03P0p2C+2JP/!,T\f5\c~2zx1 Ld}3&(D _'@$<<<420@d\ #t6\'gk92R].[tx+teJ(x H386X0434:# $<6t'$"Pd05#V&h.\>d<3dLq#W W7d<0rdx8$i7hK!X4Pl/p8Fi4"'5*h+#$N7 $4,",0h8`6T(k.`+dh#3ptdzi0dP3@t"44Nd.8,j (i}'|Ha&D(884l,Bȭ* WHd^N50n4yL21d /<0q6-y3(@$ 3Dt"(_3`̎3x%ԣj4-|(9h$ AdkF3R48c@3 k{)8?# Lb7(lD6k=: \B! 6$ )@" ,34~38&T&-0+47l3GjPH*i:3rD0~4/8'Pm*p$A(X" %6(0`4#0 K& ļ" t"8*d76tg6LH41dU{ia/@oYk~\-88\ܐ+W'DB72$@H8:'TDw6^kP##@!(/&@4hK,.\Tdd|dr 84$E! 6d-D:30f'$6p ?dX&@|1PdLt7`)Ľ28iC7`MPx6_T2$r(/x&X#h4~2İ,y,5@f5$034+Ȉ"T2H%=0=#P0'Xg83r)4#8$,+ pT%H7 (6o0 n)8$o5\6q2IH{7`V45b̵2jF.(/Dh6i280H<(  <L'8 =70'dh,d(<]5@Ȓ-8OC#`Y8&dL"8rX&{5lx'4Yk/x'@ +FdM(\)4/d N%xp#!qd/ #9MdH^.[8)(m<&8w6D4 4d)|qd&ldu#8$fkS*  $4X6D`.`V7".LXr#]6.@(0>p0dL/0V `1DhYkqL,~'|H&H)H$r287U544+8S(X4xNd<8&0)$x1|.8P*"B<)WX3d4bdz8dg$2d0p!l%, <3E8E<$Zl5\i~2/LId'@87K6 P8d(H68h&` t8dt $"&(# 7 YkHu+XV#k3"$~}6T3-X9` 8r10q.0 ,B THp*x\i P5`Bd"&x.H/d B`@dN uiZ8U){A&$ &8!o63dl!H1dL~,8R234x}% '^7x=5*&`5u!\H6RH-a(2o" $X&L\d$Fid+"8r6`(lH,d4 0 xi Ԙ 3x6K)P_2l1ri0/+L'd$p o!L$l5'M6P5l,0d  43(&04Wk>UkT%]"k/dy,8v5\8Dl$T(4$dJ!!<[7$9Hrd .ԣ8D<z6PHP$TI$`E&ndz(8dId{6\]'6p$l%h0~3Ed(\8h0~2*$&h5L& D6RL6ked}d8~$hx`!TQi ,/q.`0&}2['@& ': 31d=d;: L|^8PYh/fp!0~I5,' iD%i 3T/(68L3k"% %H~d\"()550a&Ag3NЗ-tZP8,lt(&l~d!.lFi<<;7`,$(4*@& 4<8*`2ri=g#E0<N`8`X )n(}iDEi,h76P}25l9T!p@% }2@)8'Y741@Q2='Jl%Rfkk.(wp_3t*<-,1$i&4DH)X ,'Xp$ .n2*#lE,"O4e@54lzit#|ddd+8<4L$Yk@Fi"&< (D8. 6+B'!< .-(\<T;dH R cT, r5PL,H~d8n2ą07,41D50LF1Tb/|t6T# 2~d;7J9-W>dli7ud5HX01185&8@6k) 0'"&pd54@D hI@,XG"$c <p,f"0| <%,0.@lj8V)p7&d2<L', $ )D- G,=H#LDhQH,8x_P5gUk@z'C8@8TM$0<$,`4.Hd$ui X"L#3@ 0A9LĔ2d%3 m#8xQ.z h`fk|T*pji5 .4 '2d.8`,@% 1:P1(d0"EdNl84\detF40zG&P,L@4Hfk4# {iW'D-,/xzi$%#0-5CD0#P dXHs6`pW6-S&04!Ğ+0t=#}d0D&4ldPG86!hC/1+X@!LL60]d#,2$@k"HP3dX$d9 qD44ؓ9T"4,Yk C4@ @di`Hn7 8d2dl"h"@!t.}(= 1dIt!8V h8|6$hv8 183-Pd5X"ԉ'tHw'@dt5 hFd$(L;d6k%=@^88Pl8`c,s {@<f$Tx&@\5`c3q"4=: ,# !,* Xy$X8)7 7,8D|+dLx"8_{6r#.x5" K5dD0A548"E1$%\d 8tL"+%,V"26>ddpKЫ2[*c'8j 2$~P 7"L-H_,H*$`3x*X8t4HZ3%ui2v!F'P0X'DZ$hA8<yt i$I(`w1H Y(X!#d"PFi@(<^5H'H!,p(`43?{iK2TXdlTk|.pDd$dd0#$L2 D[5pvi#DZ'TEd(139P,4GF'0R!La8p;38yI(x idп4)*siid7F8%80~i&6p0|2$D\`'L: $$/, 5|@&p$0Xrdd @Y08 _" X! 0', t8 8t 3') 0#04  6@ Pg)Y }(h (v${ 97@ u3 \@d /| 02P XB8T ,p2 (7 dd 6 *  94* 4F#1 6`A `%N 0n $"<~ 4 .  /: gk dh " 30 ,(D  ,5t "0X! xq"2 HVk9 /8I ;7W ,*b $hp '"tx ( XFi 0 I' 7( 0: q2 % Ld x:- Dp#$ .\J# #8(/C,Dtp2V)oT'l}2|P80|z'` @Htd</̲*\)4 4P0c8"h3H/ .d>#-I\#lW)m:'Dxd<7m20  T-#h:#,<gk5dr8l70<7T%o-x309<5kJlz4a(,p6,7\Q6$/-{iL#8d8HY'D?-@d)h4`"8*!Hm6W0H4%+x6dG5dQ5l]-k6`{c3L06I5 %# pL/t&`$" 0+!L5"3;/IU&J6S_'_10f's6dT)X`Z!Q.@p+l8\1 d/zid/ $028=: >8$(hN7-Z!" k\2`rd 6/jP_2$5i8tt/+{i1"\`"40#%,*)<=ȸ&R4djt58X~5`d &4<p920l-,8) 8Yk! ~25P1 9X!4N0dW $xn|itM76`ԯ9(pjtn! J4(.B,\46X <$dPAd&|r%/p.8@T-pQ6TaH /rT)h%T0(@xizi7<04$&lĪ-# p',D.</+2703"ED8(V4$m0Px/0(dd31('('0lr#$04t3Pd б0XTkL L)p l%)Xd06M3G-$N-dW-2n-N3@{-(+-,X-h-d(-P3-.|-T.-`+- ((.DG8 .ȷ((.94+.D.;.-0K.'PU.h`.L(8s.%H. &.|2.54.|j..D<".p# <.48.Lfk.W# /(i/1/ #)/LR!d4/H D/'R/ )"0\/ %h/4.w/tl4h/F#/8e' /!p/1`/0/yi/+ p/@/ / <3, 0t-0+ %0370@n8D0)$[0+e0@l%n0 (z0@z4,0D,"T0x 30 /P0!80z10-0u$(0$$h1P i14"1f5P91 2J1^'LV1("<h1"7u1Ԍ5,1 G0 1N21@Yk13d1<51(#-|1d1h)@2@762<4$2n+8/2`%@82 /@F2DjX2je22 w2>.02g82 q52}22/h2]'<2O#2 d&H28p3 MdT3x^8!36:3pL5`I33Q38P`3"j3&(3Q%3&3H|*43O63Ti3>"3$!03736 45\4x,t)48W!84dE4HF1@V43b4,o4P2"p48"4D6W/L6|"Y6d!p65:x6$x*<6 646T;7<6$V5<636F(6H!6د)7 6|7 4/7t2P<7$*D7|d3|U7Rdd7t.78d7(O*7`S8 7(%67P&7@7D74,7x+\ 8$08\2(8|/l=8d$lK8Q3`\8T5 p82Dw8,8h,!08 <888\6L8G(8(8 u7t8448b3<80{i9H9#9)B9,iL9h Z9(0d9ȕ&s9j$9d97T9!9pm29t;d9`Fi9'9,4:Ll*0:(D":,5|3:8d|Q:/dX: s! g:8`v:l%|:h'::,6:Gd:t4:.H:S%`:$i:,$;@6 ;#; ;A5<+;{!1;0XB;>: N;6d;t),z;Z6x;);|7X;؄5d;@4;ui;I6;T2@ <j<,( #<m23<9D<I&M<P6dZ<H5t<8&@<"<d8>(#$>".> #J>g1Z>?df>P%q>)> :>4>`x*<>@^)0>j>$)>(L>P%/>9 9 ?<}d?а"-?.@B?t0:I?|5dY?p5m?D+dv?00#?`#0?&\?#L?#?(?"?.?/?d>d @$h@,%$@l5d.@4C@64T@D8a@Mdp@,Fd@4d@$@Qd@X0@5"@8wi@"4$@Ph @(8@;/x@4h AT7Aȟ5,A_8D&AY83A(AA,|&`HA.WA0i_A3iA<A<7LAD.7<A#A^5PA0dA$TAS2A|dA7AV80B83B4i Bd*BD15B@dDB&JB/dXB0(|aBd7pnB,4B(C&<B#3$B3BQdB < B3B 3B^/xCL! C3C)(1Cv,l@C +MC%UC85"fC/ nC{3|Ch2C:*Cc8C`u4C8hCX Cs,C m2D:#$Ddk/DCd$AD+&IDT!PUD 3hDd20DLh$DXZ&D&,D@1@D,8dD4D40DhD$)LD=#0 E$!0"EMd/E 1 "EdFUkFt^!( FH%8+Fhp#7F)QF\"^F/dnFTf7wF$/FP+dF8(FV!xF<F8(Fx9F$5kF*G5Gfk+G40 ;G7NG41hXGM",eGjrG0c(PG%G1"Gd K<~i$Kp,|-K'LCKD%pQK8~2`K"pKP*|zK<%iK7PK77TK6K 4XK9" KD8dK`+5K@),Lp,dLN/,L7P6L<87lHL<6VL,5k`Lt/<}LA&|L 9$L@dLA#L4L54LDp2LV",L,2MPY5M,$8.M\$@GMP)"PM`dWMػ7pbM8,vM%M &M"$M#tMT*M p#M_6MJ'M,(M,iMs$x Nl#l!NTk0N2=N)%TEN$RN,_N4f3xjNs/8NO2NxiNyiNj(N48Nh?/NPfkN<iN.Op#<OD. *O( %7Ogk6tjSH4HS@%dSiS,,S,g6HS 4S4`SdSVLpd[VdaV0m5`nVPl7 wV"$(V-7tV4d'V@wiV&Vd#TVdV~2V`kV2VId WLK/W $W}5%]$l]LYk]Gd]l5 ],]#$^p9 ^5*$^&,^8wd<^,I^l},W^ 7b^.7o^9^<'^ ^dud^Id ^*d^$4^Ld^t ^P3^t,_|$_`8%_8370_$+LA_?: N_Ƚ,[_T, h_%v_X <|_Nd_ !_0?8_d=cp PMc(|bc&ic8 wc:6c3c/dc#cD>'c!ct9c'c0{3`c|id>#dt~d d.6d.|Fdg1H^d1md8Td<%'d/dm)d7d :dȀddy%`dH[%td&e34e  e<)5edEiAe`6NeM5\et&fe$~%qe4`e$2ex2e},e&eieU2e}d$eĕ9 f4$$f($f̄'L.fd$>fQ*PWfj_fbkrf {if<$f"f7f8Odf87lf5f&fc8f<7H g$g5gv%)gPT-4g"Gg0$Rg"tZgd6pg~dg*gl%Tg4",g8q&g^1TgD"gDdgx'gL5h,h 1#h9-hQd2h4Ch"XhU8Ldhb5qhl`&zhF&h*d hT8dh"hd-ho6h K-Thж hFdh-'h'iLii4($i \3i,.TBiLe*NiL=# ^i 8<sid3`|ilO2 i$i$%$i6i 54i>diw.i؀.KQdS0x P]V'Dgr.8sd*xX 5xP/7H,8@Ā#π09>dj&T.p+Џ$4#[7`-X( 93Dl'8WT*|c>"vp/8,J5d \2`D6d@1'H3Ɓbk ρ $3@0d~)<'%#1L6hCx%(M@d[/e6du\YkH@d <#14;dƂ7Ԃ&:5#]!8Y38$pd8p-R.4>h['TJjiRX,h[l8mdD,iiddP(o6(7(!E('L T|s'b<,duL$<@dt+'p_"- ^58˅/d؅H!T^5 -trd s4T!}"2ud9Y3JQdbvimsdxLda60>&$2H.1l1,xdžk% Ն4Giކ$\+4 V!*5`2T5@<Xa.Ju'Z5h,38v|},HwiY38.8X6‡V/d҇L(Xއu6T/$& .)p4(\Ah N=*dh(q('z@6d4P)@" X`)׈#t 6y+il 4Adi/ % *G&8<DtH78O5,q1t"x $*, % 5dlj^*PӉ0؉@d\dD-60Pe(T[iH'D#o$*894E6lG&0S(*`c!@n0)h&0z"r2E10Š2Պ̽)h'@`Yklq2!yi+w(:1PI)4\tqdn#Xudkj "`:H, Ë+x͋:+%׋(`$@z5E.Nd+,)<B07HR*Y+c8 hr61 }$7L45tda6\Ό862،x+p`8p8\7 %4*p,6 <*EL&TP4d0] Tsp8TLAd f0L3d`#w8čpW1эl2܍$