ELFa( 4B4 (    ::4(4(4B4Ec4Ec$Cۣe4B4!c4!c$$_DO! "&@00Q_: 0/4EC\@/ XX@0 6QQO @@( @0 P`D  B00 R qР -LT +4EcXi4Mcmain() returned,ui   !,@@(TQ 0/bui -`LP@p@D0D 000``@ - 0LP@pڥ`ҥ`˥ V -L@P`p 00  0 0 0 0i蚥 -`Lp@P 0x 0s 0n 0ix0pj 0 ]WP@0LFT X@P 0P3X - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P' K 0 Kh'\8P8 p-LM@`P3PUOx3e H0 P'00 h0 \8'3 @'89'3  : ''p88TX9888 Q-L@'0 '̬8ج8 -PLĜ4p`V$ 4! ,0 w0 ''',0 000,  ,  0hߝPV@0D PT,0 0,09tk98888$8 0-0L @P ,00,0 R 0$ 0 00  0 0h,00,0 R$ 0 0 00  0   0;00h蚝ꙝ0hcu"g3v"g -@LC0  0;0h肝ꁝhD!g -L` @);0 D!g -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  6u4S0=0Sh9Kb4S 08#8 00L$H@0@@000 i31C0 1-L?rcWP`S áV @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S20W6 ) 00` 00P00Zpd3 00X3  #ڠ0W  -0pS0L00@`% 000PU00S`U \W%    8M%U F%C%X:r88TX9X8d8 -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h % 000 P%Xp 0 00 $p8ح88 0-L@LPX 80( 00( 0h'' p-L@`> PUP00SdXP ?lp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 㭟0@ 㢟0TTPPQ @Om@ ㄟ00000@TP303n8P060 0 308#83 R 00  ^ @00ahX: p-L@Y 9P`dU  0,00PY YR`pp 0-LP@P 0,d H@ @0cP' 0H@ 0V 0' -LM0` Pp @20S3  09P.0  0*0,0K0,0 Kh8 㾞 KhS㲞0S 㭞08#808#80KhP 㞞 0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P2`0  @o0@  00  X   8 -L M0PSp 0S` K@K  PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 Y,4 P000Bl0  %PH0@ P0 0 0   @: p-L@Pv04`K?@ᰗp -2L M PRl2   ``0KST2`0 W0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] R3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K&0 ,pK  3 00,0K,0K3 f @4  0+@K*K( | #t003 P3,00,0Pb@:h , X:r(   0-L M|P@T  Q P00 K0H 0@`@p,b$0 Sq00t:8D!gl "g p-0QLM@`  `<xR P 0P ,Vx p-0QLM@`  `<xR P P0\Vx p-0QLM@`  `<xR P P0XVx p-0QLM@`  `<<xR P 0P (Vx -P0 L  80C R8 2 d #8XH$ -P0 L  80C R8 4 h #8XH$ -< <0L:\0  (@ H$9;90@-9 0 0@0@0 0@0@ -L MA0P` ` ,0K "[L1RC R $K2[mCX#X`+p@1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kp p0 00@0@, [D0   s=P'H$### 0-MLM@P90000% 1 R* ?  p!0S`1 KT!0KH1AKA AP$1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼,2 2 0 0 0 2 0 0 0 0 1 0000000000004*P'D -80)0L 0 :P'0 0  : p-0LM @+P-` x0 00> `P0 R0C  (P01Ł'B'D'F'H' 0-LM RP6 P6 6 6 H6 H6 H6 H6 6 6 6 7 (7 H6 \7 7 7 8 H6 P6 H6 <8 8P@0!80! 081P @1 P @@P1P @x1 P @`1P @H1  8!0 @P!0@0 P0 000 0 0 0 0P @ = P @l 0`@0 PD D0 @P|P'.'0'2'4'6'8'<'>'B'D'H'F' R-L  p-LMQ@;01  P `# 0!0  0PPV0(B(R`0 01> 0PP9 x+r 00a=C4`#hl 0dx0S 40< `*  `0:0P'8,'8 p-0L P@p0`   000h!2  R` ^P00 S 01PV@p|##vi# -@PL 1 `p = R 0 0< SY  SK  SI  SMS00-00S < < < < < < < ; < 1 9 0 R 0 I0| 0 R0 R S x0 h0 X0 H0 @0  0 0 00*64P' -/0HpL` S $> ,> 4> p= <> p= p= p= p= p= D> 0GS= = > = = >  0 0NP@/P h0h pᲀX0 R    *46 -L\M4@KP e03K/P3#K 8#c[Qr Qn 0S=Q  F2 3K2#K 2["[`0 2[d h0  32 ㌂#K3K0[[3 1C 0!0}"[208P"KKK 7 Py Ps r2">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K  = =`   P!P1QQZ@K&05K,15K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 \p["[2[@P'7 D$l9hQp808v'N$h8D8 0-LMPl0  (H0@@0!0@ 9I=98,P' -9L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- # 0h.V0CRt 72RD >0R@2@ 0C 0h:0CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R@A=@01@@0 = 01@@01@@0t1@@0@0  0,1@@01 0h 1@@0 0 0 0h0@@0 D 0 # :0h 0 0R t00 0 # C648F<.2:>*B|#0#8 -MLM1 0 p 000CSp(KBKII  D 70T `0S` @ T .pP@VP9K 8K 0H"0C4K#KK t0 B("(S04"43K@BK0 5[Z90K 5KZ*K ZM @ 0 BD$[4[Q04KD 0 D B0000 < { ZM@ Q0 BDDt 0 0 0C0D 0 ^5[K R<0# 40Ba"8P':gfff 6S-LP` 8SB  p 0:Q8  X@#8  0Q:`8X@   #8`|@@D>t `X0 R0C  (9Tp<Я8H$ -LMt!0 0 @P  @ 4QPEuD q 0Rj0 ` ( U3 0R" D ( R4 h 0X 60bP?`VP\\0 R0C6 l P:CXU<P'8H$ -= LR xPx`x@0 $<< p0T㚐 0Ti萐  0-@LP@240 00 @0@08P' p-L M= @RP+ 0`0 P PEZuKpUp 000X01KL01K01K0K 00PP'(8 -0LHMp$Kh`KD0 ZK P H(@"(D0#K0K"K0 0H00< 0 04P  |P' <8 -LTMl p D_l p@h峉,?` S  ~ .0 h>P  &XG>n*T  E>TL E0CT >T >T.p 0lX `>T [0CT 0TJ  p0l0xX 4X0 X0S  x Ǽx\  - 0:0 `喊(K=T !=T S=T =ThP/ 4XX l 6@ x x$=T K 0CTp 0ThyP< R l 62 = R  孼 |9R  R 0CR 9 Xp0X))($9T 9T 9Tl 6 8 R  嬻8X 0X <0$9 XPX 0 St8T 0Tyl 6 = S/ @St 8 l0&48 ~,8T $8T 8T\h*PpX X70SLp  X LpX Eh Po 0Lp X X'-'P+X0 \d7Q 47Q  Q%  Q PG0XPXP l 6hԿP8 Tp X X<&&PXppX h㶿Pp 1S ?X 0p 1X 0XPl 6 6 l 606p0 0S 5 $5 Rp 010   徺,X X0/ l5 XPX0 =R p 101p?X  d噺4X 0X0, 4 X@PX p0 s L4X 0X0, p4 XPX0 p0![h!P3 R |^0T0 p X 0T 00bY"p 0SX 0 P\ d0 t U t0 `  @h  h" t0 0$30 R0S    05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 hP000p0\  >&P:p0 T0 p0 X 0T 00b S,p 0d  Sd %:0B\0 1 p06@/ .,p7X p0# :! &X U  X 㐹P_vi\8ii i5i i i iiii *":(S gfffd8:#816i(i8i A i iii88?71B##-%C(P'>   0 R \0 4K04K@0$K NK0RV 0RD 0CRl PR XD/i@X0  s *2 0T X 0 !!X0 x 6xp  ! {%x>   0 R x1 4K04K1>,0X ^= R&X A s 0X 0!1X 0000 XD X 00-0X 0S00 X 008200X0 T X +00#@; x xP Z2Q !0Q~2Q< 2Q4 2Q, 2Q$ 2QC 3Ql\i3Q' D0CQ >0Q_@3Q4 0QX= RX l3  q|3  H3  3 @ 3  0WX0 M4   &= R $4 X;1>,02 -L:#[#8#,: F-B8l8 |####*D$! -` L@LtPi@D♈te q0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJ[z/ pP 0RJ0 ` (  0R  ( R4 h 0X Z9 P <9  0, <<$H$8ܰ8 -LMP,0 60  Paz,0> R6 l ) R6 l 0X @R6 l 0X 60 h@P R6 l (P0P R6 l ($0P(KH$4xV -L0M`P? QC =P 43QX Fd0CQd  80-P/ @Rz8 p 0X R8 p 0X\ RL8 p 0(x2  0dP (K0S<2.`K0K2K02K 2Q: 0Q0SX2K?2K.`K02K00C SK~ ~ ~ (~ ~ ~ ~ (~ (~ (~ \~ 0!02K0"K.`K2K A=0S: l10S. S08#[.`KK}h<@0 fP 8=  #A$[P& >K m8K i *K e 0  0D P 0 0@0@7z 7갤[>0P 6[Tn 7 lK60 <0< P 79 T <00 0lK @AM@ 07p GP 9 7 700 @0@A= G 0 : %5KP'(4'*|##@888x8̱8,8 -03L  9sc @RZ2 d 0X R4 h 2X謢r Rj2 d 0X 0R0 ` ( RP4 h @2Xsc 0R" D ( R4 h @0X1 Rh &4  1 R0C4 h :Xdd1 R0C2 d P1XU 1S?1 R0C4 h >=CX0 R0C4 h 0X R4 h 0X R4 h 0X~0`H$p -7gLP M}/ @7 #K3K 4KpP &$K賯 0Ky ph \70P9$ # ! 0D|1( ! # ( :    7 'p0C &006 & <06 pp0d &00A= &6pp ?"K2K*K0P6|6"[   =Q Q Q +>2K 5"K P2[S&000 , ( Tq5B@K4K 04K5 P5  [^5ࠃk5  P N@\%\5{ 0\, 0V0 e0nT0@\s  *S$000/0$0f10Tl4 d4@ Q 3T$3}.  842Q$000(4Q#0;04  b3^ʙ03\`0@  03\000Ǵ3K 0hc 00  0 0c 040 z20{ 0b 00bY Q20d 0 0b0:1 (0O  0E 0"0< 00312 P0À 01 P 00 01 0o0! 0h0 0a0 0Z 0lT0 0TM0 @0F~ 0(@0u 090l 02R 0,0I 0%0@$P'T8x88l98+ 0,24.6BF#8D; t0 TX98D$'j)('_eNaa -LMP`p 0P@   "0T 0P  @0T 0P 0  T)40 T0DD @T0 T 0P  0T 0P 0P   0S 0  !0 0 0 d@@T ܀ $@  0 d -L M@, 0 Pp 0 `  "0T 0 `0 T&40 T0  TJ40 T 0  0T0  00S ,0 `(KoW!`0 ,04(K 0-LMCS3   PK0 -LMp"8#h030 @#Tؒ唣嘃P, @aH,$H00  p@ e0d88Õ#hp @,0  0p` U(K -LM8 b@ P8آ0 P唓Ü 4 0   "0T  0P  @0T  0P 0 0  T0L40  T0DD  @T0  T  0P  0T 0P  8 3Sy 0X)0K*0K4 p 0S+  0PB@W0   0 p*0KRPE@R  4*0K)K p Pp 04P W0*0KXW60 0 0 840dP 0(KPU  $  $0 0  0 X  $@@ U80| 8b 4 *0K)KU XX R 04 dl88 -L4M\3s嘓PL0 \S  b؂$  0@ p0  T0  0 0 4~ !0T 0 ~ $'!P @L0\3(K $  "0T00 0 @~dT  $@d  0T00 0  0T00 0  H0T 0T @0TtJP 0  P/HK 0  @ PHK P@/  I0T @0T 0TIP 0  PHK 0  @ P|XHK P[@00 0  0TL'Ѝ: -L(M#3rآ@ #S`< X SS *(KS 0@S4000(# 40)3ƅ)#ƕYH0I0("*3$2`#t3"2堓l3x#@0PRPU0X4,+   h@  0@  0T  0@ 3Sp13bP `z00@S8K@ <0 P Y00( K#"0RP2@@  0@  "0T  0@  0T 0 @ ˠ @ <0  긴8ؔ ,"Դ8 -2L $ 0-2PL@ $@0•00 T0 -3LS260 T -LMÐ@ \00 j茋77-Ð0 \ ꌋ77 -L⭍ 0-@LPύ20" 0  0-3LS@ 0P” 0T|” 0TP|U” 0T0 -L@hm p- ML802"0 o@2" 0uP 0 "R  Kphd"0E"Kph[p ( "" -3L $ -LÐ0 T -LM 0 0ċ70 ċ7Q -L  0-@LP,20" 0 a p- ML802"0 o@2"Pp p0 0 "R  Kph"0"Kph "" -@QLPppU@#BpW?`0OOP$ 2>AB?OCPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0:|b -,0L8l02 0 :|b0 8:0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ :L"gXbP"gb 8"g$0 R0 RL"g : -0L`4Pm 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T z $  T 0pWdz}~@ $ pW z0@W}~ $0P0P@0T k@8 0-@L t04 00P T0hu -0删S/0 4p 0  0LT&40S  $  0PT  0T  0T  0Tdoz@T T* 0  T0Sz S6 @ ܴ  P X  $ PF P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00|  $0`  T  $Z0P  T  $0@  TZTU000Z ,h0{ 0 S0 00  0T  $0@  T@0  T0@ 2P |"|Ÿ0 Sj00 Sh QP,TD V<8 R, oPl{ 2 R0  0@Q000Q 0000@000\X0 00D1 R0 0l(mh  $x0 r0$ 0440 0Sx0 y0 @0 0 l000 00leL"g8Xbb (8 ܪ ܻ 08D8`888 88Ե8|8@"gTX9 8wi :D"g'888 -PL `p@r 0T@DD0 @T0 T 0T 0T @0T0 T $is -LMP@pP 0`P  0<<0< 80@` ,0 $ $0p<"g:wiL"g ::H"g: 0-LMhPd0d@ @0P @0S000,0 0K0hoL"g :<"gH"g :\8 -LM@`p r}^PU ,x $  P50 T00 0 }^PU x $  PtP msPU w $@  0T 0T@"g N0 L"g<"g -LP `q0pP $  $@ $r 0T@"g 0 L"g<"g -@Lvqt0  0t0r -PPLL 0RH 8paq@堀`T Q):W0  t0 or0 0040 TrT*tt ` x p0 0Rp0x <T l0  2@ 0X|b7 -L M80`S4P删  $8 , ;  $@P 0  0, @0  , 0  , t0 0t0| R,0H, ,l0p"200SM  $Y  $p l@ 000 r0Si 0rx t0 0Rt0x ?  $p  $0T *p@0T@, 0 0 00 T@|0  `0`S  J0CT  $ (KT<!0t, l0 20,Pi 0 00  T^000 00Vql0 20,P|b -L M@1p0pPtpx0p0t0qq<<0W ``U 0p`KH8l9x8 -LM"p00AP4`ppt0  0+Dq$K|0Sʤ0 0 H0S t00t0 RS 0H 0.H0S H@TPP#0 00 T0S0 @ @T u $@  0T 夠KR #H R#PP @ 0@ TT >00 T0   B0T: N -LM#p0`0Q(@i0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@|0@P0C|0 WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T:8|b -LMŸa48@, l ሠpPP(K0 P`2Wh T2W4 @0CW6 42W I1CWd ;1CW㸦P 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0:|b]t@yt ktzt lt -8pLW`4@P t0  0@#00C S          0@2Ÿ 0i @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0Sg p0 Tds $ 0Tds $0S@  0T0 T0S0   0Ti] 0T 0T 0T 0T 0T 0Tr0 T $<<0 pT:H"g -04Pp008@L `T0 T0  00^  0Tdr $dr0 T0@00C S   t  $0 T0  hĩ 0T 0T 0T 0T 0T0 T - LA8P4pt0`  0  l0 20 \lt0  [t0 0t0 m000 T<:|b - (LM$(" P4 80 W0qWS 'l8P@U5 hmt5% 0 pE   8tPl뀀 0 X t0  0Nm@(K4  0S 0Bm@\$%$5 ťt@P t  t0S ) 0mt@́tb4 0 0@>K0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P800="R$ 0 000 - 0p`L80@S@ l!X00090=,ohwgp@lP8k/ohvi`888 0-L@\gP0hh p-LM H`T Kg X@ 0 8>040 0ahKp 0KPPP/g@   ,0 0 ( (@ ^ 8ch -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `f(08 04p090(Kog(K<0$(Ko]<  (KoWh8 p-LMPyfH`T 08 j0$00jgKp 0KHP   ,0 0  (0 ^ @8 -`80$ @RL0p4PP 00$1l00< @0, 00 00C 00$@202LP0040004 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<^:#:zc>0PP4*3 S R 1`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 41@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % 108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $`e00 p04lB pt2   lš0p \0S <2S Afp(Kl@$<   l ,i(0 p-LMPdH`T 08 00fKp 0KP   ,0 0  (  ^ @8 -LM P=b@Vp7 0SP32,0Pn Y0P P, F 4,0p 0P  4# 800 0pS0000Y < P  1,01,0]d @ Re 80,  7PP& ,0S  P 4(p,` "k j( l0r,0 oP0,0o#d@ de耎::::Ȏ:: 0- 0LS@P YP 0XP 0 PIP0-80=\  0 `\0d hP -LM=BT (KX20X2c(8,X,H40 (HeU'Y P$ $`V 0SS lP80S 0C0b20000#s2(Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0Ec@d0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000 c@Kd90Sb@>dN08⪹0UT"g0 \T"g 0-L@PPK0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00b@Tc$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0KR 2\8R 0R 0V8V!0NPPS񟗊@ P 7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SP`  l $ ^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pd=2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  JN4S Sr S0.Ÿ@(U@1@# @8 C4  0y2^/ 00l— pt2   l2pH ,O`K@' \8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0K'U00U0 0 U 0R0* R# R  s U`1 `#@f TP1 P#p@e T@# xl P P R .M# #:;:8":+:4:8 -L@P 0hB -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0_$@0h` -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"{rlV@IX2V0CX2 lB pt2  B l•p 0\4 04 2l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`$@`lB pt2  B l•p 0\l`P80P8tP`z $P(`0P8r8ȷ888 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00hf -80L="R<2S 0-LPP@0jT0 -LM80P=b0V@  , 4@pP7 $`D00%0  0 0R & 170<0@ ,, 00C 00 2p$PL@F^004p090_<2S a ( -L@P 0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@](0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S _<2S l@ ὿V -L@'P 0h 0-80L@P="R 0P<2S00 -L@P 0h P =2S<2S  -LMp0  R0 0Q6  090QP4 1 0@9P02>U 0 <P@<0E?01P E 0R904 0 @RJ1?P5@TZ 4  8A~A ᔐPP 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ HdlBpt2 P l— 00p\dlBpt2 P l—p 0\@ bl—pt2  l2p ,@ T$/@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\lBpt2  l—pH ,0\lBpt2  l— 0pL \,@ |Pul—`pt2 ` l2pH ,@ T0@@ 004  HHDH4lRpt2 ` l—4p1 \H 0@T"g8H:D8@%I$h:h!88 -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DklBpt2 p l–p 1\X8 p-LMPRl• pt2  B l2p ,d B`0 @`0P 8T <30`2xV0`2x9l9888 -QLMp`G Q1 Q i<2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2=<20C<2blB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\UlBpt2  l–0pH \2C<2 0CD(<2L(H(icl–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$ p-T0L@`TP @T 9S  @Tp"g -04 10@LP  >00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0 0-LP@@T0 Y9  0-@LPX 0 0 9@)0hTY -@4LP R00080 0 4P0,0 0$0(0 0-PLWIT R0009 0  %Y0 -Ltɐ`p0P$ 0 0`0=,0,0,09,0,0tpx8@ 04@D00@<:8 |0h1,(0\  @ ` \ H00H0viS 0-9L@| Љ -0.@L 0ۉP h^"!и8 -L M0 4 L, 04 8 P , 0S ,0 S S] SA p0,6(Kp0. 08< 044 @0 0@, 04``p4 `00p`pL998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@r4888 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(7ɄK0p 0.t8T8 0-PL@z00P0@T0먹8 p-@LP`rVP0S @ 0 0 0 8 80P8 phW8 0-PL@UVP0S W@ 00@0@0  08 0-LMP~@# ,0  0   l (00(0 ,00,0$00$0K0 o  P0 48Q Q| Q>  ֆ0 $ (,   048 < 8  P[0 48<@(0) *4+8<S(KO0 0 PP0   ㍆0 $ (, B 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPH뀻8X8 -LM Ly@W ßX9 "10 0 0 9P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@0 0 !" 4#`8`P zVX ",0( 4;2( +>$0"` d405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K ?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ g" "202 0-LILPL @V08 H 0 48 N La0 0 ᝣؼ8& p-@PLn`rN0T0*TX PH:ʄ0CH:phN p-n`PLNJT TQX0X0X0:TX H:0H:Np -yPLHzN> ,0 W9 * Ʌʅʅʅ ` *@\9\`0)40@ 480<$P娰`WL! 0-@PL YU 09 Ac 0 倀)> 0 9Y @9l@ 9 P R040S840S --LM K00,8 0g. K -dL@{P , P  88 -HLTp` +^JT L p |Pd:S +^ 08 -HLTp oJT L p WPPL9 h P PPfo 08 - LgM`0hpP`m/K0\@T[P 0 K]K O1 S h h00 0K 0RS.K 0T`p` @p@`pW0`pVviedAD8 -@L`p  PPL w X)R䁟`  0p)t R t9 RX9"100PVp P Q0p9  0S00Qp p V#t9PP 0 S0 S RQ  PU p t9PPUpp P t9 P2T!   ~PP (蠏:8h8 --LM K00,8 0- K --LM K00,8 0 - K<0 0-PL @P P0qg -LMS8# 0 ,K hGP`XI 0ĐK:0 . =0h0 0, 0h!0 P` Lp 00 H D P P P H0 0H00 [ %0 + 0 S ?04X@ `p XP1X#\   ?04X@@,PC(K 00P@K00@@vi88 -L(MhV. +^jV* L p P0K Ŀ4@T@T  pPP (0 @  㞿P  L@+^  4@(K @ ឿL)04 8P\IT p0 48<S, @T A}@ <}000W  \) L\I) (0*+4 8<0#,##Ƞ+ )*(0p  (84@40 $  $(\$H0 @PLɖ 0! "4#8< <P@\P0PLLɖ 0! "4#8<S$t)!< X0SSXʎ( Ѿ<D \80 NP0cP@ 40  @@ 048<0###,  0XP@+ < h 0@$ @rg808<8X88t8 0-RL0 0h( 0谾8 0-L M@P90K0 p-X9PSL p  f|pI`TL Z)|p\Q@T \ 0Pܾ8 0-L Mɠ@P 00K0 -L$ML L00 H0 1|`P 8K'LpyW D @ < \q L 0P048 L2 $(T\= pWD0SZ  <Q| Lp9Sx \pq $0( 4L8T\^ L Wt9 X [ \q0p pL 0P H71U% $0&'48<@ 0D0R0D0  8Kⷽ 0@$4(8 @ 8K ㍽P; $0( 4L8T\ <  U < ~}T{ UW@);{(K UkHP@HD@H4@(XH @marc$8CRAM8`88D8 p-LM`R@P ! P $88#Č@ a@0,  @+Kp訿8 -LzM0 ! ' 9SH S G(KL)! 0"4# 8  t@X RpX0S pW` D) 4$p`X R 7AX0S3  RL K 0 ,KDP  ß@, h1[VP||h.K,0V@P T h1,ZV,@0  1 S L K (K021 1RS L KSKL) 0 "48 < P @Q  ! K 0!R  ie !1R[zKNK0@TPT[D0 L KP *PP 0P0Q0S`L)000000000K Q!LK\ ,0 `0L 1002@3 48K(0,@zK04L 83H0   l @P L K@SA T1SDT[0 L KxP+>L) p L0K\nXI mx L K<-888,8Կ8viedAD8X888|88(#!8 -LMLɐ 0!"4# 8  tpX0SP  qX0S  Rp (KoPW ?00 {bVF 0S`V> 0S> L)0,0 p h0EQ@ @4 R 0 S@RTQQ 4 R 0 S@RTQ"GT 0 嘝xY,h 0(Koz0S*E0P@z 8!(\ %P2"0CR202 0S00 yzF888:x88U -LzM\pK 0 PP P  DJ@(K  (B@,K5B@P 8@d, h1TP , ?P@ h1, T,?h,.K0@TP 1 S  h02(PK (RQ 0 4 h1,nT,>W/KP " #B00@2 B 2  ~KR <K ! ' x \,0`01 ha~OK0@P!(@,P1 0@4PMA 8<K⓺H0 Q@X@ xm0a 0 0 0 /0C B0 0C B0 = B <KaP%Ƞ P>!4!( !? 7P90: ;=0P!"#1P2P3P4P5P6P[@8![<  !1H$0!X +xL2PX99X ػ\Ʌ xt 2!0p)P&OXy"R, 0S0202_y@U t P  w wZ  wl  Q "w@ ‰888viedAD8X8<8D88L88 0-@1L PR "RE HT P0S J0T0R R R 0 0hfp)R \0S \0S R`0 l1P L)p 00h7D8d8$8 -L4MpPK@`P 0Xɔ\048 L1 $(T\ p K"1   P X^L1U0@K `0` P 0 4 8,R* R R 0:504 80 0 @00 @ @ @X\ 04 8,P00 marc8:|8CRAM88L8 -LvM`! &((0"4#2 40  $,K?@P h    .}v)yv(K$P, h13RpP ,<A A A h,.K0 R@Pc ,h1.RPP,<1 SQ Q Q   vP t  vP x A~KXYQ Kp<W 0S&40$ $,K! ?PX, h1QPC0! P >A0 48Lx1 $(T\ X,h1 Q,;< h1,Q,3<q q q m1U L K 0!1P @,h1 Q,< 4 0!! ! J )F %11 @ (u@ u  0! $0@8viedAmarcCRAM88p8H8 -LM0  80 upX "10!PP4 piV0` * 0㨀00 ,0 40 \ P0\X0048 L1 $(T\ `V X0S\`V)[u4 Wu0(K0U \ 40P,0S \ ヷ00\000  xu. 8NL  p0,0 000 ꠏ:marcCRAM -RL,MT `N Mp0@P0  RuT0p900p APt0\@X0, LK 0,KU>P/ ,h1 PP- h,0 `0 0S @00$@S p P0sP T0pW@P(KP0P 0P0 ((0P0 ,;0P0 vi:8 -L,MOp QL P0 E tL0S7  t0\9H _PH m ?Pb/0p #18#hV%@ PVP  P@ H@K 0 ^  `  P `(K  7pX 7 " sPP2 P PPp@ P L)540647/8 <S ` ` ` t`? I2Tʘ0\T9 x9|I @ P0 x |&- P R0 0:(>*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @} p9S 3# 0@@ T T0U T * ڵ1A p $`P P`TQ&)PaL0ST9V L) p )L)0^\IT x:S P @TXʘ\l  P0 Pd `#V#`F X` H`L `@  @sL p hp.hP9`SO 09L `@  sp xQL) p Xo` , 4S PL @p0SP$<$$$301 20@L  pL9 p0 rL) p >qPp PL  L9 p0\ uL 8T8P8488l88$N!N!88888|888p88(#!48 -P0L8p@`4t!81TH ,1T6  1T. 1T' 0H0/Ӵ2t0T, 0T3P00T 0T00S0  0 B&B"B!B%B'B(B)BݽG=!40BS (0Q 1Q -4ud@ -LMH{P@UL ,@ 4S 0S ,S  ,C ,P$ ,#$0S{0Sx  Rqs  Vr`P $0, &P  PP,c L0@sL8 $, KLVsP,c U,0S 4S `0S $S,   $0S$% $0&'48<04 506$7(,r{ 4QP'XPU$  PP\f 0S `0S$ RQ$ $`U 80X080X ,0`P\ qpP   5406@ 427P<01002@ 423<0! 0"@ 42#<0 0 @ 42<0ෳ43S0P0 40S  0SX RQX Xp4X4s P\$P`0X$0c   0rP<    0rP@  43S $3 $XP$ $|P $0S iqPH  $# 0P L(# L K(H0LK\0 h (0:98T =<ČT>Ȍ?; ,H  P (#LK09=8< >:; $? (H3 L \(@,P( 09=@8<>Č?:;P|H Ȍl0`4p˴(H3 8HLH H0LHO0X0MrL"RG 0SH0L202Rr$XP$ s48 2K0s0S   ȲP 00h0  CR <#00@3  @0 QPZ.S8A8dL 0X@0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L <K0p 16K   ` 0CSu PL#0@qL38 2K0 LKq88 XYV4cP@XpT P $Po oU@ o`W0#R @P $Po oU@,@T P $Po oU@,3S ,@ ,C oT<*o@*o8(K0Q @  ӱP0h0 $@T  ȱPP X@0S<*JL#@s  $?(<L  %PX T < P (KP@K T0T #<`0 "(T0h X \ d #4l Tp0 "|"X"4<tX..h.D`[J0KPKh[X0[OKp[I0K 0 HKGKEKt NKMKLpKKPKF0Kt 0@KT R0-0K00K/0K.0K0@ *0K,@K+@K)@KoX0#,##0 K/K.K-0K -LrM L ` A= 0<向姠>?@ Č:Ȍ089 ̌ᜡ @ ɯᬑ 娡 $ᐡ! A 娑;/ᐑ夡 壐嘡̑ 圑\ ᠡ ȡ!0O1  OcK| P  aKᨑ `p@d ?$(\p l ZK~KpWP`P`B2MP`.K c@`$!\xQ0T0R _  0 P[\A 唡9S@ M?K0@41 0A KKP`0PU`@p,q ( IK$ t VAڔL9L) 0!"4# 8̓ t 0X R\ 1X RV  QRP 1|AL)p XX㞾(K atqVꔁ|L)p yx U$xPv !t1Rrqp !""4",D1 <  8 @! hXT@g| x 0|!h|XY l!R 0 88888@8`8@-L)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T a\0P@t 0 dkVTn 0D @0 TKpP0S[W \D0t L 0X$(^ ,K &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko8 0- @0L,墮(0 :0 9 0X*T:8h!d!8!-0 4 8<S 0-(04PS 0L(07@8\80 -LM L ?P@ D0HL`P0 0@ P 0   p (K00 0@D0L)p T 0(08 0-(0LS4P 0 ( 6@80h p-`LP ٫ j)HLp" !]Pj0@pPqIT PB R 080Qh\@Tphq! -2L@P 2S P P j"`pP Pራ"i0S0 (  R(00P2  -LMP0h0p 0d0 ` Pd 00000 ,@ $ bR00S40V80 ,"?110AOHL( 0d4p 0 0$0 008PU `(40,0  0 0$ 0K  㖫00K0 @00 ,@ 4P`U(K d0 d  0-L0P  (Q 5@0h70 <00h`i! -LMKd @*P 0 g40 @<0GiP0(K 8H! -LqMP@P K 0`0@ ,@ PPpp0K?2PDs@0 h1DPh0y/K0EP1 S02( K01SSt  i 0@P* p`,@T P Ph hU@ )h0@V@P00S "h1 lD0.(K 0XpPp`405 6478<sb h\`0 0@0@` \ pᱪ , K,@TQS @T, 0 48<S ╪P Kp`  ⇪P Kp`P K`~`|0s.p`vP K|p`nh1 0C0`. p`dP K8y`^ )h|viedA8l8808H88 0-L \P@  S  9L) 0!"#4 8<90q P02 Q " RzP0#2  P  00-P0 LⳫ0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*08!CP? ,-Q p@ ng01  hgZ t P  `g .\g XgT ğ,h1 %C,-(K p Cg.?g ;g (,h.K,0iCP1 S  02( K01SS  {Pp@  h1,B,M- Pp@Q  td =g \@,0 `01 h@P@PL) 5406748 <0@4P(@,P1 ӪL 8H0 X g@m0a 0 0 0 /0C B0 0C B0 @ 嘀噀嚀囀圀址垀埀 L= BP 0 407 001 2 3 5 6  !"#89:;<=>?@‪!1Hⴽ0|!X⯽ f(80LYXԉD h \ft !  嘀p)% f@p 8f0008   B⋨\9 0L)\y)(0*+48 <0##Ġ#+)*(0"P@  0@vi08edAH8l88<8D88L88 -LM<`KN_Kp@KLI\FmI OGO s  ss㳧㰧\㭧(K -LzM@`TpP@K z㛧 K肏K,<PU @ @<U@ -LMPh9i)j 4k8|WN@ P4K pm K!0 " #ČNȌ@(`̌h ;p 4K  ;r 㬧PP FP -L$M P P04 8<S S D$K<$0 0@ QH8LHhARP  <$0P  PYU800\PU 0d0㾷cP LHK$ Ứ $L)H D 98:p<= ;P>`?< L#?1SDOpPU! 3! (00  <0 c`PP0 HLp !]Pd0@pPqx(%sqo8888! -LzM@`TpP@K z㈦ K肏K,q;PU @ @=U@ -LM@Ph9ij`4k 8Xp @P<K\ Y V(K  dP 0! "#ČȌ̌h  ;p7 @8P 8 -LXMd 00K\0 @h#X@ (P\P`LI`` ! 0"#48] \<P`^Čp80<@(Ko8 0- @0L,彥(0 :0 9 0X*T:H8!!!@-L)@ 0!"#48 <9 -,0LS@P` 0(00  L |pP0S ppPL8p  0 (0 ⫹P88t8 -L$M0K$"`zP=L)0K0P 48<@0 ,  .  8   0LY@ty40 !0 "# 00@1X R#X⥸ ty 1X R02I *(KLY 0! "#48Q8 c02A 0O0 K  P  80Y! 0"4#4 8<S 4 L)p S888 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S= U!!!H!,!!\0<' \Ɏ$ K0\0<&p 0常\0<\0< p 0(墸$0K0h蚑 噸t8T878 -LMP@`,t)q0X@T& T !!(!!!(!X!V V .t)0L)p 0PkV0X`p` 0d9+] Ki.0FSV ViV VȺ87 M-L0R TiKL9',&&Ƞ&'D'X? 9:;=@>P8`;p?P4 (8N  0]@^`\\ X0 Č_@ȌlP05 eLQXpEP \ E0LRQr5BPPTp tᄋ4UL H0 jt p | x Pp `t08P 4` +@0 , <0 D@ 048<`p ` p Y8 K `pP ` p O<`  K tpK@@@Prʠ K @@ Pd 00 0 0 0 0P\ K |KlLpKHL  2. @   0@ 0@)T*TX :P'+ 00#圁 0   LɚX 048<@KQ \8 #@$,##$T$h P`0@L0 p$89`妀( | =@:P<0dp  >;4` ? 8 ́,Pl @h vdKlpKpWP`P`B2MP`l K cP`DU 0T`K@0@|pSZ PIDP 9SW0|K@| x 00K8K T@8 4 P LxPP`ULL) 0!"4# 8<P`Utɚ0X R;  0X R3 0@P1QiL)p WPxT9S VPR L)Xp (Ko̳0 8 巀T\ l9888 -LM00K0 @(&@ OPLP`L9`]!\ Pp"@^ $#_` p( Lp Z 0`KP  0@Q0@5 0H@Pt@ pP 夀pP0H t 0c9C  0 Q 8@Qᄛ4T P0 0K0 @ PH0 D@ T0KtK0S@80 4@ @_\@ XP @ < 凔ᦛᆄ8Lt K PNY\Y@  L9HK`p ` p KQ l h h0X`( ̂S c_ t K @ K | x Kt K x@ R0Sd `0 ʮ 0|`K@`p|` xp pP `0K Fp`7NV>F DKT. P T`p0##8 K 0`t)|01C X R ɲpWh (K\pQ\Kl h P T0`##02, l`KLp| 0 pP\`KlK`Vp\` Xp `D LL B0l@K0@ PLP| d0 PP A  0l@K00LP| P@P P  0 0 0|PRULL)p Pv' PR 0S 00@0 0 0T @T0`*X :嘠( e48d8@8 0-L ML@! 0Y"4#8 0 K00SPtɔ0X RM1X RI0K! 00P00 R- @R 0S$0SR4U !!x!!!!\0<& p 0喲\0<' ɄK0\0< \0<p 0 wu8T88 -LMP@`&t9q0X@T% T !$!!!!!!V V 't)0L)p 0PPHVX`p0 0d9+; Ki'V87 -L9@] \L^_  DpL48 M-L0Rp` 8 KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki8 0- @0Ld哝`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l* 8d!!!!!!!!@ VB K QFQP봐`L9pPKK   圀K KQ l h h(` ̂Y ʁ K H K | x 8KX 80Kt0 p@ pPx Uʳ 0|K@ | x x Yʣ 0|K@| x P 0K EP6NU>E ;0  ? X \@0##@ K D0SDڴ`@t   1X R02 X t R |PU  @D  RN P Q ! `Mp)90 |K[Tl |D^&`@P|\ K ` X l@K00TPˠ PPD@_\ dKl0KQ d `   PK`P`P ` T``T` H0SP  lP lpP} |L8@~P uTl 0Tl ! K PPlPK```K|` @pPWt K lPK`` @prPG` K ` @`cP8lKT | K  PP%l0K K @pt@  @=PlPK`` K `` @*PY \f  f(KY@ t Rp0S@ |PUx`V@x\5 X%Y#0dQzdKl h uX \P0##@@P Pt@ pP zH^ P`@P ` lK| K T H@TP`@P ` wP )  0 0 0|0X`Wt|^OF|K|p@0qpl T-lPK` K `T`ˠ  @@@`pPiD\`0@X ( tP* |\- ; 0l0KT@S   @F K  oPD`D0O\ʗH^X Y tPpPU |\x^@|K0@孬Ÿ|P 0@$p  l Tl@K0 K ```T`0 [ P`p'P Pl@K00 K P t`PPD`VL`0@X- t^/ |Q2 PU5 lK+T0 !0000 K P`DP0OUH\XY t^pP |Qx R PU\HPH\H^*F!븀X 0 0@ 00T 0崐T*X :帠t" y(r8888&g48\8 8 -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V p!T!& p 0e^0>' K^0> ^0>p 0HF@|T `t9`X rT58T8888 -LMP@` t9q0X@T% T !,"!!!!!V V !t)0L)p 0PPVX`p0 0d9+ Ki!V87 -L9@] \L^_  pH L) 0!"#4 8<0S03948 M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki8 -L@00 TBP0  H p:09X*808 T:t*000 :*(0( :l*8(!""H!!\!!D! -LM  0TV#" -LM) 0TV#" -eL`Pp=< (00p04S80,0d0804p 00 , 0@07< wċ&((0"4#220&$ 04 @ 0i=r:8(8WEV" -P L d&@ ᳌pP` 1TJ x1T) *`{X1T* P1Te/ߔ`010S ` 0 ፐ`P 屒`P0T% |0 00" 0`0 eR@ 0be/孔 iR 0T %40$ ( _q`brdAhdsd edAk~gd" -@L!88#!:P1 zp" @0020p(P00`t4Q!40,@aT@!0   DY400d80@ ' o܆, 4+0<0, 8@ oD :b:: 8 8-#TLL%p`P 0@ޏ ᭋ֏ᮆb 8 8-#L@(NjPPp 0`pP ᓆ0S  0\pᬏ0 pPb -L@,0^"0L00ⴐ - ؀L`p0pMRP$  Q@P P00 `(pPp 0ᦨP,p0X@P00 @ i喩唩b4McbL8qg48T8 -L∩t8 -L₩t8 -L|8800S SP 0Sb -0L -L@\p``h臨# 10 0 P 0W hq88 0-PL@40 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T vP0b 0-d0LP\T 0@ST0 00 @PT0b 0-PL@ PP 0 @ P00S0 0 0b p-1LMQ@P, 0Q( !0Q$ 0Q! @0Q&0CQ*0Q(`K 0)@PP@Kpd0Q \0QP  @,0Q @'B&B"B!B$BB B(B%B -T0LPD00S 4 40àLbwib -X0LPp@0P 40à$ L  bwib -h0LPp 40#D"B ,0S 0P bbwi -$0L0S wi 0-LPL0@S P0 T0  0wi 0-`0L @R PHD0h8 -3 ML -003bؒ )@  0@ (30 "T0@   *3 #T  #0T #0T)3 0 #T0 #T$3SB0 "T0 "T "X3T  #0T@ #0T @ 0 (3A0 "T @ 0 p P @"2 TXP@80PK=@#0@ TTpp! 0 08#800#@DT  0@ (30 "T  0@ 9)#  00 #T0 #Td3S  @ 0 (3 0"T9@0;9=(K #H0T: #0TO>BV -LMRr@` @0 (30"T@ 0 D@@T #$ h3S -PL@p`|1T% 0CT/  08m@4T 01T (1T0/q@4T6@ @6 @& @@P608#8@6 0 R8C@ v6@06a@@Pk@gi 5i 6i( 0-L@iPXX0h -L MԂؒp@  0@ (3B0 "T0  @ #$DR0 0S  0@ (30 "T @ 0 @ , K 1+[[PX35V#5000b00a 0a0 " 2 0 B S 0B 48#( RG`A0SC_0S? B("(+[ 0A1P07"0C220 T00 R 0l× 8 b$\Bb $,K $+K $P $TRK0< ,00 @0@>(KZV8 -@L 0  0 0h&8 -`s4cWDqL`s VP40 ? ,?N/!10CĠ0@F 8Å0C`P  V? ? Op 1l Sh0!1`0 1X0!98P j@8@/jl"V" &"*""8 -OL( (0p !0p!hp"" -L M\38 SԂؒ0 (K@  0@ (30 "T  0@ #$pP :  H4 Rv g 0 0@0@p3S 0@  0@ (30 "T @ 0 % #$pP4 0 #T40  #T #0T #$ 0 #$ #$  #$ #$pPm0 0@0@ "$Pw "$00 @0@P`0 0 B("(@0@R0 9^ !B0R0 0?0`,0 0` (30"T 0` <1T 60C00"T, 0"T, "4"T 0` (30"T 0 B08#8 Q000 ) "$ UP` P`0 0@0@ ~>B p-9@@(  L”`P"0T2"$$00 ”"0Tp#00”"$@060 p-9(@  BP`L"0T•"0T2"$"•0?0S0"T2"$2• @000"TB"0T•"0Tp -LP0 T2 $2@ @$@T# T p• 0oTh h0 ndP@ @0nThnT T$p0@#pp""7# -LG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ 77 4 0 0-8 40<80 (0 $ ,< G-SkM0@   0 0@0@P@P`P`p`p堀p 堠Ԁ$ؠ(,@0 408 <0@0P?UU[ [`00p R0@10XHA0崀0㸠P @h1X100 (H1@,00 0#00 c80`1*dH`n`1lȠppp0P,& #'a0 ` P0eZ@1P1 (@#@0b*,0c̠0 c<00*0$10n010dLp$1'P#1  #P1\0T1@1,0D100(0T1`#D1&@#0nc80`$1dH0(1101(1 &#1` P#T1eZ0X1D1 0H1b*0 *lȠ0(0pX1'a#H1 @# *0l̠c<p`q0(q1andL`p1& #1P'#h1,0Sh1 \U0000 d`X张0 HȠ 0\LĀ8! P `p蠝0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝ-g 4g4%c071s s0<0 0<0,b n1 ^2p* K<0PlD"[0R  =X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0PP0K |K0Ph `@800 j D0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@l(4 K0T0@0TV ^< tD06040H0D 0  H0t0PD@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S"$@DP@ L T pX 9LH PG=8jHt TN8jt0< tZD060<t X@(0T04 K1@P>V UF40H0`1@0P 04 O0tt H y\@ ;pl0PL! !Pl0*0 t04PXP 4h 0K 0Pw T0Sl*7t< PD0\@ 60 < t@PD060pYX 4\@ pQ<4g R0S  0G- M0 v~ L1 pW0@  Ѝ1 PN1a@E1 0LOBd g@  e g  0P n0R @ABA21C 0#!B0 031CdQ ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KP0 D00@PQ -L4M  $0 0<0 @K;   1KB K謐b -L4M0@ $ @K <0 3 K|b 0-L M(0@ P b$p}!0S(0 K0S   00 $ (0!Z(0 I9 J p-0L@`P5 P p{0p0d0p0|000pp0P d0P |000pP pp{0p0d0 |pPd P 0-@LPၐ 0h(8 p-0L4M"`@0Ph ,{P 01`0D #{P <LK( 0P H0 t  Kp8lb 0-L8M @( ,0 xP!0K H 0@ $ K0[S< L@KLK0L@KH0 0H0 b b p-0LS@P p R R`d zP0 <0p`8zP0 S zP 8880 <#<0@0  p-0L@ S Pn"ln"tn"m"n"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"n" "P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ Xz$0V0$0000p8I9LgLg -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\p"tp"p"p"o"p"p"p"Hq"p"p"p"p"p"p"p"q"p"p"p"p"p"p"p"p"p"p"p"p"p"p"p"q"h@`T  z 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㰐 {@` pd@I908LgLg0@- 0P840 W@D 0pPh0 l0S00  H < L @ 8 0,K/;pP,,0D@ uP#0S S S ,P W0,0 dY,P N0,0 < R 0 DD Q0DT0 X  p,P9HQ 4  0[ Yw 9 |30`2p 93u@<P 0P84<  0< 4 P 0P" 4u44 08 40<040  ( 0$ , X00 T00v@L`D    $0 X:($0D` Ph q 0000# Q00000@SQ 8 P@" Nu08 40<0  ( 0$ ,@0 0H\ T0`LQ=, <@ L ,p >H0S5h0,8@ H ,p 4X@@  u@ P @ $ u@0P0  @0 t8@0P@ 0 K0@0p P 0p  *4 0 0C,K0/Pp,0 DPh0h0  ãh h ,=h 0,0 k4g88 8$8c -LM`$@p(KK p 㠞pP$0 `RP K Z 0>pP@0,0 0C(p 0000pP@0S pP  KpT h 0 #40Sp47P $0; 0SP p @0(! P / bp@ZB_RtPZ  vZJtYO Z vZBt Z u p =t ,~y 0PP FTb p- 1LtM1ha<PP0@5PP FKp KPP 0K$P PP 0   B  10h@P0 00, .`bvi5g!c4g(8P8X8 00 , 0^nP`U TE*Ap1 @f0P  00,08 0 (KT-*. A.0P@ @0 0Y 4 00< 0S0c>0a00 , Kw@s@o@d>00n 0, 00 6b@r""," -L M(p`@P K00` p P 0SK -LM@,0  0L+2` 僢 0PP'22 Vp!@!P#*@ @T!*0S P 0P: *p 0PP  X* T*(Kp PK* 0R P0 S, ZlPP -L8M 0 , 3SPp_P10C8S{1 R` (K  0*T 2 2@0 @ T0W`Pc T@ *^P` D` 1S H  85 41, 0 S!   5@@SP 4\/ @,KD 0  `P  \00SR2S(@T`L < 4@ 8@ R JRk 2 S@ `4@ 8@ R`DQ yT@ )V`01 1"RT@P` D` 0 S*wD   D0`P"R @0DS\` S SPQP@ RJ 03R<0S: 0R`*21C   0 @<Hh <  @@@H0SC P V P 0@ c0  4K8K00KP@0 H 0 80 1s_ Q40000b0a1!1i L fP0SY`m PNH !Z 1sF Q40000b0a 1! 1LH@ 0  L 1s0 11s2 D0@10DH\0$1%  .)L H 00" 000, 8D!@ T( `40!140! 1 1S !10>0>0 1!H0 4K 8K00K0 H q `0b8,bgۣe|" -LsMD  LP 1 P 倀 KpP@`V p@ (,00(K(!0opP@(0$ (!0RpP @0(!9h@K 40pPP5[S p0  [ )3[@RL 0PpPc[Vq q ^  0S0!(K. ! 0>00b>01 ! z 0Ll 0 DQ `a S(K1 0   0 !.  . a0 S2Q>222>30300 5V* 0! 1 1 0K基P PDȡ `! 00\ . 0C0b!00`D  ! `\ʼ#[Rc`   1Q5 1 `0R1 S000 40 Q\T  0 c, 0K4K ,0KP\2:00\,%* , b 00b$1#[0,0 ! Q!0Q+*"!B00  000 #[a 0,K p 8, a ! , ۣe|" -LHM8QD1U@$0 p @aV $K 0}P3P  'V w K0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 哓 & v>ꘑg -L@P 81S<@ -L M (18 @ `@ 0SD jP 0PSU *0 S   0 S  R: (K00@ T T@ T T TpH@ Dp  0T0S  Tp p T p@T TT D H 08#8;00 0 40  8 (! 0U  ,',K.,(Z0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P (1 0(1? 0& @< ? l& 14:0@ 8 (10(13 0(!08u<0S P @? %P<? % 0(! 0@  T4 8 j 4 8 ?0(1,0'0R,A'+mP@ 0 00 S S0 S S S H H00H0 0SHD 0, 6 0(!$up80b8g -LP P   %P`pPU X U@1J# Pp *D% p-LM R 0.>0 0` Ȍ. qΌ@P 00 `iKp -LM pR`$K0.>0 0`. 0 @P`0 E`P@(  0P``0 W`P  . . 0`G` -LM @R`@" 0:#:S%0:#:S z'zW P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P K QP P \  ?$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0 %2AC `f 0P  ??$`p p-T1!!1@@Q(!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpR00C>!00 cc!b,"0hLvi0hvi -0LHM,0 0@ L0 T0$ ( TK BP T0 P P $-{ K){@p888 -L8MB 0R<0 0 !H0S 0`0  a 0, (K01 :0 0*@P0 `PUh1PU,Kg0@c 00 0`Cp0K 8@ 0p X/@F 8K 80 PKD KP0 L@ Hp P& P zPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ <` `F<K ۏ(K,z(e{$c{|6g8 ؓb<84gP8d88 -6娖LMh|0QW:z돪\볒닕,ɫN6'] 븍(TP( Q }<6 R0 0$6 00  !!D 0(D  !!` R0@a 0 ,0E00S 00400 4 0S000 0 `0  0  !!$ 0,$  !!0)05 D01f LCQ:4 00<38( 0A R4@4@@ P  kp@P0@0`p @0FP`pP`pX@\Ph@lPp`tps(T@`d*1@@@吻4 @!

AdF#0S @P0So $@JR:@lO0 @ 80 80 80 @J1`V P>U |@K 0 0@PU`V1 1 P>!1 P5 tt1 P, ``1 P# LL1 P 881z P,;$!00D!0HEyyyyyyyyvi8g7-96gGg GgGg|9gIg4gbl80#4g9g$:h5gpyiwi:`"h9g ?gqg8b80!c8 ,0 $ 0,000C0YJP v} g00Qp0 ZP唐 R00 000 Y40j<0 P,00,0  B 00 0 @,00,0  B w<0 ` &pi0Z. 8  <"!B$"}0 j[00SHڈ!43C" cb @KJ84pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R~ 00 g[s a 0#SP ]@ ZMb(8:?BQ -LM0`A8@|ZszJ $3Zu 0S} pP - 00 040PP#(*80QU#PU 0S!0S 0,0 , <0  ,W 00CS 09 p0 U^ 000 4 0(0 L<0@ P'  ,0 :,00,0}  ,0 .,0@ R0,0- l   ,00,0 <PpP @ .4.0QUPU 0^0S1ASpg]P  8p@<0@00 04 0@  PP p   ob0p `0`0`,K@0 @P0` GP 4,=O0, ສb -LMp4 8 @P 8K` yP*840 @10@0!0P,0 P@8 ,K ,zP8 0,0 B0R,0 P8  _yP'00K@ (K4K  QyP`@Z`J,K ,zP0 ,0@T0P,0 ` J 9yP'00K  /yP -L$M"0(0, 0 p`P Xs X `p8m\ (K00 (![`P(0$0! 0@;00@(!09`P1 I (!00 `P0  P(@ 00P,K  `P@P<, 0l0b 0 R@1TA`0P41<  V V (1#200 @S00S 0S V ` P ` 0S* @M00(! 8d[`}V@$1 !S@#@3R0 0!( $0S TgDg(bb -L Md" (1`2 0 X2 JpP (K0  !X DD !0MI?C? 0 P lp hp p d ̟H" 0K L @2 <" #>KB/K %K(q Dr q q 8r 42 L!  pPE<,囓(1\ Tr @PPU \"P , Ru 0 CyT2pP0T2 00@,K`d 0` wpP00KP K(1PQ V[P  Q `" 0P\ H[\+;җL? @ 0  !X DD ! gm$Q0STr \B \BTr  0S 00S  ? 0TST $Q?  (10(1 0,(1 , TPp PU  , R 0 xP00@`d,K 0` wP00KP p}?W{pypw9 R[! 0T"00 00100\00`00!0S00 pZ 01 > !*XH!<`. | H1D!0>0>00a#6l0@! . @10>00a#6 p0t 01%K>0#6x08104! PX"08Xe A4! ֥P= <(Q$dZP  _ \`" 0P\'7L? N  0  !X DD !z?P\ p  P]T@ H 00 L@Kb%K \2$P X"4 vPPXN @ ~" $QMT0S0# X00 CLX2V/6X004@PP1XT40@0!!X0D  D !!XD @ 0!!X0D @ D  !X" 0 !D 0 D  !X2 -` R 0  !X D D !1 0  !X DD !` 0R 0R `t` (0 0 X"`2P 0`00:X"D0 s0@ 0@\d$0@0@0@H4D\kY`"P 0X@,0S %KP d2%K (X@PX"D0  i L ?B X01S/ L R,  S (1 +  1S+0D 0R %K 1X010  !X DD ! HpM X2@[8X21C0 \  q 0R/ 0R+0R(0!!X0D D !!( P' 0  !X D0D !`1`  (001 0`0,A 040 P4  X,J < K4K X@@PX/[8KP%`" 0!8XP'X8 00040@4 00408 40$ 4(00(04  00CS 04 <4 4, <4 *84gbp87@8gb0b 0S$ R(0(0(0 , R$0(0,0$ (0, -L@( :X 00C00Fgb p-L@`y $ R(0P(0(0  ; 44PPdP  *h8X(  X 00C0phHgDgb -P@\LP` pP 0  !D D !@\@ rh0+@ @00$S$0#@0.00hp R 0 0 0 ,h -`Qp0,!L`a ,@T ,0S ,1 r $@T{ DP v~< S# )0SD  $0 0  !$ $ !Y1, 00Sp P KH R )0S$00  !D D !, Y% H.0400 $0  0  !D D ! ,Y.04000S$ P J\" 0 +Pj ,0 Y0>  0S hP UI   @ D8 p-L\M0@ S`  K\0lK`+PP0SQ K sP 0S Q lKP sPKpP 0-@L84P,0S00 0040@4Pw0h*b b 0-LMP~@T  0,@T 0 R404040 V$0  @D0 bO0  !D D !   ) bb8 -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 000!L0S0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $k)W@ $pD0? S=C  !D D !H R   W@$0 3h = \10CS\1N P#000"<^\1S@02#4*\1SD0 | Uy[5, @0S  00 p 0  !D D !b l E~D0 ^$0 \10CS\1(0S.,0Su 0!!D 0 D !!("(> D@ 0!!D 0@ D  ! 0 !D 0 D  ! ( @,r6  YSh0Sh EUh0 @( R 0Tp 00,h|0S  L uPp pP '$ H]Ggh9ghx8l8HgL8 -L  -LM@Q K00  qP u  l@-88 @2 1 0!0 c@mcQ=g -L@ R 0 SLPwPP0Q  ,1S 0S Q 0, R=gGg -`0L RP 0@@<R@P K@P ?gmc-00  0 0\1(000,[3l# 0h!$tvi -0LD @ }ht -L`@tpYRP @G4 JJF(! `0004P40D,10D Q0 D' r 8' 0' ᆒD0< ' D0D<DD@ɌD Ȍ8DD0l R0 0 Pr 860QD0<  DgGg -L$M@ D0 ` #>!S  = S (!<8ğ, R0 0 t ,p  P100S!00400 0Q,0 010Y400S0 00, 0R0$0(0D0$  , @( ,@ 0  , Q\  K8^ 0dd0d 0 d ,00d ,00D R ,0(K=9 =0 D (oPY | 0Q  *vY@ ,*"<0S000000000^P<Q  D0 a R ,0X"Y  0  ,"0&D000  0PH R L0L  !$ $ !    p0x 000) * P0 +  4!000K  @  p0x 000 i 0@)00|0&`c'V/000  !D D !I :bmcb8:bmc80Fg0#1$?g GgGgGgh@B8 -LM  0  K -LM@`0,(  0@ @K=# p-LMP0L S`@Kp0 $K0 $0 0 m@P($  0 @P`@=# p-X`X0@ TL  04PSP0 X@Tp$bD?g p-d0L@`TP p  P $ `P@0piYD?g$b8 @P-00 -QL@M'0S S -$K0`@KA< B D<  0@T   0P P pp0 0C`P@05f@ {WXDPU`V0 0 C?g00, Ã0ʃQ #0@S00'0,y0T0a(K "C W!>0 C6 00 6P@40  04 0P @@@*PP" ,G  Z0 0cC61᱀00@4 0jj00S00#00!P0zW?g8b,b?g?g08 QP3-L@P`p:P ݗU hf  TWT8000 0 h10S 0Svi 0- PL@B0h0 Q0B0R>"00 h R 00CS0 vi -0L,!,M10 `h  P@p0 T  0S (K "@ D 0@0 8pK 0! < 0T@ D00"<0S  i"#1"P vi7 -H0L h  R@0 00P00vi0 Sh1 000vi  0R00  ]0R  T0R0B040S840 -LMbp<0 P @2Pp8 hp (K)0  @3L2`00@p,00  !D D ! `00!@ R00!p  q0 0100V 8.L0+LS,1 000\EgGgDgIg p-0L 0 !@PT`@T 0Sp) @@T P0@0S0`p@T 0S) p,FgDg -L@ 0@T @ T|8 p-1L M`P ```) l1@TdAdQ0S 0C) D1H0 0S 0S 0S LP/`@\ :0S =PP PP@0 , !D D, !Z P A>0U 0U -@tL`(Q [ 0SX 0S 0S 0S PIv 0S 0S 0S P9pP\ ':t@v`t 0S2 @P0 , !D D, !t P xt 0Sv 00Qv 0S tv 0`S -PuL`(A Q 0SN 0S 0S 0S P?v 0S 0S 0S rP/@p@\ 9uPv`u 0S( P@0 , !D D, ! u 0Sv00Qv 0S uv0`S -PuLp(A` W 0ST 0S 0S 0S PEv 0S 0S 0S P5w 0S 0S 0S P%@\ 69uPv`wp@0 , !D D, ! w 0Sv 0S u -PuLp(A` a 0S^ 0S 0S 0S POv 0S 0S 0S P?w 0S 0S 0S P/X@\ 8uPv`w p@0 , !D D, !u P w 0Sv 0S u@- 0p 0^0@p   p0 @  P`t0@P`P`x0@  ɚ;6e -l@L 0 0xpt -L M` @08@ 4P @P@ P@0 , D H0  S0 @ @ H @(K(1( R1! 0O@0 <@  0b 0@P]  0_8H@ K 4X%M 0@PHD0  0IH@DPT 0,@@ K !5 0@P0H  01H0:gʚ;: -L$MSp 0K< KH0K<KHPK`00K(4`@ 0PQ/N`LaD#b $K0K< Kb0(!@0JS~#~#}#}#}#~#$~# 1QE 0S= Z  1 ?Q 00SZP/ Q '$ 0f `. .  像x0 ?l0 d0 0S:0SPP 0` fQ$::Hb@b p-LM@(`KP `P SKp p-(1PLQ \0R00S0D!@TPDA `@`T ?&@Tp00Q \ p p -0LSPp S# S P7Q  hP/ PP @T ` @`TV0S(1 h0 @T `@T 0 R ` 0,Gg0 S-L@- S SP6P D(^)^ 0N00S(1 0 \ )\ 0 RD1^ࠡP P P )D1^ࠡP0,Ggvivi0 , !  ! -@L 0@,ncXJg0 , !  !-|!X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|`Jg -|LX00,X0!00 @dd0$@d@X1 !L00L0g p-0L`P , !$ $@.!V0l 08#801  Pa0S  IP` ph<0STb -1LMhA @0P40 0r4 00` !! ! !P!0CR80 \!X, T1, 80 YQ $0 100  0  !$ $ !L!0 ! 0 , !    ! 1U01 0!10101.P!0R000T1P1X1\14  018  ,0 00  0 (K(KoKviTb -@`Lp P/T`@00 V06p0 0 -L M@1P @8p^@ K?(KP 0 0 0 XPT (`K XPW  0 41$0 SK?"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 AX@PV@ ,pK W@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !|0 Wh)X0@P `0S 000 0@@0ݸpKg4:g -$0`3P0# DLp!0@3PN ~. @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D ,1 R8#8.W0m {@aἸ D  D  !0@3P@R 0  !  !%B D D8#8.0.B0W) ;@!|D  >P  @0@ h0  "! !  "!0 | DMTb<8 -LMpPD`R0 Am Z @ D5 Ay 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss 㚶)0@S Sd S`n ַV (KoB Q005; H0QP  !  !(K0 1 10,0 1,   D1S0D1Dž ,1 R 0,0 0  !  !j$3h!R 0S  RGP RC $  1 P92 (KooY )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)0 60  !$ $ !`12S201Ņl$0 j 1gP0  "! !  "!k00SH0Se $0b  _ 00#!001 00#!Tbvig - L mN i Pp-L`P @T U  D0 V@Tp P-L@uP  h S-pL ,1@T< P,0SD0 h 0S  P X*@TZ# R& EP& @T @T P,0SD0h P X   0,Gg -LPp`P P U 0 R Q 0S U U U  hlP @T0P \ 0S U U U @T U  -@L T` "R"0R = B @PP  0S  PP $0s EP  T r R 0h.p 0h$ b0h@B0$10CS$10007Jg 0-LP 50J/@)0$10Jg 0-00L$!PR @0@0 -L M88 <0@ $J 09KpKg#H8Jg -`L00@P" p* 0@#P1 ^1010  !!!0 ! !!0P1K 1P 0R 10P0Tb -$0L@S ?0D   10 P Q$0 0  !$ $ !L1Q 1$0 v1|1!D iQ 0D   10 P0  !$ $ !!0 , !$ $, !$0 -LMp 00 0K 0 o*PP 4K R`PE,1PPO0HL 1`Q5 0D   10. P +  @0 & W01 B0 !   ! 0 Q` K 0S`(K00 U#V#J 0 ` 0A2004P/1,ȟ@Y P`v0S`PxPBɚ;0ncP8:: -0L@T D0  0!!D 0)D !! 0 1   @T Gg -LM@PDA ~`01X\TPaD0  1! 11  (Ko !0 000 @ 0! 0 , !    ! !00V1 0!10101(KTb p-L`P0S @ T0p @T R0000 0  R0000 0  -pL@` PP W` P 00  00S00@ P0-LPP@@@T: 0P T 01 R0D00=X8 0-LM0PS Q@ R  R 0A@S0@ 80SK` QP  0 B0 00 0@@ 0 @8S0 -pQLPT \Q 0 0CW . \, @ R W`1`!P$0 70S( Q^ 0 f0 0 0pf0@ fW0 @P0S  Q P QviQ -L@M0P@00 ,@ PL #0S c@T0H0 P LP0S (P@PTPHP \ßP  wD#P  p(ß@$3@ß`0 @&"  2@`Vl pAKA ŸR20H g"w;2R(|ŸP Pp2(, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPDz``V! @ 'T0K @ $&P A @0 BC  Dh! E FG@@ ;W$!00`C 00L(KU 0pW L P P`'ᖲ, X 000@8 @0$0(@H,0 P0408@<d0Hp0TP_p`WJbqgrgbbrgl98l8-P  0S 34\^ .PQ0S :P00 (0vi -@LPp`z'T  0R U T  hO  M-PL0 0S R K P O -PLM0  0S R  P  KO  -PL`p @ 0S:PVPR00S P0 @ OP00  h#O -LMP p, 'U`&,0 SR00 SU0 0S @V  |OP00`,  N000V R S  D^OP`@A UOP00l9 -L MP K -L MP K p-PLP`  0S@U@R00S P 0 OP00pp p phN p-PLP`  0S@U@R00S P 0 NP00pp p phhN@-R @ Q\ 0@- 0-LMPR@@ KP0T30%K00 p-LMP PQ`'0@S)#,######X####p#######`#(# ##20S KP 0Kp20S6- 2_2 RxŸ 0`Ÿ 0H2H"@ 0@cFP0 P]2@FP0 PR10S  +10S-10S-10S- 0H P`1`!à0L  P$10S 1 :"~ 0 0b 6s 0 6k 0 e 0^ h0X$ QMgLgbLgbbbhMgMgLgMgrgbbl9bwi -LMQ`@p E 0B@S񟗗#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H##H#H#H#H##H#H#H#H##H##H#H#H##H#H#H#H#H#######H###H##H##H#H#H#H####0BRS #x#\#|#<####\##########t#t####@#|#\#@# #####t#X#X#X###x####\##L#,# #########l# #############h#<####@#<#\####### K 01 0* 0# VP 0R`9`9^ L9R@ #K #(  000QY@x@T0 @A  0&Rx8x8\ d8R 0 Q~V #NK] LP!70S0000 00  00KOrG@ PyPi00CUSPc噌0S^ @_`pd 0!T|밊P7P'ODǟ 0G(ǟ 0{? ǟ 0s7Ɵ 0k/Ɵ 7'F,K , ,P,0 CRS0A 0 - HƟ  6Ɵ 0/ş ş L@ P00R00S 550Bn  #>K0B ,R ( Lş 00ş 0 5  4` 4w 7ğ ğ hğ {LD@ PPr0So /m-k 4d ^C0(K ( b(00Pß L@ P00R00S? l3;`C K, @P0 R- 0S$ŝS 0 ,Q A 0|N͠ 2  2 A 0`Ÿ A 0Ÿ PfϠ 1 0 0 0 t1 \1P 4   0h$~^rgrga0vibwi4:b8:gb<:b;gbb,b7b :KgMgp9gMbgg7$?g g$::gbiMgLgLgLg-g7 b(: ggg!7b,b0b -L@M0PS( `G 0B S@$K!XKI@PX00C S <#4#,#$#######-@\q P (K I@PP( ,@P1( H  a R*+ @ppppppr@P 04d@P!(0 (K0 A `TK0@Q  c8T Q  I@e&bh1#Z%pV&-# 00  RMgH0S RC40, 0100 0 H Mg 0-LM@P Q PK =IP 00 0 I8 I88b -L -Pl`LhA @ pሩH4< 010dp`Hl`  @@viMg -`L PnF4 01pPU H0@S  PUi蟪T0H00000 0PE ) RMg -U0L0 u 0@T `@T <0S`<0V<0V0 004nc 0-@L H0PS )0S 80  !$ $ !0h@ p-@0PLhQ`p`P PQ 0D   10 P  @00  ``p `pvi 0-0QhALP! 0  !$ $ ! H0S H0S0 )0 0P HP0Q D0  10 vi -\ Lh$0K 0  !$ $ !#L viQ0hL vi 0-Q0  S  0RLPhAQ 1| D0噩0  !$ $ !0q0 0) 0vvi p-LM`\P0 R '0@jhKp(@K0 LPP00U00Sb~gb -LMD `X@ p@ V0<0 B 8 K@@P08KTe Q MPJ R @<@P#@(K00@TP c ZQx!0p!O SA,J`sZ@D <@<@PP ,K 'GP,0S@ D 0<0 D <0S xD0< 0 GpD 0@@<0U 00R  0@k y::4nc28 -L M0@SpP (`K FP K`G -LM0@K`Po 2Hp0 @ Nt3WP K] 0T0; DPKPPpK8P4V4[Oj8K}D @0 <0S uD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0  L @P=0?B -L MZ  4K 00Jn `p04` 0p n P, #4K  @PX 'P (K4K L@PXP400,0%"O04@`00@=)@ -40 0@ , Qg@B -LM@pTP $`K0P K @0PU0 0P$@K @0P0 p-L M`U $@K f q@PV   i@Kp: -LKp p- L M0@R`e)Kp" $K 0 R0$KT Q  R  Q hI)ڛP 80QU 0R  Qg\8Lg8 p-L M00`P%T ,K =P U  K =PT $08K#!B !,0K0 80 4@ PU  0KKp`: 0-L M@zP K0 PK =P0Sk$0$ 00:   RqgQg00  p-4L,b\I  000cSoSb SA400!!Ń1у10000 0bSG SA400¤!դ!Ń1у100000cS- SA400h!h!Ń1у1000 0 bR RC400$!$!Ń1у100\ph蹟RC80#< Ń1у100SA80!< ո Ń1у100SA80!< Ռ Ń1у100SA80!<` ` Ń1у1000 P000@償咟t8bqg8:gQgYgagig 0-L⅟Ÿ  01 0S Q Q0!01 0 P01   0]C401 0S  0C40!0C401 0 P0C401   B4:B801 0S  0C80!0C8010 P0C801   B8"<1 0S  0!010 P01   @@T@08b8:gQgqgYg 0-@LH0 P 0$0P0000ў08b 0-PL@ڞ0 0@  @  c0cS@  t0  @0PP@婞080  0 PP圞@08b8:gqg -00@ ALhh: - 0@Lhh: p-P0LϠ\ @?i Rphp:@-,0 2Ts: -p 0tLQl0Rh\0`P/ 1./@ Ribq@B:: -0@ LAp+hX0`P/ 1./@ Rh;q:: -p0@Lp hX0`P/ 1./@ Rhq::00  p-0P@L@p`0@ 0R0000$0 0@ Ὕp -LM`Ppĝ @T  0 @T0S ᝝ R000$0 0 00 @冝T 8 -0Lp@P `ႝ0 00 $  $0@$@b[ p-`PLe@T00H 0v@ST Q:ph8T  X&0( ph{4% CRQ$88 p-LMP@% R00xh R d&0 S ` @0 0S( xh<8$8 -Lp( `mPP @Pp ` @@Μ 0 @$0 $ -@Lh$Dblb -LMx`hQ@pp'!$ $p p'!`F0!!$ 0 $ !!vi -LM 0P A0pK 0h , !$ $, !@0pK `P $(0  M `P@w0@C@_ 0 X0h , !$ $, !T f|#vi$ -Ltn -L@P @0D! 0 |0S0# Q!|D0S 000vig$ui p-0l @1P0Q0@L@00APl0 0CSl0 kl00CSl0 eP@phSi 0-@L ә@0P0$S$0#@011S1ԅ1ą0h  -L MPrhax0,Kf,@K0T_ Q0X00S $ 0T cR, ( $ m0!,0K\0@! l(QTI 0T30  D0 , ! @, !V0)0 000E 00| KP0U $0S00S0T0@ SS0%@k) ,, ( $ viɚ;6e0vih$ui 0-`0PLhQ 1 1) @j|000H0hQ$vi@8 0-D0L hA1 P1) 000/0h8vi -d1d!`0VムT1L`L1@T: \ 0C  !L !!O0)0r|l0S|0 S|(l D0!R 55030505l8vig$ui0 0qgqg 000qg 0S0b0 , !, , ! Q-L@0Q0P (0@ @-0@ , !, A,, !Q  0 @ -@LTP`p" p@T $0SV V$pW V V V $0S 0 @TUWpO"I"8x8 p- 0L@P`~0S @p@p p-L@[PaT`p04L P PU ph0 U PV php 0-(@L0P00(0P(@000C0 Rqg -pL@`TU@ 0P$ RU00000  UU@qg 0-$0LS@P  P 80@ P0  00h g"e"qg88 -LM0bP,0S 2 l0S0C0Ę 0P 0S P bĘ00S0|K x婘 -h!0S@ @ @0S W0Q4 Q0(0BS0A0 R 000  0  01 Q0S  1S R 00000 R008!Q !qgb 8:qgH88 p-d`@ L0P0 P $0SRP0 Ppqg -LM0p@/P`a PP` 0 0( @0S* 000l! PJ$p @RTR 0pP> T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ!K  8*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , 48A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 d ]#48 0- LRP00 @M @T0@B0  00hQ -LMAPU^, p`C ZQ  ,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00 _ Q 0Z0 0    $P ,0@p @Z  Է@tncp8rg0 -S0  R 0 Q R0S0 S0000 00Sa0 P00rg@-@ 00bO 0$@P p-0L0M@`T9P 00 08 4   0K @0 ( < 0  , $` $ 0 @ KK 0P0CS 0 Kpớrg -L@L R 00CS 0 $0$ 壛rgrgrg -@L ׃4 R00 0S00hrg -1Ls@ 000 <00 @0巃 00@Ȩbrgrg p-1LMQPM x1Q! p1Q h1Q` `x 1Q, D1Q<1`  x0 `00(00  xܻ`P0 KQ`P@ R 00CS 0 00` d0 @a঄T0` @@xPL H 00``0000x}flvt~fwt@rgrgrg -l0L RX@0 D 800000 )0rgsgrg p- L@`A@P <0 S QpJ@prgsg -1L @P`p\ 0+`P )% 000^  S 0El@Q@1@!T `P0Q 0Q`#`rgrg|8 - L UP 00  0 0rga0? Qp-L@`0 PAR  x0 0 PR0 R H0 p 0S0SU RUrga0rg0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P((0S005:SPP( (0Q 0#03SP P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S00  -(0@S0(0 L 0x R P~, RQ000(0 0 , R 0S~00CS0,Q R000 00 ,Q 0-L8MP@~xP\00M 000$0  R00# 00$0$@ QA$J Q L0 80C PL0 @T d14 \1 `REx~@~Ap~K00001Q 004 0$00  03lLK$@ P# (0X 0T:d Q00000$00$ $$/~ d  8:g:8`78 0-L M 0@02P 00#^ 0#^002(Ax0S K0,K0hKd (0Px sg8T7 p-LMP0 K 0  }@T < 40`R00 V @@ @ <04 S`H0@ 00bS*} P R0000  0 PKp -4L␰,0@T  @Th蘰bبb p-`PL@}00  0@@Yph} 0-PL[ 00CQ0! QU  0Sp_@T |}Md}>@T0 0S 0 00 0S0bsgبb 0-@hLPD}0h@} -L MR0  04 0  80 0 00BQ0-G800S@ 8 0Sʠ0l,0 < G< 0f8S8pLpZpj < 0< 0 0 $80,, @\ 40@d08 0` 000 P00WX 0@@ @(@<@0@4@xpH@L@|@@@l@ 00fp0F th @@@@@@@\Q||,0^@0# 4140嚯,000T0 R> !0S 0 00000(Ko蚯8pL < F< 80R D Zʠ Z \l 0l8 ,0 d\ \0 8 l, \8 :Cʠ8 ,0 V,, sg8bsgبbsg`8bbbh87- \ 0Q|  @ 0sg -L MtptP`@F ` 0 04l`V pPKxncsg88 0P \|  @ 0tsg -1pPP0 ` U00SL@ 00S@P`0U00PWP$A WW V 0 RU h0\0 R P0` PV  0U00~gb brgrg -RL\M !|  x pL L p h PP p%PP00mPu `0  @p d0 \ X0 l pp l 0AZS_4$$$X$$$$$$$p$$$$$$\$t$t$t$t$t$t$t$t$t$$$$$$$$$$$d$$$$$$$$$$$4$$$$$$P$$$$$$$$$$$$$ܢ$$p$$$$$p$$$$$L$@$ȣ$X$$p$d$\$$$$$$p0Z0p0  L@W00 S} | z(K>| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x `pM\`Ph@ X0U  ST  T d@TT dt `T @bTZ L W00 S 00 |  @DTXQ Z  L W00 SX@@ |0  tP @eTZ LW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh TP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) P `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ 3P h \0PbU\PT T őd0 m H D  `  0S S S`D@H0?K0(@+@?D Ru Zg L W00 S  | i @0P? K@h TP ?0K\pd @ d 0d ǟ@xX P` P d @l ]d\ǟ P bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAL@W00 S |  hh PU):h0Z| `T @bT:Z L W00 S000 |  @D0| @D%0| @Dd ` T0@cTZ L W00 S 00 |  @DTP | @Dd Z[ LW00 SF |  X| V U) Kh %(0Kh0 P  %2h >&BbP`h (0Kb1(@K 0gF0 0dXFQP` @Dh@ h (K00b0 P0@P`@]000L0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@H0 D@ 0 H D }|  @xQ pH0D@0w `Pj  P@ l@2A \@QHK<@00` !0@0^S!0@0^S^<,Z9 LW00 S |   !0@0^SL@W00 S |  !0@0^SZ| h7PT \P?T0 D@H0?K @I| DH0?K =^ Z LW00 S>00 | {p 0?@\0 p 8888888 -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TPkw 0P40@ R Kw8Fw8b~g --LMPNw 0 e,0@ R ,wKb~g -@LȾ9 -L-9 --LM 0 7 K --\0LMh!D0 ,1 Q @@ ,1  0@Kvi 0-LM@< +PK0@ U+[P @ P> K0Y9 -p-LM `t 0@PP Pu00 R0PP QKprg -p-LM@ `tP 0@@ @u,0 R0@@ ,Kprg 8 --xpLM0PSd0 P `AO L&P 8 ,@ 0@L~gb8TX9nc -@0 L( 00CS 8b$8 -LM  0@8@-0R0S  c1 #880S$H*$$$$$4QT"(1 T0`!10 0 0c0C1 0S/0cd0Z:h0h0h0h0 @dB"Pp0 Lw@@r8o(b:,b::8:88$8888D8 -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,*Y h00T 0 SW@@A(b4b: :P8 p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S xh808 -LM R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`0 08#h(0BHT1P0  8P#800 08#h(0BHT0 8CHt Qs (K,`KNPs da0bȀ:088 -43LM `R#SP3 P8CxnTNT ?Q@;yTYTYTyTw (K(Ko.8C nTNT t$Q@h yTYTYTyTc@"2Q @P' Q 0S$ PZ` P0 s 08s 0pBP] q@,p  0@ |!0 8s hqPC v08s@mZ0$ - (Koc(KocxX@aA00c10J0 0c10 B(KokP 0, GP00 00, "L(Ko(b,b:8TX98: :Ȁ:8888:8:88 -L8cY(Cx02B  $"0`S/ @P 0PS( 0P0  gPW WV W0S (B(00R0S {Pc0ISFT$H$<$,$PQ0SD@0@S 9PWc0IS$$$$cY0   0@00/|00SS P@~4b:::8,bP8 -LM`p(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 P,00aZ<f 0$8Ԃg(b808:,8 -L0MȠLK8 LȠ`CxT #3 Q W ß0SأP @$0 @S P0  i$0PPS @U ,PKpa 0Pl,@t H# T0(i PKtKX,0sq aT,",p RP 2"PP@ PE U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0sP0  P0S S0WpT(KH@,@U0S @P 0S 0EP0  P0S S0UP p0@S 0S 0&P0  P0S S1pTA(b,b:88:::x:8D8d8 -LM0 S SPpp0 S S P S S S S  ` S S `0 S SP`0S @@0S P ?P@0S@ T T`` TPz1 0 L B*R񟗾h$$$$$$$$$$$$$$$$$$$$$$$$$T$$$$$$$$ $$$$$ $$$8$$`$0 S0` 0$KT ,KP, 40 T ,K& K(0K@P,"[2[A0@ T ,KPr,  RR@@ Ry840 Ti ,`K@P,K0@ Ta ,`K@P,d 0@ TS ,`Ky@P,e 0@ TA ,`Kd@P,@0@ 000 T*0@ q-=000 T?C e000 ~Ÿ"00s03S0W000 pR000 kT0@ fH000 aC0@ ]?0@ Y`|90@ Sp50@ Od10@ KZ000 F,`KP0S ,0A0 0B0 RS 0B0 RS Rt R R R P,00& K(0K@Pf"[2[,s0@ @P,0@ @P#, 0@ & K(0K@Pc"[2[,Q0@ & K(0K@Pve"[2[,A0@ & K(0K@Pfd"[2[,10@ Hb88b$b:8b8c98808T8l8@8088 -LHtM<(4aP(P gMh88~g8N- 21C8b 32Cbd0 $\H0 \<0 | (0("404 Xbbdb-0 $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ TbbdbE -LP@p`V `P@ 8 P -LMR,0 pP ' `0S` VP 0 S00ű@P 0 0 00 0 00CS 0᷀,0 -LXM`<ğ(@0P!Pt x0 :R`Kl  0P `Kl  !tlp YPh Z 0l 10 R0x Rd p 4Kx0, H#40KpQd 1e0@p6d P $| "0P  !$ @$ !0l W0SLxQ$ 4K4KQk X0d 00S;,0d Wc\@ < 8 h<0S\"43C" cb Qh$0@@ 0S i0  !| @ !F|! 0xh xihQ 0  !| @ !h#Q q1 Qt lh 0lS p uh(KW0R,0dP00ӑ@ 0R@K}0x @ @ < 8 h tlPh 0l h S$:ɚ;g:d8gQʚ; -LM0@S`p 0PK QP K~P P $PK @P0p -LMpw0 WX0_BSeo1ǏF$8pW4P 0` 40K, P(KMb@B 0-,PLP@ PP0hP H 0R0000g 0-@LP2 08#ȠM0PP0( SgH 0@R" $0@ 0  !$ @$ !0hh`` 0 00D $0PP00)0S Ugg -L M< @ D H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!h~PP . 0,0  0 P  <040 !<0 0! ! 00CS 0~ Z,0  ^, 0 <0 (K茎7 -QL`MPt x |0 @c0t P0BZt [X@K L0KHKDK@ T`KPpK`0 d h x R   @P|0SU  @PO 0  !$ @$ !t@ #T Tx0S ` xP@ |\ d  nP@P h eP@ Y ! B 㸙(K  0q 0 0h X K ` p`0 d \  @PP\ `p 4KU40K , `"pQ\ 13e8\0 \0@`6̌p\ P Q l (20p0 0  !$ @$ ! ` t0@Pd0S` R% 4K4KVI W0B 00SO,0\ Vc\@ < 8 F<0S:8!43C" cbl e$0@ p 0S f@F0  !$ @$ !F l0d@fT V0W,0\\00ӳ@ P0R@Kzl 04 @ @ < 8 ɚ;g:l8gQʚ; -L M0@S`p 0PK P KPP $PK PA p -L(M0@S`p 4PK P KP,04K#!B ( $ ! (K p^ -LlM@Qp1 0 P  T  Tf 00CS 0 | (KT 0PK0  P< 0TpHP D@ 0 4 ,0 8 p8p 0S4W10p8p 0S+W) RP0  H KP80c,P`pǏP D0`0@,P0`D0H@00S  80W pP EP #P -LM`@Pp|P 0 K 0 0 0P p[ -LMpP`{@P 0 K $0 ( 0 0 0@(0KP@ 6 -LM@{PPB 0? `fgfff-\  )0h SS\0  ggR  Rx0x0'' Q Qx0x088 RAF -0@(L 0 0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qgg p-QLM@`@00CS4%l%x%%%000 P埬@Kp-@l0d0\0KL0 20< @ ׏gg؃ggg 0->L@ 0PT;:h0h0h a(h ]Hh YD00 8 P0$0 0PA0gg% 0-LP 0NP.8CR0 -@L`^\VpH h10RUV hp t0`0t00˳H0U h10 XH >] :]vi:8 0-@L[t0P0t00h&] p-LM@[P`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP \xTb p-`@Lp 40l#"B P[H L00bO 0$@H >RPP\p1P91pb 0-@@Lp 40#T"B Pk[ R00 0S000h\0b 0-@@Lp 40#T"B PI[ R00 0S000h\0b 4 0p-#Lp"B @`!r r p<0P<0@`[00@b\p0P<0blb\b -LDMP(K|3 "  1ˌ\3ŠT"10A0 0c0S |P @T ,K`P@T 0KU P 0 ,0R:, `@PTD0l<0<K 0H K,P4x2x0S40 <0K 0@P<0 8@ 4 @020S@0 mQv )0h SSp, Q )0h SS\0 L P ,0R:h0p,0 Q)0S㔡 S㌡ d1Z31C0!02d4@8!;5@><Ϡ.,0@lEnb <@K00H@K0 @P` ]JP0 z0 ,0Rvg:D0dqP,0R:$0 hH0K 0@H0 D@ @ P5D18-SiQ8@KLɚ;@88(8k_k08888 -@Lt0 | 㙤h -.H0LS@ t0h0t0H⯰⫰ -t0L@@ 0  P HZPt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HPT#0?0S %H%D%<%,%H%%0r8#(.a0HS H0 `0HSs%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%\%%%%% 0 .0Pc0>SYpH z P``0O0@d  d Z>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hr Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHP PH>SB >g7T9 p-LP@Xt0`   U rYp0 Yp 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP fX(`$pK @P $ @P` @P $ @Pt0:t0Y0>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CRWt0 :t0>%`(pKⰎ >~ PP ( N PP0t 5*0t X.8C8Ac Q.PPQJPUZ7d8 -LM0pP,2 8" `4r 0r Wt @0  82 $ 4C0 X02S  X#0h, R  VR 0H0S8V` V(ڠ#?0@ @V; 0>H u .` D. 0O0@d P d `l pgʨ0H0X VRӋ 0}H0X!WH0@X82t0"0t02HNAP=0`FpH0XWH0@XCXk R`1l#K ᲥP0 T42S042 0S 10S  p0R>SV0B@Q Q QkVtH0CD ` |0P] 0Z @X00!T 1FQ0S:  B  1@vP0  4  42S K0(K   W 42 S ,2R#  0" W002 W #002 4K  002 ;.t0.\4phWp0t#40#"Bp0t HQHP 2 (/ Q HP( b Q-L@ t00t0t0 0t0 0) P P  -Lt@  0R'0 t0! 0)P P ۞xQ  p0̌#40#"BH0t 0t0 hLjgg -| @0S00L>0 Q>|  00CS0 ttb\Eg -`pLpE0 㨀&U@hV  0@D  D 9@P ✠% !,t 00S t PWP|@$ k 20P=d t {RyW  b @h0(PTh ?R](0Sڜ0  P HD Pt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X*| t p 0@$  $ h0 t@0  th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   t@(0 h0S&  .H0SOtp  0S 0SWt W W@ p p(0 S|PPrPY T 0S 0S 0S >08#8S>>>t  ^50SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi &W X?0|S W 050;,(0 0S050,| tWtW   ^tɌt z Tx 0>(ExW 0S &+tWW9 tl 0W+tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S mtt/! W   st}\Wˌtx6op0̌#40#"B0t )W}p ^W~p  R @0S?&| =zgg؃g7b p-LM4`K@P0t2Ɍ0tXPt09t0Kp -4LMh1p40 0P00 < @ 8p ,p 㨠tR@ZS0 , 0S\ gR@v0$($?Aas P0S Ph8 R , R,0 8 0]t 0  @0#P30#pxS8\ 8 0#p  0S00SW#W00m㨠pR@ kYS0 , 0SD |0P 00!4  1@@0S  ㄜ"2@pPv =(0S(¡.S` Z@P%0T; 0TT X<pP<0S X` T 0T 0T 0T  T` Qh1@/ b\*R8 R ۴8 (KT =  S| (V  !1YpP 0PCʠ#W  ] 0%>0S8\,  8 u8Ḵ80S, ~8寴0pR#ppRpvi:gfff0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0qc-H0P R 00c!0R#<0qc p-@L)M`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@ENp 0-@LPL0S US 0S\ a aR QPb0bU00S0 00hN000 0 -@L`Lp^P V  0 PbU0PbM 0 b PP 0eS0 1S00PS0eS0 0PSM p-@LL0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0Mp -PL`PLV@.Q@*pQ% 0S a0 aR@@  . P 0ax0 0S00`dd0Vp@hQ  ^M -@LP 2> qP 0SB%0 S B! >`000 p-@`LP >V`0 0 0P  pUB> | -pQLP@p1K Q( Q* `0Q! 0P ` `0RPP Z`P  0a 0 0S 00pe 0WL R 0   p-LP@K `R4 R0S) 0 0 0P \  a 0 10 0 P000  0Lp0 #0 00  V0Lp -LMp=K0S" 0S 0R wLp$K@@KP@K $KmZL00h! D0 ,1 P ZviD0 ,1 0S Z p-LM`PD , @T Q Q0 S 0  !D D !Kp`kZat -Pp LD0` ,1 @T  /\ 0@Z `g[` -Pp LD0` ,1 @T   \ 0 Z `E[` p- PD0L` ,1 @T  [0 Y `$[p`p80 P0S0SPg -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUg p-`0LP`U @ T*$04@S  RPUphsg p-`0LP`U @ T*(04@S  RPU}phVg -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Kmw 0-0 L 0P0S@ T* 04@S  RPUt t0pS00d0 \0 PLL L(召00h苬gܴbbbȬbgqcY%ggqcHZ%( ,0 S!0Rgg@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  T0S   D00ccD 0b1  T0S  0  b D P0 0c00000 S 000-^ 0S   00 Q 0 S00 00C0 -L@ -L M@04KT` pU@ P P@p P U@0S 0, 40b0(K00꘏7 p-L`@PDJ @*Jp 0-LP6J @J0 0-PL@)J 0l0hJ 0-LPJ @J0 -T0LP@ ` JTT X HX X0TI1 01$IDPL H1 01b 0-1!@T 0 QLP!TT@T0XX@0$IT0T0T@T0XPX@0hIb 0-@LPI P0 -LpP`A @A1 00100 +P1D001 D㙼㖼PD哼 D0-00@1L0 Z0@0 -QLM`  p$R KtPP VU 0 @@cV@1 `d0 0 VpP  8888 0-@LMI100!p B!1I1P  %@t0U1U1:11b g(g 0-L@P@0SU 0  00 0PP 1  T0S2 0S P00 P-L P p-@LPH 0R* ?H`p`000HVpBPp 0-@LPH 0R* H0000H0P 0-LPD@P 8H4 1 01HQ0h0(gb g -@LP,T`p UPP 1P 01DP,0P P0H L`X@T@W@ s@pP @hg% p-@LP`. PP>  R'000 0P1  *1! D D⾻1! 0D !X@T@1 0 1 p0 17pD 囻7p P 0-LP\T P@ L@HD 1001G0 Q 1000(gb g -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - DD0  0 P0 pP  P'00h00,0 Z  0j0   0   P@/,0p0p -LϠMϜp0 {Q10 K0 c`Pp W0,0 ,@KaDD0@000`00W  pl 000 S0`00 WEVA @(PP> Z& 00 0bW1! & 0S  ; RW1! 0  00b\! 0 吺  EPd0Wp00 W,(K,ge cʚ;,888 -LMk -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0PP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8W 0 0g 0 1000GP% 1 Q PQA @@AQPQ100D00 0g0 `` p7`P8 -L@P   -L@LPLpL[n <0"@ T0hg(:b(g -@ ML 0@0< 0@`夠p夀P0@ @#5 F 0{m0PU`$Kml8(g8,:t8gg4qc̫b0:|8 -PLMp, [ ,  0Q`&,` P`U0@TpcP @P0V U1R  W P P@U`0X#@gT@!  0X PU X`p0S P P0gX@cTPP P, 1 0Y7pP XPp 0 1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $s qm j8888 -RLMp`@0,0 0PP V@`;,K⼠,0S PP3 젠 jR",0S W gpZ @1@! @`d <VPx0Z0 c; 1,, 1:1,謌g -1L`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4p`X  `V00S 0 X@1@! ҷ d 00dS 0000 X  V00SR``  pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc`0 o100 2022RP0S0SP00 -LQ@ 00Q02谌g - LR0@0 0S008 R0 0 R8#82谌g 0-@QLP 4T R(P P@00밌g8 0-@ LPP 0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , KK@P P P T0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VgXg 0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0, \ 0 0f 0 00 M 00 0{00P0@,0 0 .1k @PP  P0 XU( ,0S 00S VU 0S:0f 00,   00f 0@,P V0 1e 00 00 0? s@D8 -40MLh @   0Kvi0S R$  0S$ 0-80$P @P @$P0  191# 0#R 00 40Q h0 ?SRP@-8 $3O 0$@P 0-80@L$P? R00 0S000S<0<0hA 0-80@L$P?| R0|0 0S00|0S8080h@ 0-!80r@L$ r 0P0P<0?,  3,@03@00PP00<0<0bb b 0-LM@?0P9@ %@ 80 h 0@@K0vi p-LMP@b?@0`h 0 @@Kpvi -LM0@P`-@ K@?0p 0  8@|@P,0Ph!  0@vi -LM0@P`-P K?0 hP0p PP 0S000VH 0V`< 0V0039@6@ `vi,b0b -LM`P@> p0 @@K -@L<@ D0ωxhY -,LM^P` 0S \  0 (K*0 V 0f Vc ?V` V] l*x2V"0CVA `4pK⶜ `~@2 P 0O 40 0@ 2 ,0 1V\ U0V= 0V 0 R] 5- V @V V 0 0000CV 0V 0Vh 0  V  V0 00 0 0 X 0 0Sy  Rv  Rs \p 0 f3 003 0 V Vm 00 09M $坳:: -LMXp`40 P" 0S \ 40K0 0 @$Kd3RO R} R  R  R *@U  R8  R R_ U@R R RUT 0S%0 R00 0000 0S \ 40K0 0 @S5 0S00S S0@82hu@P Rk2R 0S  R  R \ 40K 00 @R R R@S 0S0 R-@U 0S0*B BQ@@R񟗛%Ќ%%%X0Th@h00T@00 \MP 7@c0CPP@u 7@SPP\@m 7@KU 0 S0@K ᭲QP!@<00V X VU@1vi!j -P@Ld 0S   -LV7'#77 0<%47#vig0 000R33    00330(0 (, 0 Q 0\  0\30C3(Q,0,0,00(, 000 30C3Q P0 \540 R 0 Q0004b0@-0PPL@ 1NT: PL31CPhP%: 2T0TD P0L20P000P00gQ(glqc P-LP 7 -LQ@ 00 0  c 1SS 00b00,C 1P00c0P0S 0$0 0 -L P U`|oppP U; !1@ @  , 0 PTp8 p-@LP`P`UP? QA0Pa0a0!RR 00b00,C 1P00c0-UP` R$ p1SS 00b00,C 1P00c0P 0S ` R 0S$ pV ` 0e  000e0!RR00e08 -0LS@ 0S -L@000 -PL@`pP 7PP 7h0 S0h00pS;0S\` p-`RL@PR 0RU  0 R 0 `0aR R4P0S2  0 1SS 0001P00S 0 00!RR 0001P000$0S`` $`pp8 -@QLPpc 1 `0VXR 0SZ !1RK WR 1 V&@ @ 0p00!RR 0000!P000!0 !@TX+ W0 101V!1R0 ϩ 00 0 0  1SS0 00$0S0$0@@W 0iھ8Q-Q  1S. S' 000!RR 0000, 1P00000 0R$0Q ! !101 TQ RQ 000!RR 0000, 1P000$0S$0Q0 ! !101 # -L @0$0Q$ R 10S $ p-LP@|3`(4 040 40 p< phr~ 040 -L@8! Ƞ8 0,Ƞ @FP 038400@40 3F80 00J000D -0@0>L068h7 -0@080L06Չ)h( -L MP L32C0bC^ (K#0 0Rx lP 0@0 a@ 3SOja4C,Dya0P<- 00CS 0 #D3SP0 0F6!PP <- 00CS 0 904 0005 5#03P<}- 00CS 08a6㵂 PPN |EM, 0080, 00,0! ,0@$PD PP00R00S(U `4C,.Da@* #P5P,08 K0, (00(0, 00CS 0 40 000@P,C p 8b~f(8 -LM 9@0 @K -LMP0  ʠ K p-LM`@ KPP x0$z P 00CS 0UCx p-LM`@ KPP Kp K0PP   00CS 04C0 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP %P( 0S0 0  (0(`gP 0  0C0 00C0AC\g - L RhrR@0T0  (0 ( @T@T ( f  ( 00C0( 0 S( J @T@T1& 0 _ `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WPB@TPZ& ^00$Q d0 R0 l D(@ Q 0Q@Pg;g`g;gȬb%P 0S  0 8b -L M`4 0PS |2R P(K Q 00\D2D @2 A0!/@!b0SP0p1`l ] @; 1_ ` ԟ ]  @l~@T 0X0 Q 0 0@Cp0PK 0sE 0sB 0SSC , p 0X0 0,@D000  1  ᝟04eA\,K , ` PW,pK†@ ቟, `F 0V0C 0,00C0  B rPp 4]7Pj` PPe`P$:\ggfff -LM8 040 2 P Ah 0@!q#W< t 0]0 40 0S Wt4@PW P0@S$0S S  :Pz W ,s^WY40@P`0 <0 `P!  000W@M DP, @VJ0 1P5@@TZ,0S(PK ,X^,>^U @0@0"W,H^0 R  \(K40, "^W (P0 0(P00 ,^A 0Ȟ4  @@80P @X, 0 W B A ,]P {BPvi\g00S SPP -@LT 000S S S 00h0S00 S  R  R 0S00  000 Z08 0-@LP0S 00iD 0h\0 -@ 0LR )  0S S S4-00@8 -LLMp0PS/@ (K iQ0@0̗jQ@h P 0D H0 D 0 BpKp@ h0 l @P @P\`0S&@ !@(!07@PTX 0R)@ 0 / 0=@P  t P  0(1  $ (1 ( 0 ,  0, t $0$ t0 `@ʚ; 0- LR@ 0T00#0S 63P0PP80 R  E[0h0h?[\g -LM0S@80C hR3PU/P,jhP`* j0p 0 \ 0 lK00@0 l0CdP DP h0 l < 3PPX@T TDK 8TP C!"0P$KP"@K 00 0 ˠˠTXKD K 6PPX0pT0(1  $ (1 (0,@ ,@"8 -0LS@ X0S0S S Slh0h LP D ZP @8/$0$ 97P8HbLbPbTb - QL@p`5 PXP Q00S0v03Q0SQ<t%d%L%%4%%%%|%D%0%,%%%%%%%,%% 0S -X )Z & r- 0Sr et P V8_TPE PC 00 0 3@P  80@ 0$@80<@,00@( @ 4 00 @5U80(B8Sf S7 S5 l"0S( S S Lxv R P00T0P 4 `0 a00400P 0l 0jZPU0p 0"PI UPIRN P`40 0c c 040 P0 b0b0 PXP0=0Y0( %W 0S80 P@QP 0P7WPXP0Y0P90 PP P, t8Tgl8d8\88b,,,,0   gggdg 0P0P 0gg g0dg-00, C6pǏ,0( 0S@ 00S@0@`0P` PU`0@`0d@P`` R$0$0$00 $0 ,0,( (0S@ggxgdggg g -0`VpL, 0V#\- 00C6OPU`` P$0$0$00 $ ,0 5,0, 0$ 0, 0$0 0 0`U0U0װxgg8 -00, C6LpPo,0 ,05,0蠀0@0P`P`0 0 $ 0p<LP``0 0@`0d@P`xggg ggdg -L$$rPmPggg g 0-@L$,0P 0P |,0  &,0  ,0<,00,0  <P08 -LM`@P$Kp<H@ DP N@P ,0 @%K,0,00,0|,0,00,0u,00,05 -L M!0 C6B6cO`p`VpࠁQ 000S @d _,0_0AS00L1P&O0d PO(qP03! 00a&0S0@00R 5 .0@W R00C10/0 @L Kd 00?2c, dS0d00bhb4:8:g ggtg8fff$glggpgQ 0-LQ0D0 P 0@:P 0 0h[xg$g p-@L#,0` ,0;,0,0 A 0S `10S,0,00,0P <,0   0S10S 0 @_Q t0S'0 0gzph$0S*,08,0Zzf,0:0,0@,0 ,08,0Iz00Dzp0Sgggpgxg 0-,0L PL,0\<P,0~60S 10S,0 *   ,0  ,0  ,0 # 0 0@ 0$@,0@ ,0 0hV,08,00hy,0@0,0|0,08,0(0 0@(0,@Ǯgxg8 -P2Lh!H2 #p8WD Y 2 0PoPVif ?pP2 1 0PoPV30 2Q:$,0 :0S ,0 x!0S  P2D4!0*" pP !0S: !0zUt0SY00S0p R"꧉,07,0"mKUt0Sʒ40p R4 0S 00Iyvigxglggggg8 0-,0LP @0#4 R21C 0Q ,  , ,0<,00hv,00,0c"@<#$ h0000hTb8bvi - LRpd 0ST0(, P00S $0@OQ XB x0 0@x0|@(P `00 0@004@ $ ,@,0<0,0"P0h  0H  H R#,08,0L3\P5X@ @h0 0@h0l@b@,0xgvi -HpL0PS` 0@4@ R @,0 ,0;,0H` R *U,0 h,08,0hnx -1L P@@!0@ Dp@ `P 0 @_R 0 P0OT Cx m"p0 R0S< [kSt0S0p R gpg8:xglgg -SLM<0 0 8 4 @Z! , ʢ`P C0P@0 @P< p4 00S 8KP8 K t x0l p0000<P@ PR00 3`< P,e"(K!2帢 , Po0PVAt0Sڀ2|2 RA<@l>0#6pǏ P`P?`VU@P3 'P < P`0P`OV t0S\ڼ0 ?V6ڬA!0"A wx1t1 R U@P\1\!h0Q L1 Q @A,ew4!0jx,!p,0@;,00@@f =lil|,!pgUxU &P0p Rq80p R,!pP0 @$g!CeXbxglgg8:pgg8gviggg88 -L@ 0P  -LMp< ,0 & ! 0PP6 K` Tp P PP ,0 ,0 8,00l w@g!T P(KD@0 0@@0D@, , HgP!8xg -LMp,0  Z0ST0(P Z p0 0@p0t@$K0 0@0@,0\9 0,0P(` 800@(, 80<@ 1 h000xgvi -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW (K4K 0H ,@K@40 PE,04 @r,@ TP<  0zSPD < PR/JD 1`PU'J0O U 00HP`F<@T D1P @,0;,05< TD R0 <D0\ 1@ > D8 1P(`80 p0@(, 80<@ /,0dP`90,040K tx 0`0p4p8  08 D0 0O`0@8<d0h@@\, 40K)D t0x@, 0D |00H P(` 80X0@(, 80<@ /< h000600sK/xg %vi p-`0`` @X0TLP0 Q00cR0bc00cUpp g8:gp-,0D 0R,0 L RP P0X0P0 L P0H pP` P`H0 0@H0L@pPt`p X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQd8 p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0$K00C0h:lg 0-L@PKUT00460P0T$0 0   R0lg b -0SL 0R& 08 pH P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS 4&4&4&t4&H4& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#0j0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P 47&T7&T8&7&8&x7&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'bb -LM40 1\h10 ,0 080 E\A0U@ p pppU2T 0 P9 ,Y(1; `PM@$ 0 p4  00 08 0@$0  8 0 ,0 ,0Y40% Y Y @\ @(K0@P(KoY0@1, (1+@ @Tvi -L M$@ 8 0TK|8lg -LM 80@ `"0 R\ 0 [  _ P|0P0C,P SP%0 ,0S 0 "xP  00W(0$  PX W(0$  0  R F 0  ,0S (0$ u ! 婜姜88 -LM,( 0 080 R0 0`(40 S P< 00  , f"<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 0,P (0PN  "0Sy 0Sv 0 ,  00,P @PD R,Z, 0 jb, D@0,SɌ,P0 ST@T$  "- P,  !,K0 p W^u ,P,P0 S SJT30 S ( @<@` <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP~,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN  T+ 00(K0/S 0 db<0@S@ p0S4 0p03R0S@,PɌ,p@ ?@p u pt,@0 R1(0$ ,  0p \  , 00S (0$ 4 Rs (0$ o p@0 0 jȌp,0 @phg@  -L(M0,0(! 4 p(P 0S 8+0◰`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq &P8啒 ``8叒00(K@ P}8(0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$r0`0K4 PP 0PK@4` H0 D@ 8 `8l 600d R8 `?`0PS8Zhgg0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-l@0l S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RPPH K ` 0SP< PP8 0tPP1  0Sc  0FPP%0 H000(K  0,0@0,0(PP0S (0P#  00l PPSPPK 00 000 @ 0( PPk  0PPd@;0  0 d0 $@KP 0@|@ xP PP -LMPhp, 6@P t ?000(K`$0 00 H @P00$00\ $00 @P 00, @ vi -SLM 1 P  0K(!`P~ <(p0 \2@`0 0h t K\ t@ l0 d@ X@ >`Pp!PRP u 0 S  ` @K0p`(!@ P 4`KTK,0KL H T` , 4p 0 D < 8 zLK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:00 J(K ,0S `~000w@@0S0`g`@`I9 -LM `PQ4 0 , p0m 44 @P#X04 00 R@080 p 0Sj0 '4 00 UR (0 4 /40SM 4 @P 4 ,4 W000Q4P(K8(!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,hg -LM0 Sz`@S"`p?à@ @( K0D0"D0P0`>`P  Z(K, ` ` - L0S 0ET0(  40àLb -0LT 4 40#"B ,0S -b 0-@L0@PS <00S%40"!B 0g8b00CS#&&&&&&&&&&&&&&&&&&&&& 00 00 $00 00 0-@LT 0 .$ àlL*PPT  !88#!$  T@ E0 00e0b - L -LM`pT 0#((0"4S@)@\& Q  R1@\00 T(K "88# "$ 40@P T00   @ T ( 0T #40CBD * 0| @`T (( 090}d00(  (0T `0d;0b -Lat8 0-LM0T  PQ%4@ Q XPt HL 8à L888bb -L M @TP P@K - LT0$ "88" #$Rs8 0  T 0 p-P@0L  ` @ T0 T00 @p 0  T 0 -LM@P T0R p  R s0 P  00`@ V. (KP@ *40bt f (0P0  0f 0`P 06  0`(KoP0  *40"!B `  YW 0,1S 0 R0,!0 0  0 `88b8b -PL0pS( D@`T ,0  R ,0@,0 D@`T0S  0sD8,8 -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX =@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P}p , KP ,0S$P3ᘐBC $0S000(0 @ * 0 @q@@P TbLg8bXbb -LDMX @`P 0S S sr 0SP:X@00 T2  $ R21C"0 @T `@ K0PN 0C"(40 0ȁV000W 0@P` < B2MϠNl尀,0尀h0T,\0S0 S0:Z1ggQgnm77 gk_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q000ԑ7ԏ7E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .ST \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᜡ&P0@ S  ^R 00A\00Q0S\ࠃQ 0S0C0^ Wࠃ\_00W @0'!000c00 Q 0l T0#02SpRt  B0 S 00l bS0a  ~0 R0N 0 Q0G0 s R .R Ԑ70@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S ԏ7p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (kgg7nm7Q:8 R0S  0 0-PLd@g P 0 0= ad0 -LM@p( $0P PK0`K9   4 00     S0  00S K$ K PPH$ fV$P aVS $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW Pm z V XT0 s0^\ S0 0S0e 幽U Z -LM@0 pSP4` x0s $ h jP(K d0WlW;`0 00 , `pdX01Y0dp$00W 0, r 00K@PPX0 G2#,p t0Q= x0000s7 3PdX0A1A ,0KPPdX0A1y\0080 Y `X ,0H `0Cd04K PP 4幻 JPPX0` 70bd0 40dD80c3U 4:48 -LMd@H0S` 00S` 2H0S M( $00  %0`H0 -LM0P@4 x0s` S0p`d R#*d0X  B2!0C03r T0Q` 0_`P0$0dP0i/d 0pj<8 0-Lp c @SPQ0t `P2t0s D4MZ080Pᨵx0sc,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@t0x@4 , 4@ B8g88g -LMP p 02@$p  0 !P  0P:0RT0S$pD0 X1$^D   !T00T01 01$pP0S5:0֣lPţ`P00W0S W( K,0K($K ,0PP$px~D 04 0 0, $pᙳP K$哳 -LM4p`P4K(K 07@P$,K(04K׷P,(0D R:S 0S Q0Sd$K`P],W -LMQ@`PdX 032`DnP6"\050@0 0 P嗷pPX 0\ D `X H0N a 0P倷pP 00 -LM$@ 40   -LM04`<0  <02PD p,K8 K0PP40K,08KHPP.0, D0P*0@SD0 @0S0S 0 TLP 0, D0 @0Sòpῲ(KUP0已<\PP0寲<00<0 -LM4p8K,K 0Q@P80K,08KP30P,D0P *@,0PD0 @0S\ 0` \ KP d KP 0lhpd(KT0[88 -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K嗶`P-(\0D0 R (0S  @000 A @D\0 0S (廳`P 0\ 00T00S$K ( -L M, ( S0 S0 p`(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 5pP@,D0 @ 3  QKP,0x 4qP0 40X`0S( U$ q@0S (0L,寱 (0K,p pP(S0 `@0\p,p\ W,,p88 -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K尵`P00(\ D @H JP JS0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SK-D  @  D 0 @ P: ,0 @D0CS,03(0\ C(0t`P< K0 (4K A(X>}`P0K40<K`P00\ (D @d 0g(K0媰0F`PL R S0 `, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 4x \ `S0p p(K|@ 0Pp |x Pp | @0l@ ( KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP@\8K00@Ke@P20P88PD 0@ s 3S00S9 X0S`hp R PP pdd ( X T گVX `hp V0fh2h Q 0\0"'p [ x | ᝻0p0 SX`X 0\`S  P~ T0S08\ 0 0  80KK IP`(p`0,0\0x 4r` ,0SPZ V,` PR8| v 3\x0s00 @`Ru P 00R00SQ  O u | 0Pp ``0S  Z Rp \ ,40KPp l 40R x0 0;0|t p|X T `\(pX 0B,00.S  R R0.Sp`R ,` P ``0S  Z R= |X| x 0  x | غP0  u | 01Pp ``0S  Z Rr |4| x t0 40@hQ`M0p0 h8Юp@ dP p `\ ,40KPjl0S P t |j06040x P   `00S | 0Pp 8X` 0A,0h0(0l0\;0p *t p|A0 6p 0 t |70\60 ,40K@P!lQ P  &40 x0 m\ ,40KPp l0xS40 |t p060|t P0p@ 6p@ 0t |P060 40p d 00  $00 0-L`P @3P004  0 0 -LM0K@`RP00 0  -LM"0K@`AP0   -LM`B`0$0 ,` (  h0PSp 0S\, KU  X 0P$  $Kh]l:'8 p-0LSP@d0 0< 0S  `P  0P ipD0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z GBZ G ex G t Hp -L  p(`P `R T0`@0Q `<  ;$0 :$0`" -L8MT0Pp $@P (KPڈ7 U@ `(!0`` @ T$0040  04@P(K@ H H :g@P# T0``,P k4 0R $ Z P < C ; ?`b,0; KD@u `0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^v 8 0Br \p:0L m0Qj 8^g 40@<0 Ta,0<!<0@<@0 x rD 0,80<0@ L 2@?!04 H @D000H0`T %80D 4t0LP QT 2R"0D  0 D0x02tQ0 08l0l00P  S0CP0l04p0F0@4 C`\ d0Fd @0RX O@@0 40,0P 0 P,ԫ0,0 |QKP0 0B ћP< 0P P @P$00104P0010h0 0`刐 T0f"0#4X0 @0!@.X$ 0,00@0H&0%< 40| h0  x0|40+H#13 د@Pq,0D@ DP 0|0,0, +, ,h0,0 yT DP@ DP( DP 4g8$8Ԓ7 -LMMVKp\  x Pn`P$0 ` RC-` R3XP K Z 0Up`P (KKX Z 0Jp`P KZ 0<p @0,0 0CK(` 0000冿`PP0S`(   JPy010 0$00(!$00  $0`P ! $0T h 0 #40S`P $0 LM0(! 0` gV$0F 0S`V`R0 0  00 0 0@>x0s009 ,Kz@P)  `_U/Kt`Y KZ Dg@ 0(! ` Vt B 0`,0@dP,@B_ZCP\Z EZCYOKZ EZC Z E x CTbE0 d B40R+|I'I'I'I'I'I'|I'I'I'I'I'I'I'I'I'I'I'I'I'I'I' 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s 40<0@l00l 0<0 0<0\b?K >l0 ,0` 0( tl @P JK >0S0th00d 0( 00ht@P 0S x 0x  0N\\X` t2l 0@P Q0edqTt  0S\0` 0$0TQP x | R@I T0`pW9 `X H `0Gd04K @P'4 '4D0px0ls` 40  0x0s ','8  04>@P 0@0S 04咤0TTTviL9888 0-P@QLdQ0ho -LM@p0d`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R PT!88S(-S0 0S00 00 z (0$ z0  ,0 s 0,0 0S tP0 S 0, S p 0S~ S  0P,0s (0$  0R KP l0  0!P0S 0  ,0sp 0,00Z080sb 0800^\ 0S0 0 S0 0s (0$ X 0S PQ0S 0 S0S000S0S0S0 0S0 0l(KoS0 0S0dZx 0, S Psn(0$  !qvPTA0sMg00sz80sw<0st<0s00s -L M0,@KdP4p`6 0 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $w40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 00 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV 0t ,0T D0\ 0^S04 0S00 0\0Z0m -LM@ d0S4p00 0 <@00 !!  0 @@咾Km -LXML T 0d SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QTnPP80K0@0Ud 80jh@HD0cS0! d`PS0!\ lDS@1@!L P0UCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @P,KP8 K0lPP`0K,08K PpPUX^OT(0$  JP 000EꙡC -L]M 0t d0x1 S 4  UKF;t1tA d! `1 @`VA a | Y?K0@ttq`1x2` 8#8R1 `AT@ 0\! X1 @| t1\ xqd|!d0baY_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0p! l1 0 W p!h1 x< K00K,@K@P 4K,0<K僥P 4, 80X! cQ!D! 0S> PR `Y?Kp`p Q { da `q p l! h! D!A0 P0S 0@ `pR Rd ` p l da `q h D!A0 P0S Ѡta\v x!|adAd0faY_K`W/K PU`XX\0d 50pa `2 PV1Q W p!zl!rt1W_K`PX`t1YK Aq 0t0g0xd PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KhPR OK YAKA[ 0,$0(@K0La Hq t(K0Sm:UKt!P y0 4p! l1 0da `q h1 G01 da `q A04 00,0S00SX `H a0C"0n2O@ # 0@ T1 PA B!KNhPA[(0K 01Bh!UKh 0@4 4YKp l @A h Y_K`WKt1PU`FPV0 0U@0RX{4pq, tAWK^K`PU`Kd `! (4ΟW_K`tAPX`V dqRU']0OK,A1K ; YoKA1[  L H! 0!0(pK0t(K\%:UKt!UP (PUSKd `! 6x0s 0@T1 PA 0UB1K U0OK,A1K:@0@T1 PA ?PYK`P` ! t1?PYK`P`da?VtaWKY_K`PU`4`|a 0OY_K`PU`Y_K`WKPU`9I9 -LPMd dP dX d 0L dT 4SH P Sv NX  LTd0@0 @T0ReTPa 0@0@TZPTX ,0KUPSLTdD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0PP\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  LJP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0l ` RLDd0S*d0l\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0Ppppס0 4D7008p0l0tP`Sm t0s] HT\ dP`0iZ! /L d0Rp:LdP dPm00 DT 8\ Q,H0d 0S* 0bL\0P00T \d H0XPRH 0Kd0 P;P\ 0؝T0MQ0n0$@U];x0sÝ\0STT\ 2p0SH `0Xt c51 a0 QV<,, 00S0000ᔱbg R000  B ᠖g0 R0 ᬱbb -QL M &2 H00SH0<6 KH00CSH0ʴ64 8#8 & 6 1K, KPi 00  0 R0000 0 0 0cP8:gĖg p- 0PL0cS@`$P  0P@ R*bP!00p 0 \%*0Q25 RP:p 8:g p-`PL @-0 P ` `p8:g -LM$pK@P `VP $0$@ T1!Q VK2!  |VP -L(MH`KPp( @[-U  -4K0 08 K-4 40, 0cS$ 0008:gĖggg -L MP2p8#(`@K>08#83K6  P@T@T 0S 0Sf@T0@T V 6 8#8 #K&x PA KP $,00@K03K6 Pi b 0-@L׵XPQ &8S0B8#8S6 $080h : 0-L⸵`@PQ \0000  h00h0LQ0hꤱb -0 LRh7+-A8-Q 0P P P-@0 H0 D k p-0L@`T$@T ,P 0 RP U 8P1 SPUppp茱bi$ 0-H0L@PT $@T Y,P0000茱b 0-<0L@PT@T 8B,P0蜱b -0LM@PT$@T -,P0S P 00PK@`T SP,pK* 8D, TPPE`@T Uꌱb -LM0S $Q 00QK$@`T SP,pK[* , TPPE`@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK *pW5PU zTP( 0Zp PEW  UHK`@0Sc8K)HK ^TZ Y UL0 0eL 0` JT8K)HK ATP PE ꜱb -LM0` V ! P0@T PPPU,pK@T PU ) e+ TP` Kꠖgb -L`pn)H0PU ,0S @A@PUh#g 0-Lֳ,0P@T @T0hꜱb p-$@LT`PC@T@ *P R000(0 0 PP 0S R000 0 0 00CS00$ R( (0@0(0 0 ($ pp茱bP 0P0 - @L 01 0- LP, P@ @ * 40$    0$ (0@ 0茱b -0LSPp!$@T @T Y*P  `P%  P" *@E0/S*09S@P p l 0@T$@T *P000@p 00  (00( `(ꌱb -0L,M@T$@T )PP @T @K`(0 0KKtP 4PLi<@K @P( eP 4PZK茱b8X8 0-0P @L0 PP 3,P,00 +0P000 #4P400 8 @Q<0 -1LSP8)m 00S0C p0 ` p0@0p '`m0060l00A - L@ R`! d!  110C0C11^k 10`P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 4kH0T0H0P U 0-L@P6#00h3 -6@06LP%#0 T hrg0<p7 0-6P0L67@T g@T1S ד0h" 10`P  R`! d!  110C0C11j RZ 0-L M㛱0P@T@T 6 6P!8H#8 R84 K KP@TK0蜱bi 0-PPL4 0d0 @T@T  &Px0P 0 Rd08;P4d0  00 08@0 R P0g -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ &P Q  &P PUP^ Pp-L`P p8Q Q P @P 00 088@ R 0R p' -L`E0pPUPU 0W6 @T@T 0 R0S 3&P@蜱b -LP0p`V%`V" 0W@T@T  0S  &P 6 P R %P@蜱b -L1`V9 `V4 0Z@T@T  0SPU 0 pR*0 0# 0 0# WY  P  蜱b -P0LS@  PP  $  0P0ahG갳':Q -@L hꨖg\' -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V 0'P 4'P0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S ꔱbgfff p-L@`P KPP  R 6pj@ᬰ p-ppp p-LMK`e@PP !PP xPPP  -PxLpMUp`P \KU T;Ul [H;Ud 0U `C$;UC*;0S^P ;崖U m:U6 P0CU0CU*0CU 0U 0CU \$ `0 0`0 6 0#l0S @ (6`(K6`PUD M`9U(`PT````PP5 P$ P/`㩮\9@UV D9U =N0CUX 0CU 0U 0CU`` 少0`8Uㄮ@eƯ `8U3 O0CU 0UJ 0CUn`PP` 6ʕr`H8U *0CU 0U 0CUU61`` 0^g7UC 0U 70CUD`P`P1Sd  0`0 A7UR w7U,0`` 05l7U4 d0CU {`P< `P7 P` 7U. Z70Sp@``P!P1S%  p0`T 400 J`P  P `P00 p0`` 03`PLPK ,0KO`PMO1` t0`` 0M?P` P ` L@K  % ,0KN0`0 l M0`0 0`` 0`` 61`PPK@ ,0KN`P@@ {$@ $` `P0` t0`P6  |$q#!^ """!1# 7P7   -@@L0@1 P”\  ^0 007rP”\ p-@LT`P7 T T   p/p0S 0S0S @T   p3000 00   00pp@T  lgd cp@0^  0@000X B00PpƱḇbbb -L M@ᙩ*PK0pK `P5PBT+@T(  P P0 CR Q04`007T20CT2 PX2 0CX2 ᥪ`$K ៪ -L M@pO*K0K` BPP*0[ሪP$KႪ00[ PBT@T  P  P000f7 @P!   00 pP2 S0P"00%.PB T2 0T2PX20X2?4P;7P -\ \:6S0d0\-P0P0p040\0\ )q2i 1i i i -L@ዜ0H2< D0CJ2I" @00/00 K2 MLqc p-H2L@%P0 `m D1l n`pP B?l00@! 0@SP!0m 00P20L ph'' -L M`PAAPp2@ Ua(K 咯RK'8'x'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'8'L'8'8'8'8'8'8''@.K  p cPP7@ @ p   㲁p%Q. 3@P< 1 01^82/@.K0 @PXq .K 0X@P51  6  ?0S/ p!1R7@10d!R`Q@P10dQ! !/00@ 0@ 0 0@0@ @\#T#@DY@ 0icP  0p{`7@8ʚ; -0QLP`(0p 68#(_ 0!  0 PQ  P11<<88#8#8110 0@0@00@0@0@04 !48#H+ 1$ 6 ^ 3T / Tg 3T00S 0S y` Ꮸ P m` 0  !  !1 3T0 2T0  !  !P@ p;0S #B@ D0Rk@ 1 00Sa@`10`@  @ 6 W0  !  !P@ p0SI A60  !  !|@P p0SF Ҩ\A0Sg H1Rc0T4] Xb`PY  I Apr]H00H0_P0SFvC000 0PP0嘧000 0PP0卧kcM]000 0@@0~괱b̖g5݆ȖgsiggQ`0S9`00 Q-L@0CQ:T0Q %0CQ6@06QT 000p02i i ' -Lp`P LP 6AUp d 420S00 0@0@0O0@0@ R R 80._/Q@@ D0RH00H0_ 47xQ@_d0 3A0 @ 1 00S၁@10@ 0 @ , ! $  ! P` @ߧ0S ǧP`0@  0 O0@0@000 PP奦+18sig̖gȖg 8 -40L @P B/g p- L`@PP(  08/ 9p0&0 P1D!0 Tl0n m @L 0p0@PE p(84''g -$LP h0Աb08- 0  \  \ 00SP \`0S S S 0S 21C 0b p-` LPP0#U T u@R0000 0  ;Tpp -P`QppW@L jTh 1R' 1RP  0S\0PS000000P 0S 0S \@ P @P lP6   R03 Pp`PP`p  0 ^P1 P!p PU00@  01 PU@PP  @P0PP!$UDP5i 6i( -L@`p  PP 0` pP0  0/L8 0-L @PP 0  T.0P P 0 P/l88 -pRL` @PPU@ -L  〠0P / 'Ȗg8 -`L@T( pP@T 0  "!    "!P S s 6@T h̖g-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S 000S  -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -p L@`0 6pP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0qcqc ('((P' 0-0LS@P 0p 0P 00h0 -L M  0P'0 R (0P0 RQ Kh- 0 U0P h0 l0d P*00PDP K,-(-8Ԗggg8qcqcqcЖg8 8 p-@ LTRP 0` 0S 0SY 0CS 0 p0R hY-pXT- Q R 0S: ,H-p 00CS 008C8S08C8J\0 S  P RP 0S T T  0Sd- 0 p0A 0 p4-p0$0$p8D8p888Ԗg -L@ T@P0S R 0U0U R0 0T p Q 0 S R 0U0S 0 S @R 0S 00 0 \ "`P 00 00 0@000``p ,`Ԗg8 -LMⴒ`0P@@PRPU%Uㄢ||2 E eQk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  YP@TXppW0 jP @ 0 d,1, K 0o,0@S2\P P Q0h 100 0  d 0 00d0 R 0h1000@+  0LSꤗgqcqchbЖg78 -LM0 P`@ 0  @@0S  ePVP  $P P 0S PU8P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @.+#048D8Ԗg -L M` @ 0  @@0SPU00  Q *0 R  0R  Q 0P(K0S@0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "00 0p 0 0# ^P 0 R !P0  0R01p Wx0  "0  0 0#\c TP_P]qc Q0-L@P0h&0 0P  @P00T00S00T P0 -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:PW  `  w 3 -`LV0V 8CxW0 08C8J\F0 S  P RP: @T#@T 0W0P Y( 0.0PU% P  0R:Pڐ P@P 0 0 0000P@ 0 R 00 0@$oz)w) Ԗg`88 -LMQPp0`%( K0( @RV 0 0`  `( RR(`0 00@0 `P@ 0 P @ 0-@PPLmd R000  0h0  p-@LTP` X0X hP P 0< a!0S00@@p7plbpbg0 ᨗg - QLp@`0P& S 0S-` XVU` ]T. ( ( ( ( ( ( ( (t (, (p ( ( (t ( ( ( ( (-` PG @ ` @ 0 ` `q`(-` 0S* yi`i`W @T8`0 0 0` @^ci`F`P`9` 0S  0`8 --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 UP P  MPW  0ZXP 0P /jP Up@TW 0P jP U(K__pꨗgʚ;00 R310 P0 tbgtg0 R0%3 %'tbgP (0 P0 Qtbg 0-L@PP P0 A0輗g - L,(- 0-@LP0P  00<0 R  R 2Sxb -鄀L`p0pS:0PP}@P 4 #P P%U0pS*tbD,( Ȱ-P2 S R 2 S,00CS,0 R0000 0 8xbp@-@` 0 PU1! \ *0 00\: Up lp@M 0-L@0qPP ">"0  0 0 -0LSP' @T=@T P,00,0@Tp, "0R8@#xT0W0 `P ,0T0r,0  @ 0``@00 ``pxbP 0-H@LTP#H@T  R 0 0 0 R 000 0 0  0S0C0 %H@T0ԗg8 -LM`HPP!00@ ,P 0`pXT`XpP`X 0S R 0 0 0 R 000 0 0  0S0C0& F OP7 0 0O0 @`$PH R0 0H 00  000(K%$b,bԗg8 P-L R 0B 0 h@&8 0-l0LCQ@l0d0Q 0 P" Q00C0C8P0P   40h 0 0hC% &묗gg88 0-L MdP@TX0T( @+@0@@ 8U,00K0%뀴bD8ԗggqc%( 8 -p0L @R  P 0@ 00@ R 00ꀴbg -LlMpK@P`@  00 >K|0 x t ^4T \18l0   0h d `g K -LPM0P,0 plKp @ @hP W0P @P 0 @T ` 00` 0 0S @h  0hP , p,(K,@ d0 l00l0 8 ,0KpF`P ,@ l00l0,P d0   xg p-@dPL`  @P l04 0CRl0 Apd @\ 0{P@ d0 T0 P0`RQ TA@p0pd0P @P$b -0@S0C00ppPL`, PP4 0 0P @P 0@0d0 +P@ \00` R `R`0S0C000S* PP7 -L`p`PU@ 0 R P@P@PPU@0S r@T P l0d 0Cl0 0 R 8@T 0SP v@P -@LTP`p tpP% 40S P. P4P& PW00 SQ  R 00x440S3Ip\ 00 g4-4P -L4M@X P`P/P  000 0X RB R R P P(KX P| d0 y 80JK R4 8040  d0 <8000 0 00|,4pW V  610`P7P  0 @ PT W Lt70P0   PG d 00V00S70  @P6 d0 / 0P@P D@PD Rl0DP0Cl0d08 0Rd0 0S Xd#X0000P0 @l0S~0l0 P zP w j0P0 p00r`d00H0hT   T   UPP 1 R T,P  0X0 08p 0 Q40 r0 T0 0 P, 0S X Xl00l0d0  + '@8 0S@ LLl0r 0l0r D@  T[`P$d0 DP@P0P    P "PP 4pd0 !80S 8f08p 040 0 S  @r0  0T 0 @YTtꤘggL8`8 -\1LHMl @1X PU 0/ ` W X l(KV R 0 0 0 R000 0 0 `V h0S0C0P!h@K@H 0 0d $r 7,bgԗg8 -LDMpPU"  R 0 0 0 R000 0 0 `V 0S0C0D!PU R000  K\@K@ 0 0X $r ԗg8 -LlM0 ,0 P`pT0SQ OPP7P @ d`8#H 2Pl00Cl0 80S PZ NY3PAP(KpK@   M?\P ` ` NK^Yd 00   ,0K@PP ,`V  l0SZ N0l0B,  -LlM 0㈀KP`$0 @@ p 0 0 @ M?TP X` FK\ 0|0 8#x  $0KpTP*$@T' l08 0CRl0 0 ~ 80S 88P 040 0 0R 0  $k K$ 87 -LLM\PKp@`  `@ `0KX P 0 T d, r 4`p@, 0T` l0SK0l0` -40LS d@P  # -d0L D0S  -LTM p t `@Pp@ 3@& 0 p0 #&30#P00S, 5 00 R' @PP 0t03 R00SH TU000|!000lK@ tlK p0h dp ` P V(K y P,,80T CP,A@,P 0S 0Sd0 0A@P   0d0, lP, `@lK@U (0K#t`lK8 8@ h dp ` <` @@,PP d`P0t03gȗgėg -`pL 0PP# 0@T \ x0$ @TP0S 0Pl 0S 踗ggtg P-LPP>@ 0|`P4  0upP! ԀPȐ@  @ !   !   `pP0P  80P($0 0or괗gtbg -L M@ 0t% l0l Q  0S0 QPKw 8tgggg8 p-PL0S S |@6 p0@` V@p0S@p 2 P   8 p-PL0S# S 6 0 @@`P d0@p 5@4  P 0S@p  80@-000 @ p-@PL,`T*^1 @0 CS  @ Q00T0#Sp p-P`8L00  00 @p -L Mp 4  , 4  R>` 0 Z0 PD 0`@PD 0 10 0BR0U ` P@ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 վR000 Z0 P P, 9 sP 0 S@, 00PUP U 000004 @ (K 0P -LDMdKpP @E1X[6R XU  R0 P P]0`S @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P80`S P 0S  00$d0 0]2P 000@T0L0 D0 X0 X$K6l0? 060d0 0 ;2P000ꜱb -L(MP@P`0AS`(KHK ` 0`T<0 H D 4 @ T pP H0L 0CPS d:(d:(:(8:(9(D@~PAL2``L- 0K<0@ X < : 400hS `300  `L@`U @%T 40P U`P  ``0h!@qBK- K ,0K21C0b ?A1c0g@;(vigfff -LhM0`S@, PK@(4 00 P0 | x  18p0 l 60d0 BK0X  `:0pS PU 0S K d0d L r0(0 0 l0@04 0帀 0P1P00000 -L M 0@0 S4>(4>(=(@>(`P,P J@P00SAX/ , @@  ,Pp @Z `Q 0 70 0BR0`0 sMPP+p W@00P0, 0 0(KP,P bJU@@P00S ; tJ1@IP,P P,P I 0-40L@0PP XP 0@^P I8000a0h400400hSꔴb:gfff -L`R@pP TU lI@@TS S *@J0 0 80@0T@S# S U *@GIJ0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@p>TPQ T< T  0p q$K <lQ@d h1S p@ rpP;h1 Q@180@ Q0001 0  e]0@004 0XPd ` a `R \0p40 pU P Phd00C0 00C 0 < (00C0000vi\>(gb --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  )P P  !P` R5 0Q 02 0BSM@D(@D(@D(@D(LD(LD(U d `X0P `0aR  R  40040H(K 0P \P iRH8p240`U  0JP0  d `X0P `0aR  R0P 0 \P BRP8 r 0Rz 40040T0OHPo0Pkꨗgʚ; -p0L PRp`P @8V P _$$ $0 ph4ꜙgbbb -0L@M 8PRp `K\@K@ 0D0 !H 0P0  < P 60$00  \00 0o`0S00 0ꜙgbbb p-0L PRpq`P @6l0? 060h,PH$ $0 phꜙgbbb -LP ^@FP @00 `p0Z 0尦,嶠T 0 @0 0mꜙgbbb --LtMP@ 0U00 ,@ @  0SKPP 1 0S`V p pG(KQ+p_V V(p P7p  0F4ǟh1P嘀 0`, `00V ^PW@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\ڣ20S*>000S \ -8LS@ 0CS8 06 l8S06p@-@P`0"U@T$b0"PU0t0" ^" 0S0R  ^P0,0,P"p`7P0L0Q00P0S>S  -RS(S(S(S(S(D\ 1 R䄔7 p-0 0 8LS@P+ 8`S S:0 00CST(tT(dT(TT(0:0p080p080p080pH8\ 0\8S 0008 H8"R -41 \ Q7 Q-L QQ20@SU(U(U(U(V( V(U(U(7P"  P P nP P,$`0 lH rD8 Q-L QQZ$P> 6P? P? PG 0@*SW(V(W(V(V(V(V(V(V(W(V(V(V(V(V(V(V(V(V(V(W(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(V(W(HP 0P   `P lP`@ 7n X8 -LDM₮@P`)" 0 2 8KU pl d d RPd0p0d0 H"0S7 82 1 h0 08 |W *>0"QP0PS0@ P h0倀  08 M8[PT70[S O0S  8KR0(K 0C8 Kl0Pl 80[S@80[S8K0 fP@ P 0 8  0B 80[S`Kn DlP p0@| (Kh  08[PPh B0t{ 7@B/. R-L@`0T T 80H z84un>0Q0bCl88 -!L0pS1`o Qo1/^AP 00S   R` V0 00Sq g 00S 7 17 ^ V 00S  ^LQ L1GT@# P 1'R! 1/>0LLQ wL1GrT@Lk8,0`H2 L78X8 0-08L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0W00 @ C0  -0X@LQ@ Q; Q` Q`  V`!0S6  pP V%  z 0  PPR P4P8 S8P4S X14``D 0S8X op `  -@L1f1"\"R`2`2`2 jh7 -LMp 2! i D10o 9!P0`00` VP O0S /rP> 0 `8`  V P\AL1 R!  0S 000( 8|b80 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫8, 0?/ 0 ? 0 /? 0/? 0 2"p(p(@P&d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(  8 01S^X="!B10b#=0 0 \=X= p-OLTP`@@T 0R! |P V tPp -L\MP @p`bP*tK  ~ nKz SP"hK p HKl|0|XX L00 0C 0 L )0C (KtK  S@hK M`hl($h(8 -LM 04a8b #8$0(Sp"hc S KVOK 0F898#8 @@PK1 OK 0K 0 0L -LMPU@ p$ 0`K)0KDPUp)0[ 0)0K  c ^[)K WU=@K( (K -L"M`04 8 $#8(0"(SpP S S KOK  QZOK LQOK 0PK  Q  -LMQ@,`KPp   PK -LMMPPP`pNK  S O08>0<>l< -L$M@p0 @00L K080 PJKK0K  DK >K LK m  B h m:P !=PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0    0  ~ 0 0  00 0@0@ (K= 0=; -LP@  00 0-LP O@P ?@0 0 -LLMPd `0 \0SK\ S0K0 SR K QK @. KK* EK&0 0S 0? K>0K=pKz 0S 0 0S00000p 05K 4K50K0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l 00>9 $ 0S0 10PP ;<:1P0 0@00S000010PP 0S: =0=9900 4>04>99 9@@ 9@ =0=9 -LP@  ³00 0-zLP @P  _@0 0 -LpM    M:0P|0   8P|0 0 R |@ 0S p|0 P`0P`P`|@P "4 <00 `3 00 "8 80 040PP "40  jHK8KXK C8Kh K*K)@K塋00j St0 |pڈ l@ |@p `x xp 0Q 0x p0  Z < x@a 0p 0aT@!0TP$pT (0K  0R@R0# 0B`!VpڀHKH Kbl08#̠8K#8h Kl0 *K)0KVT`tdQt p  @p 9PU t0\ 0/ tRt  t    V HKH K) 6P/ 0XA 0HA 0#0Q| 0 0 0 z8|(K; 81P0 0 ;|8|1| P0 0 C9P 0 0=0=P8|N8| =0=E8G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝĕ78G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00ĕ7 -LM8`p 8  P0 0 31C ` cR 00~>XU 0~>NH>,@%H0,$H 0h l 88:g: -L(M@p`Qꄍ(\(4( (8K00S0,0K00S00,0KPPK0+0K)0K*0Kּ  ᇼ0  g@ }@T ᣼(K8K  2K 8K  2K 8K  2K  8K -LXMp l d t h p0P  0RfdP0 @e d00S   P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p06@PT@ * p 5P 0 BjR 0 T 0S T dP ;T00@00h@!!R t@`0 \,X!8X8U.h"H h0t@Eh0⠐!1 0 W`L@K8#8  h,T P@0pdXGpPP@X  0@a0g T@! h07X dXX p.P@ 0W 0pU` C6P`q jX RPP B;51P  pX 0(>5x $T d 00Sd@000`\,XX.hJ ;TV51TP0 0lp=0=4T4T V0htE⠐7ll,>p0,>4T4 T 0S:p4T4l@$>0$>`KT p4@T@ p4T@ l@p=0=4 -LP@  ծ00 - @LIP0 1!  -L,MP T p L a50PH0  T 3PH0 0 gR H 0S TH < < 00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 w L巹T< 0bY[H@0`pD @0 D@b 00gT@! @D @   dL0ṹY@`p @D 0WpD  0VP4Pg PgY P P U`` P   P L0CoP"88 L0 1; %41PP P0H@0 1 P4P3 0 0 0PLP!0<T @ @0LV 0@P 0$$$$ P @  L0DH 0 0 0 T{3H(KP T=0=r3Hp30H0  ;H3H1HH P0 0PT=0=X3 -L(MP pL P H P0` 0R<@K  9K  HҸP 40P@0 P _2P@0 0 BjR q@  0S @0 @0 @  fZPPIP@@ PD  0@a0h T@! H0ẸD q dZD +P@ 0X 0Up `3Pp: jZ RPP`` B;031P  D0P,@K 0 120H w,0SP2@(K ;@3@ 1@P0 0L P=0=2@20@0 LP=0=2@2 @ P2@ LP=0=2 -LP@  㯬00 - @LBP  -L$MH L ` D ?30P@0 L 1P@0 0 iR @ 0S L@@ P D0\ 2\D01@0, ,4008@K30  5K  D崷L0eZH@@`P <  0@a0fT@! <~<   dD0ṷZ/P`@ 0V 0`Up 2PpH iZ RPP  B;621P   @p< /P2P# 0 0p<@ 0 ##Ƞ#\0PD0j@ 0 0 0 L1@(K00 ŠeHL=0=1@1@ )lT ;@1@1@ P0 04H L=0=w1 0 S00RSS   -0p.0RL p>@0#200   N000N "" N04\0N8 |2S0S = 0=0S = 0= - 0LS=(0R=  l - 0LS=(0R=  l -LM8@S P0  0S00 ?$   0h 0S00\0S 0-LM@KP < P P P K0@K \% P00CS|((p(p(((͗7ʗ7 0-LM@KP  P 0S(Ф(ؤ(d((Ȥ(K0@K | P0S(Ф(ؤ(d((Ȥ(( ӗ7З7 -LM@pAP,0 P0 Y 0 0帡t:P)0 Yl:0 $("10Y_:`A8!#8S,0 P `A @~8# P, 1 PI0SF  Y@: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:/0{(00*0s0\ =(0= LW0\ =(0= J -L,MPP =0=(K8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*=0=H0S 0SD0H   =0=PL 804$@0<0H2 @0Qp>q @Pl"000 2 R 3 878 8781Q3#51 R\ 868 !000 lo6 `1\XA@^08 #8<8H8 S808=0=UH` 2SD` | SyR=0=s+@K M &PhPf0Sc0< S < ]< R P D 000t08680D < H @ Ldi9l9<8ė7 p-LM PQ ` đ=0@= Kp ĆD ȠH,Ƞ$H@x -@L h謨9 p-`LQP@ ۨP   p 0@S  ㉨ p -LhM #R0 (KH8 p !0&`0 " $PT #0P0 LX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*=0=xQ 0S| R 0` S`1'R!=0= 8S `\ Q=0=`0/. @ |0v P  PP TP(48R#x 3  p0S  HTy 0S :Q ;@ :0w|   '0 0  -/>0$0#sp0X t x t0 AR ` r0S hP n *SjR 0X0 e2S tP a S^R=0=X+@K ( PM0S dP I RFSD0lSl >8 h` x t ` | p l h d X 8hQ ?Nd R ?/00v8Sf8Sct0XS (1 R? 868H8X t 30' Q 0 Q'5IlPP  L P PP5 L KCP00d]PH00@  <008 A?![0 L K8Ph@ 868Ǘ7-\" ڰ\ \ \0\ P\ \ =0=\h0 ]0 -LMpW( F`(K(0S(  Q 0 , 0@`W1(PU g-@P,  PfjU; ,1P (0S 000C `b 0,@P  +P T,(P,(N,J,+D, -L MP`p 2S 0 0@V0@  0R 0(@Kg*CK L0R >0 >,LP  ,ꈎؗ7 -LM` 0PSp :@00S \((((M0PP=0=#2K 01R0S= 0F0f8#8 $#$"Kw)  D00 PP  {$K2K  1,K  -2K2K  $,K 2K  ,K 0SFK<)ꪪ 0-@L\rP+000hs -LM`p!28#8N8 ,0 @P0M(K2> 0Q 0, S PU @0 0@0@R+`00 S0 00#  P00  P4 U 8(+ 000 @4`%`@|P| R|@4P+4o, 0 : `8 -LM` @PU$  ppP! 0 %aXH8Pp@d 80X  `P@I< 40$KmD8S $K(7|7l8T(7 -L M`pP00  PUh=0h= W DP  ݵ(Ko*@d=0d=q Z,  -Uh=5P!02h=5d:0S  R ,0S000Z 8S 1R#28#0"=00 ,0.  0Sp=0p= 8S 00 0 08 ,0Z g Z7 Z)Rt=0t=$8 S@d 2 Y TTd Tb 6mDP  n1@ 00d(Ko7*0 0@W0@r(K8SkRt=0t=f8S ' sPl=0l=Z6  0Y8 6 t1 00@0 0< =0=@=0=<8 0@6TPT=0=/00@(  pP 00000@=0=  pP=0= DP   0(Ko Px=0x=  0-P@L ! '0:0; B0 [0C\ %#53c0t0d D0u & 64 0&,0 l (p08t (780dfh -@PL`! p' :0 0;pwp0 0\4[BChRl8-S0T 3535t0c0u 0d 0 6 0&06(l 8p0(t 87 |x 0 0|00|00|00|00|00|00|0xP000H8S000dfh ->LMQp %x>Q @l>QJ `>Q X>Q P>Q85P0 00,.h@Pd 00 Pu=Q /=Q ^=Qf =QW =Q^=hPP^80 V=Qr s=QH 0Q 0CQC. 0PAD=QR @8=Q 0=Q (=Q.<hPP.=P P|1'R!v 1/>00L888S8S H8Lp R 4P<Q <Q |<Q  0>P(KP<QP H<QD @<Q;h倧PP!<  R 89 8 ;4P8;Q ;Q ;Q8P900;Q ;Qh ;QI@K! 8S8 HKI0K! PH; @RPpP:h5PP8@ 208S:4P*P  xP8#m<000X=@00 `p0S :h PPx0SS0P021Cc PPgpW@`P`8 :0 0?00? 000 ?00 ?000 ?000 ?000?S S S S00 0?00?000?0P0! XP8P#500(008S.H' PPP1@P 0S`АK000@P 0S:   #`PP℠F 8@2 8P㳀ᴁ/+Pd7h^PP6A0AS2P'8 ' S' w l`7 20CH'P6h6PPIK! ^ PPI0[ SN@ I [(HKi4PT6hPP8 0S8 <4P8{ 6hPPu184P208k5hPPe0S 858 44PX5hPPR8 n 0S864P8F8P2#>1@ 5hͥPP:@x P8;8v8S8 * H' P4P!4h宥PPȘ 7 0S774P4P888S78SLP,4h吥PP@ P PA 0 3hxPPfPP8K  PH8pHHK:0; I0K P858 4P8;8 P00CS#M@` R0 0S- Rʉ" Q 0e! c#-Q 0S0000f0 e`00 : PPy PPrY`@ 8 B<4P8X-e_00?0 _??0?S0?0  /0 / /  /0  /0  /R0 ? 0S S S S ?0?0?0?00?0?0?00??S 0?84P68 P0Q H8p Q4P n8 ;4P8ii 6i(i8ii4vii i8iii0p0 -PL@ p[`` \[ V @[0S  [00[0 m= a0=[@ -@L`P=ip8@P @Phsj -LPp`@P !ip0S  0S 3 #0S R@Zj:0S  p-@PL! 08Ph`6t80t8phW0>@ mi -t(x8LR@\t(x8R p-L@`PP=0=  H ''1H8p p p p-L@`PP=0=  fp -L`lhpg@PU@ )8PScU@hi -LpPLh`Ih@@D@iT8S hiD 0-LP@P 40p0.h000qi0d HH 0~8 -tLP@  0t1 p-@L h^`PHiHQ php 0-@PL#-0t1tP ]0h0 -L@ hF#  〛 0-HH/0L000000 /0P  8 00000S /000000001(  A? ` 00000000 P  S= 0<0 p-L`pPp1GT@(1@$R@ p0R@(l10@S: :  (@R :0R@ @ 2$ /0 /0@@ @@$@@0SS S S@@/0A? @@ 1 S@@8   P@@p @@@@ 0' P @;P@ -H8n^p`LpP`V/n`Q12GLT@ 8 0  H8p Rh8Q2G3H82 p`l -6LP 8! 88S808@PpDS(=V@ 8`S #PW 0RVp@W&  HdHHp08& 0108 l7  =07lP'0S 808hU0C7 898 0-LP@ =&0= T0T  L810(0(,0 $0X0h 0898 -HLQ@ `0H8hS -`8 LSR R R 0SHX  p f@kPJgU e000Bg\ 00SH(t(l(l(0S00FPPHX X\ 'H[[ }08p2S   7 -8LSHHe000f00@Qʐ0P 0V.RP P PP 0V.R 0V.R 0V.R7 R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ p0   ;8#("40 .0 0.0C 0 -(L"HP  0 0 K -(L"HP  0 0 K -LhHxPP&$x 0 $L&  p@帀 p-8L`#X[@P   ;0 B 0P }p -(Lp"hAPP @  K0 B  0`c  _ 0-20P0 @P@D@L P0 0-0P0@PT@#@L @0 0-0@0@ LP30 -LMSPp" +@Kp #0 0  00CSP(<(@(<(<(<( (<(<(<(<(<(<(<(D(.@K 00P@ `6?J&40`P0`T]Z&40`|&40`A  04"#400<00Pa8 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  00`P  08  #hP00P00P{ q? S0C0P ]0 0S  aP [08  #hPw P00 (P"hi778$8 -"0L@M+pK0`P 82 .00  0d0C07 0-00@0PL00C0d0C00 p-@ TL`PP T000p; 1ph)D8 p-0L` P@P 00P  0#40 b p R  R -L[ R8p p\L@`:U 0<Q 1 PP^H 0 D ;0\ 1 #      pP0 8P I8d;8# 40 Z 0 #40B : ;[PB0[0S480 !8 00c0 00  0  3d0  pp0  08#H '> | p-L@pP*>0`(0\ࠓL ;0\    @P (0 S00c0 0p  -LMpQ`j PX P = @,pPP`0!P21    ' 8  VV80; 0@006@0!0 X7ST@10X'0 6'L$K PR 0"A癷p`IpPXX0 80H V 6 $0 @ f(7|7p8d8 -`LAAP@Pp Q2P PS 0iSSOpW0 8  0S 㲁aQ CPP 1 01b8zP!1R1@10d!PR`A@@10dA! !/00@ 0@ 0 0@0@6  b 0mL7P8 -LM@` P 0iSS3 0 S@P=0=" 6K   }PP=0= 8" 2S2"[R>0> T [U 00@(K00SyD((D((08(F @ p0U  [ B@P=0= @ p0R0岀41 "!8S0' 0K     X1  0@00P41  "[1R ;p< @ <0 0!(<S1 08#(<0!w00021  TPoppPP 08PnpHX`000aU8 X=0=Mꈎft8 -LMpQP@`z n`000aT_ T: T" TI =@0= T @T T &P `0 @PVhF( 0P `P= @0=("( P 6 !⳵0 8`F((8"(#8P 8S `("(P 6 !⑵0 8`88d8 -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,`1 S@ *D  L PL @>0> @>0>(K\1S:D L P< D CL,  04Sa b04S 0<4.J@21C! c@0# .H 0 4 pH@ HD0 0@808L08F E0@$@<A`D0@P#D pC < <P`B0@<@!(#Lp4 H0(, (@0c, L @D4 P8 L<0 T  0@,8H`P 0@ pDP0  ` p 0@#D <8 P`0@8@!(#Lp4D0 \`!@6@D4 (Ko<D@ 0h@ l?D!x@0@8 00D "@L /L|8H8 -LHMp P` 0@Tp P lHPpT0KP` 0@D0p P`0`@\0 X@ \PK` 0@L L#D<P`0@ H#HL@8$p!,`1SpH K*L` PL 048#8 D0 B L P<a b0cP4epX4:d d0X4 %8 % *,0PpX1: 0X-:0SR+@K  P0S8P  S4L4 4 HP>0>(KHp>0>\1S:8Q L 800  0R8PH`@@21C! c# ` < `pHL08008F E0@$@`D0@ApPLC #Dp<P`B0@(!(D#Lp4 `0(0@HHP8`0 HL< P@ 4pWd 0S 00L H0hH l0 $("H0D8S21Cqpc#  HL184~  P` 0@$hP d` @@`Ph0K 0@@@#D<P`  @  0@@@!( #L4P` P T(H`4pHL PD 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L0 \`!H@6 HL@ 1LHLP!⼲$ 807|8H8 -LMd1S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L`!p4Rp%*(9  (K@C [P0΃! PKK? P p@P  @>0> >0>\1S:@ U48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K  P0SP  S@7 P Q R 0S{ P  1S `@o tQ  0R  00 0 h lX  P^ P KP L0S  @0S4[SD ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0\`!d1& q ş8 0 .PPI w  04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p^O 1q匁|1PQ 7  P3#  `VU *  0R@@21C! c#  d H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(D#Lp4 0(@HP`   Pe\[ 0S^0 $("H0D8SU21Cqpc#=0 0 H180`  P` 0@$P ` @P`0KP 0@L#D<P`  0@(!(D #L4P` P T(`~y  P@ 000  0   P .@K tT -P0S0SP @@T@T@ PP A"78H87 -L`Mt d1Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L`!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K  P0S0PpY`*X 0S (Kt 0SS<X  ptP t0Ko t!p0N0>\1S:t@pKo xap $80 %78H8 -P0o0@0@pL0P 0 0@0@WM it0bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' '  0   :cpP=0=0S0S1S 0SRpP   0S  [  ~ /z p-@ TL`PP T0 00p; 1ph8 -`LP pP `K @1 0! 0  00S00 00$(SS"(08#(,"4 0 0  C Cq0CB#4Ac Ba0b 2@XQ :`P"/00@ 0@0 Y1S 0S08#(08#(!1R 7`101 a@10d!`R`q@p10dq! !Lꈎ M-LM0, 8 #X40 0@ BP( Z c @ T;8#(@#< 0 ,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@&,( ?$Kk"400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!➭8  $K8 -LM` pPL Pc c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!R \80P 0#40  002<8#(#< $K|88 -LMP wpP> `c c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Ki`! @804- K@4088 -LMP`Q<  pP; @c /0 0   0cS  ` d 6 0$Km!⥬P8 0@ i`@40 $K88D D0D 0< 0h"n0 0CP($8 0l"d2 T* (H,)(Q888888x2 S-L 0-8p@6l 800\0 PQ L0S 8  878087808S 28 8o S00Ro0 - L@ RT' X'  770C0C77 10TP RZ 10P  R' '  770C0C77 RZ -L M4  P8s4p4 *> 00 [`p, ZRi Vf P\X00@  X0T @ V 40P( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h 8\S8 V 6 H8S808=0==0=? 08X{  lHȐ0000H(H8dH^/ 8 p- Q` `VLP0 0C0^S@0 0C0^S@TtIT`PP\AUDph<V 88V@@$1Tp@@8Ⱦ9D8 Y9 -LMX`U@pH TC-) .)-)-),)U U:([0R6+ (d4R'\D@ 08HH:;8p0\@fT4@0 8$ 308 08L0ES.).)/).)0ES/)t0)t0)/)U U 0h8D08 ! ('p/* [u2  U 0)0)0)0)/)w 8SA0C0 0h8S0C0 0h0 8 RT' X'  770C0C77  10TP RZ 10P/  R' '  770C0C77 wWF Wr00 0hi6CPH!P808 RZ@0 0hGWE00 0h<89 00@ h1(000 h08"H'⴩8 @88888l988888 8bdH8t87p@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0\ TP0PL @0Ba$!B30b0@/LP T耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@LPP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PK 7)7 -L M0@ (KJ 0 @PK7)`7D  tQ 0 S"0!B ᤘ7-<JQ !0 S0`70@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C007GD  tQ 0 S"0!B ᤘ7 -LM P3 p0@ 00@ 2K*=2K00<0<Po:00 P,K  0 4 K30K1<14 K 0D$K贱b -LM< @  P6  p  0@(0@; 6K0P2K<`0:00  P`0K  < @ 0 8 K70K1<18 K 0D(K贱b -LM0PK`p@ @T@W0 BK,` /0K0KP d\0l 0B Sl00 R< W K\ X p-PL 0`P p0@T@T 0S00 0 >Pppp蜱b -LP l0S0Q 0S 4Qh   d00d0.8 -LPMp`0 $#$("(("80CSp  (K 0h 0K d0 ,Kd P 0QI 0 R<0@\/0\ `0 <@ X@ P 0X RG ,PRF X 0@(R@@Ŵ0 *PG YD 0PUA  R40S P@K,K 0 `4P幦8P8 0,Q 0 R<0@\P 0 R@,PP@K,K 0`卦 0gX000 p0CHTo0PX R (l 0Pb @40l Rl0SZP` |0`0 udh q0Kd m0,0 >K e\ 8Ka2 3K0? K@0K @ K0CD/` -PWP@K,K 0 0`l0 P d l20Sm40Sz P@K,K 0j`4P8P8 00l0 T l0  `T X0  !0O0@T0X@d00d0 T0R0S&00 @ 0T]  R    B X!L PDPU0P0 P B !00C0_ 40  P` `\ RP@K,K 0`嬥80 P@K ,K0`圥 08Lt@ 0T T0X@98b8 `l9b$bg,990 $!$("( BRQ - ^ 04"48S  0 000^: 04"48#8 S  S p-4aLO 1@T0 R*phP\.  @00C@0P 0SP 04"48S 0 000Q: 04"48#8 S  S @P@00C@0P @P긙g p-L@fOp0``0P 0PT0 <0R UphPQbg$b -@?L 00H) -LM` P-  0^ 0 0@00  00(KQ! (0,K {@P,d0  0< KL v/@, @%0pP,  Q T0 0u0S 6cPbʰ2 R? BP[ Q 0 SA 00C00S`0 ``000,T X0 a d00d0 R{ ,"T0`SR T0X@1 PW, d00d0,/T00@T0X@ 0P0  00C0 P0#@00b 00C0 P000!TʇS<Ppv< K0E @:X0S#@5 Rk 0@+,0 8 ?#@!< K08 , 9bg(:$b$b b<9p9 -L MßP^p0<`4 dW\ WP W! (K8ß 402 03D  0@ 媱0S 0s d 20 S V R  ᇴl00060dT2 TX    00  j0S(  "80(Ko-V "00C0Q00 d0<;d0 P Q 00C0 Pt(Ko0Sl0V060{< P<A DH0 0 0d0,!;d00PS0d0  0@T0X@Y`VU`VR 0 R 0< Q0@T0X@  |08 P4 8 00 08`2P4 (Kog9g$bgqcC) 79Т7 ggggg9 p-L MQ@P` KpP * 0< @`9^$ 0$PKphG(bg -LMp@s`P< 0 0    0; 0T0@0 0@P0C 0@P00P0 0C 0 P0p 0,KrK&K%PKPP$ 00 0 K謌gqcg -@LT @T 0 R(0SC \\0 ( $0S,0 Q 0$0 @TAg -LLP0 R R 0S00S000 RhMqc p-TPL0SpdL80 @`T  @TphMgb p-L@!PJL$0`0CS04S U 6,0 R  .phxMD P  P 0S 0 08qc 0-pP@LP 0S0S P8 P 0@0 00qc p-`LPQ 6S0&R Q8 @P Ე0  @,@p,0Sp@pqc p-PLᛔ@K0 4S`$  T 6@ 0(0phLp  @$@2? 0(@g l0l -@@L@L0P k00 t0@ @@ 0hYgqcqc97 --LMP  0 ,0 @04!48#hdV)ڲ1 0S*PP000 0p0d 0;PI 0d0 00SW SD S %(K000g 0c0 0&@T 00S1#0`AqpV `V 0 R4S  p3R Q$00CS8X)DX)DX)pX)DX)000.000& 0SB 000000& 0S0R 0S QQ 0 R(0 0P P 0 R 0RP| ( 000$0Sy s:Sq0$0n0R 0S QQ 0 R(0 0PW PT 0 R 0RPJ ( 000$ RB02&> 0$0; 0 ]P07 0 0R+@T+ @T( 0 R(0S0`4S2 $`>0(`(0S3@$@0 t>`0(@0(0$0%000ol,0 Rggfffg0S S  P0 0 BQ0S 0`000 RP0S1 Q 0-L M0@0CS0 K0ĒPP 0  0 $ K#K4 KHPI R000 0 0 K60 =}2i -L M`PQ Q 0 R 0@RQ000P1S@K06 S}pP  0 00000,KD< KhPP@I0S 0  0 00 0p`J60 |@1i -@L 'L0S  000@  0-TL @}PPL0S0000 oPP @ 0-0L, 0\P< \#\ 6 0 Q@T@T 0 R0\ <00^R0h0蜱b6H@-0\@<0\!\ 6 0 QQQ 0 R0 \ <00^R@xꜱb  0- @PL)hP 0h00 00h 0-PLP T @0S,QT00 -LMSPpQ 8@<`KP1SV  PPGᙑᶴ,0S 0,0 0 Sl14,0,0,0\0 0(0XSt0$06("8 ,4$R3 ( 00L06("8 " R.UY(KI0SHt6P(ᦴ^OlP06P(0L06("8 h0S0(K0 Uh i  0-@LP᾽T00!R00P    a pQ5 R000 0@#P0S0 0 0@ %8 3 ( 0S00@@?@ 0 Q<l0K, 00#R , 40 @00@bgvil9 -L@Qp `V ۡ@TԡX@0S 0S@U l0P (0V -LM@,pK0P`D P@P00P0#S {K9 -PL\M| 0 P (KHK 0/ 00a!(K 0c1\ p q@@ R 1S q w Tp Rq w Ypw Ypv KvK` 0S WW `V00P0#S w WV3 @T*:0V0. Pd0!1?PU`V00P0#Sw 0S1 0S* 0aR }:vK ||x |Gs@WY Y4 h0R  d6P`  RY*:00 RR*200#9 -LMP` \\! \ (KQ p04"48#8g00S03#!4@K,0   * 08#8,#0@ 4KK.K-K@P F7, 0 @P( K2,0P ,@ 0 @ ("(04"409 p-PPL` d00S p<$@[ph">v9 -LM@PP& d00S \00`0K ,`K<$p;P 21C0@ 10\ $ 0 =EgDb9 -0L p3Xbbqc -LXM8`K@ ᇳ0 70K8K4@ 劢PP$Kd0ppWPx@K @ lt` 08 (0Kp H P(LLḡ(P<0 0>P ᭡Pᩡ P b0) 0-PL@P9 04$48# `04"48# Q\00AQ\40 p0 0QS\ JQ :40p Q`0Q:S`0hi0\0\07 -0LP 0`bb -QL M@`Pp@ $K;0S S *@$ "=` `Ќ봀@P" PU4P0S@|N @@s 04pӌ@Pf`bbgdb -L MK KH 0M Ϡ< A$0/@#b  8#" KQMb 0-L M@0 01@0̌P@@@K0 -LMP0 @`-P 0S AGT(pT 0!0<@BT0 0p2Z p- pPr 0`S PS U0S S@  U@UT# DSSPd`  ɰ   f1Z<1 p(KQ 0 0 Q P8K 0 7 K80K0  40 P d0& 8@GT ߱0 7 K80K 0  40 Px T00T0AEpP  0 0!L0 0@L0P@8@b4g -PUl#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S " 00 0  P| 04"48#8SWQ    0\QP1! 2 R@P 0S!ԑf(0 (0 0b0(Ub!0U00P0 U00 UX: 00 01D 0NSA: 0 0N 000Q 000A ("(04"400  0>0>00>0$p 000U0S 0("(04"40 ;u! @t rg 99 -LM@P  WP h: --LXM` 0,0 @04"48#XdUp$&000(K 0$U$Q  0P %000#`P%0000(S(1 0  @AQ̞))t)()())()()x)\))()()()4)5 R 5 R1  0004 R U000T@ڴ000T@ʲ1#U0 0U R 00S 0)SCU00U000}4 R1 0010000K 0 00Pd0`p4p 13 RU 3 RQ T#U  10URTK d@K tPK ޯ گ0 PKS0KTKs0Kc0KtKdK| `Kx  pKt40K0P(  0卣4P 2 R# ZTh@mTc0)0)0)0)()0) ))) )) ))))) @X@V@T@R1 (0{4PIU600 d|aD@K r0 C0KD K0s S@0  0@0 W *P 00\  0S? 063 LP0  05`P000  001DPK 90 D KC0K0|@0  21C0d 10\ 0(  L0 0gTbPbLb\bb`bbԍ)gDb p- LM@T`@PK0`0P@*, 0T PPd@PK*![0(( b!("( 0P0 xqcqcb -L$MP@` p7l0) @TQ P8  0Pl0l0`@   0 K0 # 0  K0 Pl0l0`0 Pl0l0`D@K  0P`DpK ᆮ0 D0KC K 0 K=K>K?KDpK p0 D0KC K -L MQ` 0SP  K ŸA0`ǁP 0B!S#))))))))))))))))))))P)x)))4))))L)ؤ)ؤ))ؤ)ؤ)-P&R 0 P`GPU 1 RP÷ x 0 Ki X 0P Ki 4 0$A 0 @`PV, @0S0嬜p 0 p뼀P0S~ 6@唚8u  0x0   Ki葆Hp0Sb 6@(`8YgbLgзbggطbbܷbPg4g p-d@`LPP 0S 000 0`埜P 8p8g -LFM10 4! l@peQPa 0S$S(EZ  0R\ ћ`0 00 0oP JK ZP <  x000T T3 R ` VX  LKᳫ0K0KLK\ 0(LKH0 P 0WF *\ \ W@i<K E:[Q; [R 0S09 ["200 "S9 K 6` LK~0HK K0KLK%Tb \ H(QX H0<0 X0  000S0T0 a,KA  90[0S SW S* 90K@i \ 0y!P00P0S:0[; [0SL@K 6 L KP `0K0KH P. < թ:0[0:0K:0[0 0C0K ʩ:0[0:0KT@\ LK(LP\0LK(嫃\` t@i 0@i :0[; [0SnL@K \0 (0K0K,0L KH0 RP :0[0:0K\0H(/P @@i @i bзb4g - @LTp l` P R0P00@ %0U0C0 $R000 hbHgdg -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\gbb4g 0-0PLP @000P0g4g 0-Lg30PPT 0@0C0S0D 00 0T(@P 000h4g4g0g - 0p 01 cQL * 0  0Q  0q03R0S %000Jh倶d%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q P R0<00 ,#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S \ <00<0 00pW7/ <00<0202%4gg -QL0M` P pL  , K,0pL0 P 001L0 0< 0S_ D K@X RVD0KX0  PT d0 0Q ύ000 0 00(  0SX qV P `0H0 4Sp 8H L0 0@L0P@ d00 Q<0 0g Qe r 0s V 0S d0 61@  @GP]X0Sf (K VD KX D@K D`KX@ PT d0 0QR k000 0 00(  0S( q& P ` H 4Rp08H0 L0 0@L0P@ d00 0S  <0 0Qr<!E 0\10000Z ! : 6S7%3@T00T0DP DK3@X 0 0@0@ 0 L0L! 4  4 0 8008004DKp0H0 00 T X N!<  6 0S QQ 0 R<0 0TQ Q 0 R 0RQ  R 0S  T %0S 6 @%1<10V0 0S \00@00  H04"48#\: 0 P0SV "Lx00x0 0D@0@0PSf R d0 \0p`0S`,"(@L00L0\ oP p QH Q 0 R P!A@T00T00p $#$("Q(@3:1<12020S oP pQH Q 0 R (0RIT (0RH  @PPP W"0D@pU 0TP  0 D@K 㒝D`KX@  嗌P-T[ @D00D0U4g p-RL@ P` PP L@p@pkS dS5S 0 PphmSnS)`1RP9 k0 0 0PP@ 0S@ 0 Rl0l000l0l0P@@ T+P( ,@ >0 0 l00@0PP 0S0 S Z@ @P @-@" --LM0 0 P@l0 p`-00S,* @P7( q0y0 ` x("(04"408 P  p0(0 0H # PAQ(KQ`0P 0S 04"48#8QS0S , "\00\004 404g~g --LML2pP( 82U r PUF @0 l0l@(Ty R 0S8 RR( R 0RX#  !0@P l 10S@0  (K 0h@P< (0PFn(Pk0(0 PUX$ l 00S@0   (K 0E@P (0P K(P G@&$K0R 0S 0 3@004  B4 0 *@ gbʚ;4g - QL`P0@+ 0t03Q0S pX Qb ))))))t))))))))))))0\ Tp op i 0`S0SK 1p-p 0S0S/p0(0pdpTQ0 p V+p$$1@  pPpP5 %p p0 V8p( iep9p0  0S s sP 0p80rV 0 ,%0y`fbbgh9\9P9 -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/ř|Q Q V# 01V 4 #tf㗙4<㓙 (㏙hLg@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20hhBN|1S(  S < t0b? S Q Q c|0@ P1Pp0P 20Sp P(0p S1*(0P!b -L,MY0@S5 S Q/ /(K(0 40 H <0 <0*0S`` P PPkpP7 PDP D T08 # R; 1 Q7 (4 H < 0 0 (0 Y0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S D# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800b<Y 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q4@>@0 H  0k `@  @ |@ 005(P0<@@0 `= >0?@0 , 80 =^401q  x0 0 Y Y 40 c("(04"40 Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 D 0S;0H Sꬌg 0bԷbطb -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 Q<( 4"4!<0 E <(4"4!<0 0 6S-t0`0@1A }: 08#8:AQ00Q000@ H 0?0 i!@ ἁbhhDb:X* -LM0`S Y0S{ S0L0X0@"2  ! 1L0圢L0"HABxrx2, P Rj`"0Q< L2* ! BR0 0R000@b "0?0ਂd1@0Sd!00da0㼀0  0,`1R01 HL!`o d!> 0H@P`1dA@0 rYX 7P@800# L 00j^/  @0x!|1L3@|  21CU @ 40P!@ TU@hhخh4bh cb? 0@X1A Pp0P0DPd @0 0@0d (K1|2H |2R(K  P! 0 0$ 0 P $ pP| X  t0 Z 娀0\0g  Y10 0a aS0SD0Dp0P0P!= SB `0`S% 000  ! @P }d @0 0@0d T0@P !}0q [0 20   0 p0R0P000:0:TP!Xy Thh$bh4b -bLP|p@P |4Q- Q(+ WP2ųpH20S S03T@!t@T@@3b/  R8 @D#h.8`#hw1 10S> S A !0S01S 1 g`P \ 67Q1 QL  Q3 0n Cw@ Qp0/ 0nC0@P10%Tt h1l1 S 1% A5g0 R0! S 1 !g0 R p00n C PN.n2 2:20Sp pS:0S0 Q020Sp  p S:0S R00n Cb2,b9طb -|0GL`@pDP PU:EAh0R1XP @300PR1h$@4b -LMpP @0, K`P 0 0R 7 (K 0aS0BD 0a0bS&% P @l0l <0 l0w0w000030S S,0S H 000 0PP 0 0 MP Po yD@D0t t 0S "2S1 `0 R!t0:t0=t0WPx T0prX1P hRT!00 001006<2 4!0$"?08000v:Sn: S7 100! 00&?0D R1 0cS!`> 0@P1TAcC(P  0(@0 @ MY H0@P !0 80P00AIH Cl0 PM 7 :hh0bb A-L@J 0\:@T 0c 0bS R@TLe0D L1M0L1  l B^ 00C 09 -6| 8SLP@p@T  0S 0 Gq0 ( V%  0@S1 `0V 00000 U | R l0  HPP t04t0wt04t0h -LM`0 ɜP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@S 剞M000e0     0/8 4 0 W  1QS P- R0000 0$ ZUp 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000 0a1 0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s R0000 0  0R hhh --LMx00 4 x0KH 1 0#2S S  y(K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,04@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R  R > 0P0"!U00s UK 101P=P L wP  ~,`,``,` 0   (0 pd w  80KvP 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% T:Y PPE UP  @@ R 0S PP M p;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,06@ 0@\K d@Kc0K̎0xK @KK0KŽ@GK0 ^  ^ h( 嬎@  㨎0 0 RS02 J@TI \ 9@T 0Rb 0#3Rm101 R |0@  @|1S SPx9A ,@@w0 00(, 0PU R 0S:D R \ 0`@ P1#  @ 0 0\41ʴ@T H0K0(  0 PHQ @P PhȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^0, 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P U t0 0t0 P @ 00cS10cSn U = @ 0(zPdKQKNQ Qz 1P0P 1$0 ?008z70S @0dP`XPP0S3HQ D T10bS00dS'ڨ@A 199000 { 0K  V101 00cS10cS0O0@0@e%,``e ,` H0S DT10cS`!0bSNڤPL  `1R 0R 0RL6 S=&02 '14 = #P 00 0 2  80KPl 8@ 0R0% *8坢 @Pt0PP t,0O0@0@t0@ 0@d0Kc K ` 0KKK0|0 K  1AQ T!D00bSJ0 @PR00U0S% ^0S9Q `10cS 0\1D T!,0S0 P 00cS0`S 1S:6S dP`XP (<PUhhbhb DhPPb9h4bhbh bb|hh:hܮh0bH?(b (`PVu U 00lSyy00[W 6S7 1Ũ@t0 @UAt@8 0 0bS3000!0 !? 08fy@t0`0`SS1R!P1Q!]81S \ c 1'0 1,0@S>@0L0  Z@  P 6 Sʠ@$"P00SPQ,` VPPX 8C(RR R ʠt 000t8C80CS@p,*+*`,*+*+* ,*+* 0bS R 0bSQ0Q,0S 0 0R@P0U000H0^0 Hጅ t0Ńt3P3Cx0 |1S S  @,A $4$@04t 0S @ PVD4P3Cx 06 0 ( 0 C 0 00i4 prPL I0 00cS@,` ,`B68C( RA0@S0S  ,0K  @t0t16S' Sʨ0lSڨ%6S$! 1S !10cS000ű`l/H0 P  @0Sj08\ @ <10cStl 1SG 40&@0?0w A$1T'P1#0Q  !S | R l0  HP 0 ;j@ V0b @:< 0Vt 0p!0bStŨh1Vha 0 0bS 60CSh0*h0*P0*)*(0*88P3CwoT X kT P  8P3Cw T 0  (0 ?0 Ppw0 @F n ‰ 8徉 0P,dKK 0PP a p 0DP[ ddKK 0 &@t0t00006@C a f00 cR 0JTT10P\1000; 06X*@0`*?08wt0`0`S  00C0@dd _@P`@P,`  P 0@,A ;[5,[\!040bSTM,/0  ^9 ^ P101@P dKHKK 0@Pp~"Pp 0@ k,`VD  0R H1 0c0cS000g 0SZ 00cS P00C0b0SH00@00[L10L1,`8#PD 0 @0 5,`9S1R!P1Q!P1 I Q f URt= R  X 1 0S 6 t,0P@@,|/0 U @ | | R l0  HP 0 {h0 [ t0ăt t0t>@0f.P 0R^ 8 dP`PX0n aS0 R10P000 @@,0|O0@\0@| | R l0  HP 0 %ht? R  XR 1O 0SL 6I t@0 @OH0S @0S P,!S0b$S;:, (10(1  P@t0ătKt 40St ] 0S @Tt*Pf q t0ăt-0tt 4t\u ,A(A9(3t Iu0@ 0H 0R0 @0Su8\   <10cS`l 0Pc/00 S | R l0  HP 0 qg@Gt 0p!0bStŨh1UhQ0 1R& P40@"0?0tS < 0  t0ătt0t0SR t0N6@tc tt0ŃtDPX!cw 0<00 f  @!608#868C8S ڨ  1'0 1ocP0 GP!PP$1Pbt8a0'0 !@\0 0@\0`@@J$!0, 0cS P3:th0bhhb -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / )t&8 S0Һ6 tBDb:9 -L`Mt |0`U@t tPhUtPf -400`S:70 10 0h0 3t0VtPr 0\ P1P!R,nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d X@d` P0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q Q; 0b` R0a0aSTt 00aS  0Q ^ 040@ t Hsx ^hhX|Uy9s40 @ Voj p aX pʃd XXp I r0 S X RU0!0bS`0ODH0@@)H0L@D;pP IX00S; M1 0X0 0X0X0x G 00 0x 0S0 (p  X(t00t0pP 8HX00S 0X0 0X0 00 x0S x0 P @B t0 1R B X40 <(4"4!<0p <4("4!<\0, X0`#P7P` 1Q!0\ a6`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڄ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ .t tQ(l1lP\l@0\0@0tP 00 0tPP  10cS0P`!tPdQS 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  d4TK 0T| p ,0d00d0ğh00h0t0Vh tP    Ut0 PtP 1 0cS 81!S3 <8!0000@P 0RL `#0?0q40A sqF=0P(0C8#,("(#80 0@l 0| *|H 0@Wt N0 p TK⻃p 0#10 " 0t0:qTx 0P_7 t 1@0S0KT@K 04 4TK(K 0`ፃ@:tP ' T#R1p < 4("4! .|< -|1S# |8 -|( -XK&0X0T :0X!K0\Lh0DH -00|, -| -h@hphXh p-LD@P`P00T00S d0ph p -D@LPpT Pg d0 \0 00h0W0sP 7S -@ML0  0 @ @cKM*X8h -L Mp@Q` (K0S PĢPQ 0@SŸ3P8 PŸ. P+ U V' 001@0 @ 0\@ Pi @0S D^ < ,$ !$0,0cS10cS 01 RV @ 0@ P< DZ <,$!$0$L0cS10cS`F0l $#$("Y* h1Y0*t05t0 p10dSupA0^/t10 00j0 Rf 3PAP @P`8@K㢁 P8K@7K` 0cK4P hMt05t0<0ꌸb0l)`M*hlT*طbhM* -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S a  0R:<KN  <0KK[#[`0pgUF P3 @08S D^ < ,$ !$0,0cS10cS09 0S0S s娐 0pP 0Sl0 R L03PAP @P < K0P1{0l)blT*X8hh -LD@@68C8S S\06aHhC6S,0 R3QAQ @QN 0-@LTP R0000 0 @v@T00h 0-L@ PdA  0000hhh p-|P@L@`bt0xPt06t0 @%nD@p0t0n p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 0hhN - LPPPpN @p81@P0.@7 la@@ lT  l 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPhbc*<7xU*$b bB?bԷb -L0MP@ PH0 L P ||0@ @ H0D0 Pd`X0`0lQ< PN #0@ R RF TP X  PL0X 0  2@0 2P@ 0 0 0H0H  ,<$4 !$ 4),.

t0P6 S `0P T 400aS70ho , ,0 ?0Pik|h0b:xh p-L M@t0`V% 40040&(BP1 R|0@  0 ?08=kKph6 <00<<0Kph, Pʄ0^x0l 40`0Q*80 080x0LPP 0hhh:h|h0bxh -@Lt0p0 h,00,0&= R P0` 0r00r0p04h0a P * 8(C89H C1S01P:000<00hhB0bhxb 0-@Lpt0P0t00h -L0M`^t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<Cg| Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0Xj2 R$ |@T! 6Sں6Q@0 R  P d0 \0 |1S (TPP \0Q Bl6Qʰ0 G P!P 8QPV$1 AD10D1|.-0100tD [5t0K^?0 4KDK(0LK40 0@KaH||0 00K/ K(0T,0 (0D2_0\08hhNBDb:طbzM*h 0-LP@@@iT0 p-|0L@P@X`fP 0X`V GPPD{ph 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P l0@<4,800P00z@. PUol(0Sn@9P P᲻PTPO 0mul0 (0(0  w x =bbh98bԷb -QLM 0S K0S0S P0@ SAP T \  0 0HP־0P @0S   0ꌸb0l)h܄* -LlM@Qp PU (K`VP0@Sl kPg P 2 R X 0x S 0t0 p z L0KLK0 nuKPKL`KDK| |x H 4 0LKP2l0 Yg xt 0R:0@KLuh`K0 xtH@`PKAu0 g0KhK@ux  P 0PWI ["[pLK l0@p, $l LKL KD0K|0  DKLK0Px p r DKLK0P dLKD Kl  | tl pLK l \0Tp M[DK"[0(P%0l)b܄*hX8 -@0@L@6@h1 --L✩PM000` 000 , 0@#2S S0 8,P5(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40K⚽P[ 4 0R0%p *0]bᕵHK0Y0 0S 0S0s 0SV 0Sl0 ; 0Y0 0cP[U` U d@K9t0d0KcPK0 6K1  X7PU h l0  b@(bT< PU @0 Yl0 000b2  (0V0(07  0b0S 000F0S 0s?Y= R00d00dSPU_#0RYW ,0S00S40S80S0S= 0S:$0S7(0S4h0S? %0@P8 Y h0l x50Sh @0   h, KO2V h0l 850Sh @0   h,K 0pǴh0dK@ P,0nP,P 00 00,0 @0   hP [Y (@ p0@哻PU 0Y,0 l @40S@0   , K2V l 40S@0   ,K 0Y l0  ,0S,@K @0S@ )0V l0  ,0S,@K @0S! 0pV@dKP ,0PK 00 0fh0S Y h0l 20Sh @0   h, K1V h0l 20Sh @0    h,K0kp!h0dK@ P,0P h @N5dKr0d0KcPK &K 0`0 , rP@9 Y  0> $0"!0Y$00C ( |NPUD0T00! 000Y: l000 E-(@  0@嶻P#000 lrPi#0Re8 R 0R^( R 0RX( hPh @ؿHK00l  0 hP Eh9hʚ; -L㎸h-Q@P P*R 000PL 0M hb -LMP)0Kp @)0[ !#R)K R ᜵ (0/0(0(K%aVT 5,  , 劵001S %1S T5,  , z0701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᴷP @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z  x#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0B 0)@[T T` ̴"(0/0(0/ 00S St) +0K.@0+ K*K*0K 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(ݳ00,<$"*)0+ K00(0C@   00Kų00,<$"*)0+ K 0嶐0+ K*K*0Kr*0[0 +0K⮳ 0 㨳 04"48#89C40 hԷb -LM⠅4 8  +0K`ጳ+ ["2S S (00(0 (K( 0P "2S S l 0P\`P + ["2S0 4* K唱0S000 04 8<,<$"*4* K{0SY )Y( 0S:Y )Y p 0S 654 R1 ( ^30 PU)PU& 00 R@T@T W 0S 0R Z 0S oP$00$0关w040`O0@Y0@ )YuBP8 R LP  0>9@ D0R@ 1 00Sa@`10`@ 0 @ , ! p%  !<"@P `;0Sw # O) i 04 8<̠<Č,ʠ*K) K)K+P>  048<!$!0!̠ 0)0[p:("#! !4!(0 @p*K 0)0K P  )0[S 0 0Q(L`P000 00 0ܲᓖ t@PZH00H0ɲ 0 0 0000 @@p} h9bbsi̖gȖgg -\0LP1  0 y($ 00 0嚲 b h --\0LM R1   00 0 W K 00 0xb hG-@0 0P8< 0#40   0 ! 0 8<0# R M` *\\\s\`B0P3P .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V0```r``F0 0! #0 042P .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " VHHHqH  41,!(1 !1! !!, ! !0,0 00 0 P 0.(. .A 1 ! 4 (  0 .,0!$0   !80R0!L`@ OL7L7L7L7L7 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(KL7L7L7L7L7G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0hx ̠|pPQ'l !a4PP<`, P#<`P|0$`p *L#x0!`@(0 $@ 0,@x0h@%D&T#d<0x!40p "0.Ƞ #4*q 0pp,(8! p "0.*4@P q T`A8`(P!0` 0# " !0# `l"p0t`pl@tl p!L"< ⤓! lT #3P Qa*̠ !pLDP`l@p$@$pp0@#t0 @0pP0l0t`#D0*Ƞ0%0T0  L0!D0&X "0P #Ē0 QPH$ @P !P&dp` " 0%pb@Pp*Q @@ a Hp 0# " !pW  "0#px!| 0 %xp'? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kog@, g I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* aoE_@ A_ @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \]^(KLb< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LZM@  hK^oOh b4bp   _0!dj i .i ( c `0`  cc,0 " 01 \ \0 (bx  c   q! X a=ii .ଐ cq-T 0 ,' i0i  0̐ 0Pb1 0i(i   , a=! L!aL bq *L c-HL1 . i0i ,0 01 0bq'D  @i i jj! 堐 ጑ 张 吡a=(-༠c <0, cc )b0 8  .0ax  b ,  8 =j|x! 4 pb!Q? `P0`?SpP`0L`@  goY@pb@ Y C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1P@X\=X K$9t7G-M 0H 0@ 0 P$P`(`H`,P  0p@  00@L ` 0(, 00($ 0 ,@ 0j0!(P,@ f 0 @0 P.!T,f. 0$0@P0L0(  0,P$ @(0,@8`< PD08}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍ7 -pRLP' D@A1>0` W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW-:P` T@1@ T@D 8 `ph PT@1 0S@DRH0 0@H0L@PT@1 0S@DRH0 0@H0L@SH0 0@H0L@y -pRL`. D@A1>?0 @c W1:PP RT@1@ @D  pj?W@<@pG@ ?W@D @W P-T@1@ @D P!T@1@ @D 0-8PL@ TP _U@0@0D@H0L@0x7 -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM ꌺbUUUU8 8 87 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << 2 0h3 h 0-L M 0t3pPp0@l 0D@&SDPS@ 80@SK0h S(9Ph h09$h89 -@PL 40$80Q8QhQ$hPh - Lp`O`P W P80U408@ ( O@PPPh$h -@QL^ ppW`&P0S" 1"000 !   \P0@0 0 000ࠠ  @bb -LM00 SPA 1p`^2 @0S& 0#1 V U 010 R010 R Qt "10010 R @ ^t`VX p(KV ^"100(K @ pP ,P0@`@00 000 bb p-@LPL0` RpQ 0ES"100A1 R U 00  Q 0 S Q epPBU( 00  Pbb -0Lq0SN R\ڈPPU 0S00S  00'.UARl 0`P: @2!  !qB0"eB"10010  唠 l B`l 0 <0P  PP Pbb -pP0LS`P @VP#:"100 A 0S0C0000SP P0  0S Abb -L MpP_ <0S\ N4 8QW 1PS 1 PY`:4 R 0004 R80K cP00K0@#0(04k(K1"0 0 0.0S  0@0/00@0 @|0  P p( 80(0p42 P8bb 0-LPL0@S ,0 z0 0h00 h,P+Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d AXpWWW W9|9D9`9 -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd @WVVV V9999 -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0|V(yVpsV pVL9x9499 0-LxMPP$@Ktc@| |0 | x p l h T P \ 4 0 ,  L H @ < 8 ( $ K0;V br+X+,W+9 -X1L PPH0SL a@ TG P. 00 R 0"QPU0ppW!00S PP ?l P ? l l0@ T0P v? l P l?l bb` -pP00PQ0SL. fQx X0S X"00l  0D@P%h 帥P  !?l s@ 1S  RU 1`l P@I 0BSI [+TZ+|]+t]+ [+l]+([+^+ [+ [+^+ [+^+h^+T^+L^+ [+D^+<^+4^+,^+$^+^+^+ ^+]+]+Z+tP l n@P  R0 !P0p@ PU `l QP@ 7ssl <@0S l 30S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01S 0\0#0 R0 P0p@ PU[qmq6q410@ Iql 0PM  0R !("( 0p@ qq q q qq;p9p7p00@ pl l0P 0p@ ppp0 000 S077@0bbHb$bؼb 8 8bblb bbȽbbbDbػbxbPb(bbhb@bbbb -LM@`l P&pPa Xa 0 0L( KlP UL P 0 0U2XJ  (0U(*XJ e@A0?P00S 1\1C40A\.0@D0 0l/P  0CR0(l $K( K lP U0Ṁ(0 偄 0`0`~ -LnM8@0T  pUq q q q ` 0!R 0S0S  R(K0CS d+0b+0b+0b+ d+P oKv=!p! 4@T1WS ,0    HK ]= 0!R !H0K 0S ("(oKHK 0 `8K  P  00 2=  `R.P 8#81 !df=!oK  1 PR`0f@eT@Q0 !  `A  0S !HK1 RTP! ("(oK  P9   01 PU6@e T @\P 1  0 0( "(oK 1  <! 0 !  0h00CS < <(4"4!<40 1(< 4!4 <,0 "(oK @KoK$\ @ l<\ 1 H0KY  0&HKm1HK  M<!H0K E 0? H0Kb -L_M` PR B @gK $<Y< 0 VpW  0 80S Y# 1hK@ <(K #00S. 0S hK$ ;hK  hK$Y  h0K嶂p 0 1p   0S  hK$ -LXMx t `@p*PPtW 0h W <Kt0|  <0K(K<0K<K|0 嶸t 0W t0 <0KK 0S x<KW th, Kpl t pW<0Kp0 hl0偡, 0R(*R& LPK h0_ R t  0 x00h h, Kpl pWo h倡0, W0R030 "SP f@Pfd x,0pUh0,   0R030 "dSP3 @ R t 0x < K| <K ;k< Kt0|  <0K}nt 0" Vp0 0#0Vxp@ \ R0h,0 l0 0Sl0 5Wb2| p0R\pK800 -@L 68h/8 Rp-L@`Pp! B9P @ 8p 0-LMP 0A00S0 B Q$@K 00 0#0Q|7K0 -L X (-"(L  0-PL@yP tPoP000e -@ML0,"K - ML̀@0@K 0 0 -LMhKP@ @pK7 00 RX  Ta1*080 Ÿ2l d@ < @0 hP P v 0XP0 ` X T` X"@TŸ0@ QTP00h@KPCPl  PVT0USPQ V`1UP @I 0X 0 `T` X  dNPl P0l 0 ;P0 XO K0SL `pK0@ &7000l `e0 pS8 0PU :@7000l ``y0 S P Pl 0SX gK(K vA<0 , @0%Ay kA`0p0b9b -pL@ 0   RP`0 0` 00!P U000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000 8 -(0 $ , 08 40< 005 -@Lz ;702 -LM,PK` p-7 ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z 5K1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F SV@  15b0`R1!~ '520VS  21!0#P1z_ +`h@ x -L@M\PK`p@4!4@0\0#0@@T(  a4K -@RL@M@P`$p j 01\PK@4!4@060#0@@T P34Kp4A -L@M\PK`p@4\ 4@0\0#0@@T a ]4KT -@RL@M@P`$\p Ev00\PK@f4 e4@060#0@@T +3K\pO4@ -L@M\PK`p9@?4X >4@0\0#0@@TZ  3K -@RL@M@P`$?Xp 00\PK@ 4 4@060#0@@T$ y3KXp3@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?ᖅ0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!t/PL0` p2RLH `08?>   c 02L!0Y/PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0B|B ?(KLH,0p S0QJ 0H 0 ABU bp 8L 890999 -L\MD< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_8 4 @ 8@`4!4P a, QU.QU105P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP a4 Q 8 <( @@8`04Q SPQ C` 0̓<0 \3R 2<0@, 0PD0 Z= 0d ` @娀ȟ 0`@PdK ? |0 | <,,l0 h@  @ 0h@ 嚃@ ` 0 F.lKP׃ ȟ0),@@ ?ဃD 00C0<0, 2R0S @3CL#020C2 0r@$bU 99P9~ -LHM\ 0pSPo0@0T8Z0LOPo P` 0OVʶ <4 S? 0 @ \00 P4 'DP0O8P 0@ ??00` Sp 8'08S8@``00`Q8 ςX  !D 08P 00`4PR@0 0  R,6^88@`0?0 0,p0P@`W 800@$ b $ 4 D0@4 DL# 00 08P5DQ8p`0/ 80 0cQ@< P0 1`08X3%@_Q8`0  0YP"004(KomUF\ 08>0?w \@ 0>0şp 0M?(K8 8$ 8@`$80@_ P LÙ n 88P   ? 0@3CL# 000\@4Q d0@S8p4 R 280PuW@`00P 0008l3 R8TT0 !000t84S`06C cB SWAQWS 3 P88`0 0jP 82 R8`0  0' 08 80   ? 0@3C0@L" 000\T2Q1 d0@_X@ TP S c6Q SPQCX K ᆀ8p1 RZ 20, 0PP0 Z5X K ᾀd ` 娀 ?L H0 嶀0PO`sdK&,L K lp h h [L K ` F.lKP `0', @?CP00080 ,R8TT0!000\ 0 =X>P8X 0  P , Pu8X 0 \ 0,w=(<>$bU 999<9(9TH99l9 -LM 8 0 L8`4 pP(K 08 P, D 0S 2 0/ @G00P00a0 S0"Q^a\0/ A "*P  d2`R\0/ *P@ 42 ^\0`ϊ1` Y 0@ QR0 <=0P ?1^\0/ 1> R,P1^\0?0  0<0  B 0 ;0@0 4D00L#040 Q 00C00 ,]08 0 ZV1>0  ?>0 @0 3C004L#0000800 <S=$bU H 9999 -L$M@ D DPAP(K@D P, D P0 $h0U 0 S 0S P@Q0N 0R P3,02SQ0 @_ 0 <@ 8P ~D @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0T Pt<Q800cO  vU80pY,@ %$b 9 -L0M L `LLH PPT P0 00S  L #PD D^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K Dn@ < 8 Z?+~ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00SV 0@ <0 T Z p T K pJQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADi@@ 0 0 R#A4^ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004O0@ d! 400C4000 c! 400C40$bU -LM ,  @_ 0 |8  0|4  ?n0 0|`, p z@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004zP`1`#Z ,zV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`!z~á,@yT, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP040 00 `@4p+ P @ 098p(K  XO ,0P>* 00 ,0 y X= H#0S0C0h0 K P 4 (0 0pP+0d0Q5h@T'dp@l0S 0l0@l0S%l@l00S0l0 00 ,0 H#0S00 n_0 DP 80hp0 0$8 8qe@ 8 9(9 9@+h 90 9P 9 -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P gz  10Ptpx7 K X\\Wz\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00(00 0K80`S 2 K Ze㼠 xŸ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] , P0S[ 0Z&`pQ d0 ctx> @SPQP#00d0  c6 0SQxd "t 80O`p X_000K n 嬌P' 0 S@P0(0SK ,AH K@00,K唌P,0 D0@_0 ^,ʉ0(0ĉ00D00 f0@000 R0к+b0 RꜾb M-L4M00T P S@0,0 00 S `3Qt 0a0S QARQ< D?@Ě@c.d 0P9y0@0S@TmT0! ( ?Q< 80 - \ 00,KTKP@ p,P 0,0 C@(K,0 4 b4pǏL H0  0 P@  <K?x< K @ D@ @P: 0Hh  h Q d0,s c4rct SqQP 6  0SpLLP0@0  @4ß @(06W6@ <4Sʕ 0@ Rm<@D4@D_@Ě0e.d x 40PS 00ŸD -Q4 0 w刳<K 0@@Uqʰ0Hh  h P d00@4# c0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 #400p004 00,K0 PP80S,04p4,85D 8 0  , (K,| 00@@^3  pQP485@0L 0p U -L+H 9\%P0R 0 R40Rh0 S8P0!RTcbC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K<@$0#= ,K ,0P@S ֮ 0; 0P@ @ =S  P@(K (( ,H 9 9 p-0LS@Pd0 0D0S  h`P p0  P ֭5p -LM, `20\%R64d 00  8@_d t,`p`p<@D_@,Qj`Vp` p, ,0C@$0(@[`4P8`,P0`k(T 9 -$0L Pp`  ㇑@P`@0 S@`3V u@P  "(0 凬 @Z -LM$0`bp 4PUMT500#0DPP00U  R@ $KPH0@T @  0@@Q 0Q 哫P Lh  $0`B:$0 -L P@; (p\@ K08@haP0 `pI@P ((0( R-0[.0[S "[0R4 0R R (04( (0K@P ( T (Q$K@!(@vi.. 9 -(0L(\;;@`0(KS000\( \` 2 1C0 00 \` @KS-bLb p-L M `d@ P0dpMwKp0d   F0d   a -LMPp0d0CSBl0tS q$ 0`T0 @ 0 Kp0S@t0@`Pt0sx0s4Dt8`r@eP`,0<`;,0@}eC 90dhr0dh X0d hR-d0( (0Q Sh0S U ( -LMt ( `( Vx! pP0KKU@(KPK UPd Xd2@ 00KP0 L@ @P <@ ,P Jp tp0 PK0 @0@Pcp1ZKF/Tpae0 Sg* RD0 SAla 5@xPp`q \ 0P@h1 dA 00V1KV1K  U!KU!KNK(QU![(KU1[  c B\( KZK 0l@P`0la ,Y/ R0 Y :0 0~?(K0S @R@p 㥻p t0 d 0S r0Sm0Y @ - `0 @PL 0pP0l/ d000X r0( 婁0p宂pXb 0- @0@L PP0l 0Xb -LM 0`@  0P 0lB(0p( P0@0 0x0 hA 0@儚[ $KdP (R0O0 @   vi p-PL0@Sd 0 d R `T 42pd0h d \0  0`ll 㖨Ꮒp -LM`dPdpW|@T0S 0@0S B@lj DP 0 !d R0 d R @00C0  B  0T@P 000   l9xm@00C00 0C0@(0 $@00@Zm -LNM#dP`0 Qp 0;;I ,0KpP ; z(K,0 d0 p t0t08pP 8pP D  0  ,X V000@,0   000  0 00pP(0( H0KT1 1RTA  H 0<0 00K00 <pP 00C0  B 0 00000,<@0 @ 0  ,巍00HKD 0 pP 0嗗0唗pPNK  0, 0pPlO ,00PgTb ᑕ@90 0 @0兕H@!0Re D\S QX <1 T  TL!R,Y~yPH @P(0 ~ ,K $s@P,d0PH1 N dL L\I LH 0RP0Rp $0 0ϓ P,00P00SR0S \!P1R 0 0 P0\P!0@ 00D1 D! R T X! < 0 .R 0 @HP 0RTQ H!4 R@H000  H!H0 00@P HH1  B 00C0H   P!L0S H 0 L1 0: S X!R@P1D 0#6 LH@PX1S) <\HH1  B L00C0  B H000L1 0LL, Pd@ P@Pln},l , f}00 0 0: 0K 6r@P~0^f dPP!d`Uf X1Sal ŤVG}U0D}~ 0S @ 0ݒ  0Q L yL0S\B@]~`p0Qn L1 p0Q@OdNOK P 0@P TQ@ H!00C0 H B H0 00.ln|XQ T\ 0P*0pS0|1 x5]?KP`(@K`Q \a hPDtQ pa X?*0S> F/ZK0@h1 dA  0U!KU![KV1KU1[ 08#8(0K0 Q PoZK p]K xl!ݣ!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0刔`1 ZKL0Sd `070 hY1KVKht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` (0@`"00YP (K 0#68#80C S񟗾`,h,|,p,|,x,|,,|,,|,X,n0O Po 0?5!,@ n@P000,K/00KL@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!f,0@P00xPU ) ?Q,h!x /0@00S0@ 0`p@ 0d Pp;t0S0G0E0C0A0?0=0;nPl D9\9 -L8MH HD D 8 d PX P% D0@T T+ T T Q H  0S 0SX0 0;0UT Q4 R0000(K8X0 @0@PX Q } 4S| D 8 00KpPP0XT0 P L 8\4 < (~ D}w, 48D0a@X@@ Ἵ4 PR]@$ 0Sc ,kL0t03U0SX000\ 4@00$@0 c4 n X !X< <0 0ãH< <0 0 ^UQ@X ,K<PPi`@0X@P3U0 X<PPWX0D vPPg8p=4Sx*P\,FLXP` U% PQ,IT~X L8? HPK 40XT0l@Q  *V6 P)X P 99x9 -LM  d 0 00 0w0R@4S@(K  P@ P, 0S2V1 4S c8R SQQCQ ,K h0N@T% $`(p,hP80cZ Q Dl ʼ@P,J,@ 0S$ x@0PQd ` ڜ44c cb SUaQUs8 4 0$h h0l  aZ!`P 0OTdXK @0S RP4S ;0 t p0  P0S 0 ڜ@tP4p5 c S\Q\DP@ DT|@ xP Ĝ   D0K\ 6P c P P# 0X@K@^P`V  E0pP@@0`YT0 @P0 @  I@T@ @P 4@#P c5, S.Q,K0M@P|t \P0lS0! ?KQWT , 800cSiSn D @,MIT0SsR|@4S:P$0  S(0S8K,@K0 0K h0 @VM@ ,@PI(0$  000d SdPP,4S:*3[Dp K4K L0S `0=@K.0<0K8 d 42K 0C3K L0S `01K0@ 0 0. 00 K/ KhA ,D K0@zupP (0d ` 00Q!/&pP 0! B! 01000,5\~000  *pP ,00q gvi9 -`@0LSPrp\( (0R r\pU  spP-d0!R" 00 rpU  r !0 00pP 0! B!Hrpr  pP g -LhMP @, 0 ( (0pR` r,0T [,P[xr]0] (K\ (0Rd0 0 ]d0   PY  SsP08dh d t !Ry 00qt 0 l0: S\ X  \,d0P`0 dhd ! !h 000LPP Y 0 `rPd0S d@C[`@[\ Rh@ 0000 sPh0! B!h 0)[0S$ q [,[\0\00 0 0L 000K O 0Yql0 .Rf 0rP  rK  rF0 0pP 0r`X 0R` \QS  Rp T0 l  Zd0S,Z`h *P0 9 ,K OP,dP` dd d R d `0Rh0R@  0Qp P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ !0[\P0Ql0 p T0  0q 0p d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h <Pp0TQ00S ` 0! B!`06Zd@p Q10C1 10C8#8S1g d 0d 000,Z00 0 0J 0K N0PE dh@d0YL0 a p R\L RYY0Yp[\`0h 0R@l R `02!R !`000Ph PG l R `0! B!`@000pQ7[p"` d eP d0!R\ Re fFZB^tl0SP 010C100000(YsL@HK! B!00 00 0 0 h @0 0@rP60[S#[0R  *  0T  0X 0C0< hA 0 0@trF 99D949`9$9vi..9 -LMP 0pS, d`0s0s0s (K0s(0sX0s\0sP0sT0s! (0$  0R җP 000 0T0   0000 0p$T0 R0 0 @t  (0$ dt@ 0 y㘐ST ៗP0 S R 0000R@ 0S 0;0Q 0S 0;0 p 0S S S  03P|,0s (0$  0R `P l0j ,0 6nPc80s ,0s (0$      `"0 D"0 ,2 \0 0@\0`@008qh 0,q_ 0FPPu0 (0$ 2d@ 0R P R 0S  O̖P   0:0000   0 0L (0$ _ fqO^0 S ៖P&!00sU80sR<0sO@04rr00sah<0sVX0s!$b -LMd 00 FVK p- Px0 @L0 `P d 000Xq0(W0`X`pXbA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S:\  aS* 0P-L0 0a00P00a00P0a0 -LM Pp ?#P  t$0(,@ \`,K 0` `P e"P  (KPih hh p-P`L@ @` ph`8 0-@PL 000 00 0 hH8 0-@PL @ P0h08 -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: @P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP:%@ P$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0!P 0@@ @9 -L$Mp4 W80 `PSXppx a @P3 $ (0 U.:,00V,K0K '!@T# ( $0 U:,00VR 1 S0!  $: P X !@T (K,40W@:00W8pX080WxpW*Xp -L4MPpU@80 { 00%Q01Sr:0a bU,0 , 50 R 10 P>0 PO``  0, 80P` UP(Kf4   40 ,80 P:P   0 ,80`P $P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0 @! 0 @ 0 @pp 0 @ X 0L @@@0*080 K09h9h 9h9Ph$9 hhx8 -L !Q 1S 01 0AS 10 ! 10A0h99 -L !Q09 p-@L !ƌ\`"S  QP P 0 " `p Q0S  0  0 00`pP NL999 -@`$0 L0b#6<@ SpTQ&0@ P PQ"TP\P<@0!PR00R0S0 !P 7"\ -LP@!ƌ0C  0S0 !h 9 -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `F}U -@Lb 08P  0R000 00 0 p-"fL@P  00b0fS 0S 000  p~|D9h9 -LM@p, ,P'0, Q@TO 0S64`V3(04 0  !( ( ! 0u,` ,P(K 9 0 B  a  !( A( ! \=,00,0 '`P  0`>PG, 999R -PL@PP) $F%6@'0p0!a @ ppf bPP@ 0 0!?< R$0(0$ (PlhTPpWb9hhhu 0-L MXPU@@DDT 0P, ((0PK0 re$9h09h -A2LMpc S1 # $0KⓠP(  $0R`0@P@RP0S  N0 000! 0 @RPc څ -LM0@C2A P # S<#Sp8 c 0KS`P0 L2 S<#S PQ R000 R0QL2  S<#SPc 㕅 0`0p  -LM A B2 \̠# S<# S@p= c 0K`P4  L2 S<#S PQ R000 R0QL2  S<#SPc E 0`0p ep p-`L@c 0PP 0S 0  0Sc `Pp p@Q0@S: p-PL@c 0Ņ`P  'U0 P c P`p p -`LPc 0㠅pP,  V@ 501 P0 0S1000C0SP\000@Tc 㴄`p h@Q0@Sڽ -LP F& 0S\1 p`@U    0@S/D P #c0P@=  0@00`+ 0S5p0`0 .'S @R 0$0 p$ S0c P@ dHTO`p`@0o,m(k$ib$rebbbh989d99 -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  0@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  095@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T %0PP (0"0  !!( 0 (  !!@TP  0PP0 P4PPd>@0 , !( (, !0x!喧@0  !( ( !@T0 00@S@ 60@Q30  !( @( !TPt LS@P @ IL(0H0  !( ( !C5  GP @01099 -`/ML&@!*$Kp 0K @ $p @ @@PP P  L 0 , !( I(, !  c3K -Lp`Q1PUT `pDQV@P'P@@P0W  X R`P0@P6Q @`T. P`P^ 1@P  W00X0S \P^@DZ(P`PU ~`bb 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 P<pX@ @8 0r0u @08 @ 0e0@g <b9 0-LM 0@S  0SxbPPd/`0 R000   , \ : P L H0 PKsP   0PKh p0S Ɵ0008@P4  4< D0#10#0#Xl 5h  Z< 14`01D0@ 40S 000 P008 Œ0L P  (00  !( C( ! 0CPK]4p h0R 7@0S} 0`.P w)W @400C400`0 !( 0&(  !,P0!!( 0&( !! , !(0 A0(0!!0pPK 97PK3PP@ 4| 0-`P@4p ,4(0D0  !( ( !!PK0ThŸp h0 @R 0400-7@  0-`P 4(@0!!( 0H ( !!4 O4(00!!( 0 ( !!4   @00 R( 0M(4` '(0  !( A( !<L 0 c<0r00C0&4p 101(04(00  !( ( !4+ <L 0 c<0DLre9h9999vi9t9h9qg 0hPK0 000$< @0< 00, D0 LPPa0X`p ,K400 0Q40KP P <0D 1 4 PKvPP@@\00SuUR4pO +4(0 ᄞ40  !( ( !@ \>+PK 0P04(0 ]40  !( ( !4_+PK!00L00 6@ ?4l 10 1O4<6 24*0  !( ( ! 4 <L 0<cjP T PK0f{\"+(00  !( C( ! PK0C 0PKF5@*(0 0  !( ( ! !(08<0 00W0X$X˞@U Q-L`pP#*@JV  0*P T   ;@- 6(@004@ 5(@80<@ 3(@ 0$@ 2(@(0,@ 0(6@P0T@h, 0S00000 ㏭revi -LM KLH0#&R*0R*0a"!B10bpyiSi -$1L@T< Pp`D0! R"Q )00CS h-g-g-g-g-h-P l l0R*QP 0l Q*QpP@TV \0 RUQ <0h><0`9@TGgbh -@L<0<0 - 0@L@*0@1b 0-LMXX0X P@h0*L @@P;@PK0bbh.  . Q! X -L΂n^P`Up*S N@ Pe?N!0,0 hT  h+pyib.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 vPP  @TF (18P  14@K0@ 4 0@ `~&P)4 R @Q00000 0J8 v4 R|v< e<@ P 8080c$8  00bbpyi -@dPN`@ RL @ppP .0 ! @ b -|0LM R h ;KK 0'x P0  1x-.x2 K hSib9 -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 n` c ,4PK@ 04@ 0P @# Z<0cX@ (Kb>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 `,K,< 80,  000P!4@,`T 8 ,:,0 @T 0\ 8A,:,0 @T`=4K'%(K@AEF0S ((1@ Ȝ0S 0SF4K %0C! S, 0 0 h0Q @ T00 ⤚|F 0 S ` `R`^<0,  04K `$P_ ## 9pyiphh$9vi -LPp 눀`0t@E 0R 10 P Ej)E*`)bph p-PLMP*@`Kp lP \0#&R*H0R*0a"!B10b 9)JUxpyiSi9 -LPM($rE 0R Zl 2   rE Pq~E 0R1   _E1ZhK@ @@8h`K|!p,*0 @P@0pP`8A1XPEP1 Q 0 hK!PR U̙*EZ ę"EU1h K@U@PQ 0*#1(K0@p  T0 奛00 @` P@DVph## bh9 0us-Pi9 -̡LM D Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp,0`$K0!&0@P0 `<P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, pt$Kphbb# 4v- -LMP0,Nl@T`p(KT,K, Lh0   P, 0 ,h#(9 0 p-LMP,h`K! ̃.# 0@P0 PKph 6 0 -LMp@ `.` $PK @ 0$@ P @mម K -.L M  8 ,0(Ǩ0!Y# 0@P(0 kP0 ,(KZ1P ,0,`0ap`p |1ph  a(RP4K@  0 4@ "PA,P0U988 ",0Z0S. :@`p4@ R00000  0  0 &0  !( ( !Z0C 8g,0Z0S$e,8 qbhpyi -LM>0`~0^p@0P 0` `P @P 000T 0 U 00 0P  K0 @P##l9499 p-LMP@ *|`|0 h0$  `0R0 P b 0K@P0 P 0`Kplrehpyi#b9 -P`pWL @P4 (0 0  !!( 0 (  !!0 j0@P`:P@`XW% 0  !( ( !F&% q Pp00Cp09h -LMℑ,~h(K!ph 00  0@P0 P>41W ,,02 0cP`0  !!( 0 (  !!08 L:P@zG`W 0h %@Pp0x Dh1pS .W900S,(K, `,,  a:h#bvi9 -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<~0R*0`"!B1 b 0 00  000 JU  0 0S(K0q@A 0`S00A ] ,$0 0S pyiSi9ph 0Q-L@ 00SD00D0p@-0\ @!@1Q% \ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E:  f@U>0e S 0SR F@* U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300< \00\0 Q-&:0@2 DP 0Q:0Q440Q*<0Q:@0Q:HP 0 R 0Q:0Q4^80Q*XP0Q:0Q4 0 Q:Pi$0(0@-P Q0#03 P 0S @@1 Q#3PQDQ 0T # 3P R0T # 3S RXQ T0#03P0S T0#03R0SHQ 0T # 3P R0T # 3S R\<0@T # 3P R0T#3S4P T # 3 Q R8T0#03\0S 0 0Pi-$ (,40 R:80\34<0R:@0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`rP nPU 0 00p 0 0  R P; X> P@0T 0` @M0S0P  0SPPP`?P ;0SP040S0p  0SppP@&P#0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ 0S0P  0SPPP@uPr@ 0R 00  S`0d0S0@  0S@@@`VPS R 0 00 0@ T`@D0S0P  0SPP`P6P3@y R 0S0P 0@ P 0S0P  0SPPP@P@ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0-,LP@P'0 Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP D0P X0P sV@ ;P@ A2P @Pi P 0S0SP0SP0S PQ00SQ00S -@,L P0 3H 0-P@Lk<0000hR< p-@`L^<P00F<pph05o -0L @+oho0n0vn -0LP@P (00(0`&<0p <AznPpP3U <0;;Kn;P0n M-LM4 040` P @xh 10 Sp!z3S0CD  f, , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g 40R8T:<0R@T*P* 0@P@T :,`P,  ` O(K0g00T0@ , K00K0 PP  740`@y z5, ,P `00T* , Dyi p-LM0@ (00(0xP`N;!mP Z;0 00 @0ۑJ;0 m/;(00(0x8 -QL M8 <0 4 ,0Q:00R, ,(K 4 8 @Pa 0ZD0T I 0ZD0JA$Z(0, 00Q8P 0Z? , D0@000 00 X <  l2 R $08`Z p1p!Q`!V< @ O l@@P, PU) < 00CS(h-h----h-4 s, 4 l0,0 0,0 4 c40S0Q(0VjW X0S00S @aW00CS0$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z D0@000 00 Xi$0Z p1p!Kb(9 - L@]T0000ЭD9 -L` PP1 @ pT p  eU $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP xc0S UPK0$0( ,0 0 $ (,@ @FЭ\99 -00t @RLBh+>00 0- L M0 \0\0\ 0d R@P 0| @Pl 0dd @HP:H 0@d@=$㊷K0hhre9hQi9Pi$98Ri -Z%ZULp`ec   < @$0X+*@0(PS$@d,P  << 6D05 0P004 48 ,0S  6  { E  os(P$$ bP!  b `h0@,408@0 dPtu00Lejx)T$0 -\0L@  Dh誸8h覸<5((\ P1\@0CP1hy68RiPihh p-0L1PU 5`P\@T P10P1\Y60\0T0000p0 P w@P \P 0 y@Pd0. d0d0S00>00 -LM@P`p & :#:S  0(  ćć  P  0(Ko t0 R>0>0 1001 !:# -LM ʠ,ʠ\ 0R lR >0. R 0^  0JP  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P (4d 6R0  0P 88`0S*#8h -L -LQ 00 (` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ Th-h-h---H-P-  0@x  0@  0@j-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0A@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @O  -LM0 0 , SpP 0 _d`V[0`0S0 U > SR UP *ZI>0^PUF  j:#:S?0Q<0S93Q6,  > r1  t0(!6@ Q 0@T< 0H(1,K`  0 @ T,0 000S   BR < 0U@(K 0@pW P ;P @  0 S  @S @$ 0SS S R@S``> 0 Y   @ SA S T0 P[0 < 0  p0`0(1 `,K0@S0` t0(!6@ Q 0@TS0 @ nXʙW@c 0K(!3@P0L 0S  @ Lj 0 CR     # 70 K;? -L,MH T H P J$JT0D >0 Z< *2 P08 40 ^8 0WP L 4 T TD8 0P4 O4 PsP , KPw ,P. 0< R*L!0,<$ QSf 0Rc:D0<Y!0000 . 0 0 0 R( Y0 Y0,P,  0<Q PH T8 LD8 L oV4(KL hV@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP P00 PH T8  040 4  -LM`@00 SpP (K 00Q, K!PP00@0S 0 0K PP000, R 00CS 0,L:0,0 00@SP 0 0 000@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -@LPP`p 0  !( ( !00C0, 0 0, U ,0 `$p0,0P0  !( ( !000 -LTM@ < `Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pbSi0@-0 @@$!( (P@@$!0@X - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P U\ `LV`@DPVʹ|֪60 0 R \ `LU`@DPVbhSiD9p9 -LhP \0*0  0P 0@ 0P 嗪h9 -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vMu(00\Qh!D0R A0R @0 Uh!D0R 0R d+ (0 0R0HA :#:S 8 r40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KS ghxgDhvihg99 -LMX`4 Vp@r V40S  0SQ21C  4000(K 4 Ph21C! c0 0 P; U, Y `FJ$&0RP08@@0D0H0L0: RYH 0  !( ( !0`VTY' 021C, T B 4,  婨4 (Ko裨塨4 0@Ph0蘨\(Ko蔨 h21Cc,0 g MbSib99 9H9|99 -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J Uhh@0>0>0 0,U $bggPipyi, 9X 9 9 -錒LM™0 @0 ,  0 @@Pg^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cl0S 0pePcUgm 0, >0>00 00 >000h 0 P00C $ (0 0, `\0T(XL(K,Dhb0Si5Sih 9gThg b 9@-0 .!( (@.!@@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 hh-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 hh 0-(0LP R0 <10  0  !( ( !00C0(0-&,0   PP@0!!( 0(( !! 000A(0 D0 0!!( 0 ( !!00  P Phh-000CS00h00`0 000 !(07(0 ! 00C 0hh -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!hD0QHP`0@K  0 @0 ,@ P'P @(KR1D0Q Po0RO 0@VUqq0@< 8 K VV 0  !( ( !h0 Q0  !( ( !S ghxgvihDhg -LM0.`p,@K 0@ , (@ q,^% @ 0 0  !( H( ! R000(0  0  0 ,@^$Kb 0-( L@4P\ U 0  !( ( !0  !( ( !U00C0, 0 , 0( /7QO?00S 0  00C 0 R00ƌ0  !l1(000(000#!0$ S0Q 1 !(0U PU 0  !( ( !0Q# 000Ȍ00C0tPQ0 p00  Ǡ00C0(  Q (0  0 hy` bh -QL+P`pW1 B(0$@`VP @0Ds(0 0  !( ( !`VPp(0 !G0  !( ( ! -LMP0KS4 0P , D  .0 P10@T2 6P` P `4 6000p0  !( H( ! R000,0  0 B 040@T(K勤!9 0-L0LP@L|00 0P Ed0 $0dE@do0h,*.Th -p0LSDP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 Zo!(0 R0  !( ( !`0PS*40 !( 0 (  !0(0   0  !   -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 003 (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# X T 0  ,0`0 0 00 T -`LPp@T6U#:0`V @@d$H04$ 00 F$0Nn0S |h@l0TX0&h<0d#8 # /nV8!00 0X8!0 (00```4  B4 0  !( ( !(@o$1P0$1(@00 7 p00p0&'1Y0100Z@D@ @幾`k,10,1D0!!( 0 ( !!0@ 0S", hp0S l0Qb ( 0  !( ( !000Ÿ Yn P_W @' ( K10Y㌀00H @ (10(144tKP@, , K00K @P00 P  4K4 pP00 @0  !  ! 0P& !娿(@0 ! _@ H00  j !኿50(@ gxgh -xLMp0lsPo!0PU` V0P!@ 0eS$S1011!,  d0S{P12d R@2DP^@"0P `lh0Q p2PU> 0O Q 0R0faX``W *T( X``W0P ( @0S; ^  0PGV 1<1T0H<1(K ! 㱾P 0  !( ( !pG PP~40A4  !( ( !( l  0  !( ( !( pGp0,PQ  \ RpndbfN ghxghh h -LMph1L0``V  0Ik``V 0C0`00d0V ,00 0B6C0 Px@|0` fyV@,08@Y4i(DzvihhThLh8dhhDhh -,LMh1  D0 P s"8p@Wk 0 00, 0 R BQ4 0"@?CSD00D0W0 #0/Q R 0O0S@PoVOL 0KiWQ |@2 ,0R0ShW 0T00000 0R0000<0 0 hxd!04P\L!8p@W@H1 pj18p0W1$00 ,@ x4PU 0a0c0KW 0 ȟ00X@T@0@PoPU`Q D0tPo0Q RO 0@V@U@P}vihhhVUUU gxg$!9b 0-0LMx hD0@QP `\'h0TH/P"j8@;P (4$0 QvihhDhh0!9P!9:( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q PUI Zg <80#6ZK:PT00 S) @21C!V c 80#6V*<0S0  0< "!B10b00< RA10aT  0Rp\1 dT,Y X(K R408 S00S40 0j 00 I00< c21C<c0<  f< h -pP8LP` 0@U*0V0 0 0 T00 0<00]Th -LM8a8hADTpP<@K* <0 (0 < 4 0p ,P 8 @<@](0 0 _(0(000SZ% 0垑$K %@PD剑@08 0d_hviDh!9h!9p!9:h -p0L$ RD@D }0  000 00D (:@h -LpP 0WoxhP 0WH5<ou 0$ 0$ p`P&`P" 80#WY 8 <0"6W *@k  `V  p 2 T8@<0$FPd  W0h$80 S%:S 0 80 S:SQxP tQ! ~`P$U |lKe@ lK ltQ  PS|@(K@x3x#hD0Q x0ST#t0  0OF*p#J 6|Y, 3# ĠP(0 xDt\PP 䂟P@K6Q4000 t0SW 2"hD,2\@0"0,0| 3@ Pp |r @0P H00H0x0S0 Pq |Pp@`*or0  !( ( !`VZJ|@(0Kp# pP| G ,0x;@@\,0 6|YpW$ PZZ Y **r| {0PS0S PX.Y p|lKy|Y b$gvih8g!Ce5g@ . -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p0h00  -L M0 S0d% @\0!@@@%w0P  0@ր|Ȁt 0l@ˀX㽀KhD0P 0冇,儇5g0Tih4#94Ti`#9`Sih#98Ti`b#9<#90@- 0S x06BQ*0 a("400@_#& U x0T -LM0 p>0n`Q70 a(@P$0S, p060>0. V  b 0 K@P0 >P  ah埆 K f 0p 0f#&Bp 0S* 0p 0c#&p x#9 P-0L R.  . h#9 00 0 -L4M0\ P `X Zj @<0t"0R 0S_ R@@ \&P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 h< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV (1@ XPK `0@H V @ T00T00S` T\r0 0C0 S V(K S@f X00R0S T0 `q0SpQ XB/ `Ph \T Xh!d (1XPK ! `#9vi -LM= - 0LS0S\"xpD0 0@`,PXW#9 M-LM 0  0 0V@`  | 0 x t0 0 |Pt Uvzx0KpP` WP 0  !!( 0 (  !!:@p Q P`|@TH 0P,0 P x`K  .P" f ( f & D0P0!!( 0 ( !!( } R 0Qn :`@|p\b R 0S P0000$Q0S0  =0(KT`p00 @`P@00 |@ T0K0@x0 t@ 0P |` c|t Q 00 (  0 S@@   0  !( ( !0#NQ3@`pQh=890!!( 0 ( !!& 0 S  pK, K00Kx@K00 0@K0, @P@T 0!!( 0 ( P!!T 0^I ,0TQ. (0n0  !( ( !.!(  (  !P    0Q0 0PP^P ,0TQ0 S  0T01 T900  !( ( ! ( 0\0$x Q {@Tx}O0tvO x千t勃00 0!!( 0 ( !!A f@xPT~h$9#9#94$9 -LM`0p @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| !P0S 0 Sj00    $Q(0(0(000 K0K0hNكt$9$9 p-LM 0@C^ :`0000P5  0   0 S 0 " P0  0 O0S    $ R(0(0(0  0 0KphKp0 KphNt$9 p-LMP8,414a@0TH>(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P> 0S0  $Q(0(0( 0<0^,@TKph, 0UiUiUi -PL0`X  p0W0 04@0 0h!04h!vi -LMp 00@"0O0S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1hK 0(!P"PK`| 000P `@P0 @0S$0 $0(0p0(<0k  M0 0@0$KMX 0T0 h 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@v$9Uivi@b8bhd0 +UiUi$9 -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U YP, + (00  !!( 0 (  !!PU 00 , !( (, !0!MP0 P^, PPU ,K 0PPP,0 , !( @(, !ᙽ,00 ,(0 L,0  !( ( !]$9$9Q00R0 S-LP P00S00S0P00=$9Q00R0 S-LP00 P00S00$9 p-`PL@ Pk00P30@ ep p-`PL@ Pk00P30,@ Lp -L(M PU`@0S 0S0S{0Sz XTH DK0EUSP 8(@#h"x 4Ÿ40S;80S89 0 Qz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0 CP 0 1(K 0 000  0, X,  (Ko04(4 S :0  0妯P @0 ,00 ,较l0S0S +P ,siUi -L0M 0 , ( SP"0S/`0So 0S 0S0sf ,0,pSd HKH`K@K,0K Q@P `$K 0H(K0@ @`PH R d040,0 ,w0S$[00S40S5 @ 0P@'P0`0S00S 40S80SQ* (@p0@4[p@30 Rױ1`00S40s80S(%,<4 4:00p00h!bviQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1\ \ R 0S0S 00S0 \ 0  2  0 2P0 0  6A0AS -@LC  %  %  h}% 0- LP% @ %  %D0000 0-LM@PK gT K0h[}gT00  \a00 PQ K0 S K0t8$%9 R-L@p`p3}R00Q KgP /.00 S 0bS1 RST%9 -0LS@ 0P P S T gPP P0P P P8 -@L@Pԑ -LM8PK`@pg0K0 80K7K]WP d 000S 40S VKV 0-@LTP@T Q 0S fP0 p-LM0P0CS0 Kp?9`P JKfNK0 (1K'!KN/KLP R000 0 0 D6 b$2i -@LP6 U$ -0LM0@T`p @T 0 R BXfPPT0007PP0P01 86 g$@P70P0( 00006 0KSf-KtPPP0S 0  0 00 0@`i? K6 #P1i p-P`L@ 6 %$0PP700  PP@ p6 #P -@LPPp# 0S 0S PRl0S 6t0$0P` W 600h\P1S d `Pt0$0Pa0S BZ`P000t/ i -@L0M(9 R0 00  0 Q 0@00|  BR|  00FUKV00S 00S40S80S \ keP 0> K.0ı8 N{100S<0SsiH8%9 -L4MP `qJ0 `0S01@T$ p@T 0 R00 4ePpWʘ@TW [ R Q000 RuK =Y@P000 0J K.0g 80@zsi%9 -pP00`Q0LMSP, 6H0SyUSu HPPoHK,Q-0S x |0S^Rq8 RUV H0S |0SQ|HG@[T h0s \@0@0@0s 4@0@0@ P, 2d00d  '0@0Y@@b,G0[S@0[S?0[0S[P &04"48#P (K: P D7 R0,0 Y ,U  v"0 ) 0(0&(00@0@& `00 |0 0 p0P0 P 7dSABjP d0 006SA_P d0 L,0@0@k0@0@\ K.0^ y/-0S S/ @Kh cP5 000`)0 K.0;  yqKc<9KᛐK圀K&@K04"49K$0 0 $0C, K 0KP 0S0 0001 xD0KcxKdKကKKcHğ\KdKcK&0L0 04"45KdK T@P   cP ^SCOK@c3( 0 d0K1 0K ! 1 0 UP, x , K]P 0h0S 0010H3 d0K>P rc$ß0 d0Kc KL 04!45KdK S@P   =cP_ SCOK@Qcd0K1 0K1 2( 0 ! 0 ;UP, *, K PC 0S0 0010X1 R x1 R  K.0 ^, 80x, WP0 T1 R 0 K.0Cd xRjR1 R  K.0/, 80x , KP 0S0 0010]Z x0 R@ x<&04"43K<0 RH  K.0, @80x;4b$bsi&9&988LgLg8&9p'9('9`&9 -LM`Sp@ j 8#QP 8Q [*8T0CT*8T 0TRx-P 8Q 8QUX  @P(KT8T L8TL 1CTK 1CTF ,8T[ t4T, 0CT( 0T% 0CT" 7T[0CTp:X 7T1 7T 7T P1S  P70S-PT7TY 0TX !H7R/PUPU  0P|P6T :60SQ 0S0S 00Sm  6T $0CTd6T0CT*%0CT0CT*!1CTM1CT 6T 6TP[5T 0T~U Xq 0s % S $0s % S  0s L@0@0@0s $@0@P0@5T 9,0CT44T 8 0CTW 0T=0s !P`Q R@ 0A0@0s PaPU`V@ʿ 0AP0@1P4TH 0TD3T 0T@>a2.@aP3T 0T6`PT3T"0P0d0lO{@ PU(P K Pa` P4K K@KK 0P 00 P@0[d0@0K@ [!|x0 @ KH0 D OP, a 0S,00, |00|0*@P,8jR@`2 `PG@D,8TP;0@P0@50@0@(RP)RP%U=0@P0@Q$0@0@#P &04"48#P R 6R00~ , KmRP:,0SIi i Qi $bFiRi Si !i '9 -R  S LNMR`1 \ `4Q 1CQ 1CQ -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I `P P@QJ@0`SE0SBpK_  _ K_@T00   1FSK00KC\ `1t 4 pX`K5 _XP80T@P40P@00L,0  XP T@ P L _P 8@K_0)D2X  XK _`!pWGpWD 0SY H`K _HP80D@P40@@00<,0 XK HP D@ @ < __Pp1X0 VOKr_  q_( (RKm_`!6 K_K`` d_|| `_\ `1 '1%!KS_T00   eK_KF_( (D_`!6 `F` <_00X*uF,_pK`&_  %_K !_4iiii (9 -LM`pV 83PU,P  0 , PUE 0S@T@T@T 0S,0S 0iSl PJk `2 R ,  P00^00Sd V0 0w,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0s,` ^RlʗRV c0 0bSPRXWVU P yꜱbb(gi<(9 -QL@R  UMRp` K\\0SY .SW T 0 \H .\F ^G  0 a?R0a 0PK0K_0[ K A [R A0B0S 00 RNK  K  []PK5 ]00 <0 &04"4  0 ]0 a 0 p-LMJOK`b L0 XPK@  ]0000#0KpLgLg -LM⨐K ]0 8 _ppX@KtPK`KDp0   pK嗀K,0 `pK_K|pK{K00 D b(K8H8 -1LS@ R lPGPp4 P2 GP 2PUU` J]P  D]P U" U00 0  00  0 00  00#0 UP#P P *]  ]Plbdb -LMPpPDa0S"$K,1@T T P0-@T2P0`0S 8 r8 r0S 0 @ P `p pP@ P`pr8`0S 8800 r8 q4bb(9t(9,)9(9)9 -LPM⨠K @8\  ^&04`"Xr00K 4 KyKK  0  Tn K0[yK00K` 0KDqX`K 0 `0KD _ K0 , @k  YZC _@P 6l0S 0 000JKY\(Q LKGKKK0 0Q00[A00K [ K  JP (K (N/ZKP T0 R @q,0 R 0 q(84b`)9x)9 0-LMl0SP *p0 S:6SK00CSP' 6@T @T 0 R0 K?Dh0   88(KP8 -@L0000#0 -LMPd<P T @0S0,3T8pKP<[6@@D0`K#D 0BK80K7KK@P 40S7 |[6@D#D 0BK80K7KK@P 40S h0  00CS0 2 Q 03h0 0h0KHH2 Q%PK PJ88b\ti -LM`\@pPe:U VT @T`00V00S 0S 0dS1!P00Sp` @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1P00Spb 8#8%QA A0T@ @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%QAAp0,$T!Xp 0~,$8#XLpGRp<8#X8#8%P @@ $K 08#8%XU\EPEJ0PPZ8#8%QA A0T@,K!Z<,$!$',, %PK0SP@ S2 0P 000 00 00RP& R 1P"[2[[0[0!0000 0!00P00S S 00S S00S 00S o o)9)9P PQ2 0 b0S S00S S0000S p-LP`000S S p0P P 04"48#8 8#H,P V 6S p00S p0@0p -@Lp`W00 R# R 00S SV 0S PU P z,P (' "(04"40W 00S R X _,P ( R V,P &04"40 -L`QPp P P^0SRPNV @T 0S/o A3 AP1 YZW% P d0 0S H@X  0 000 2IV* 0S' A,2@P Y Z+P +P 0z03R0S0S\4 4X, V Q Q 66QA P d00S P;H P00Up 4?7@P 4q $HA EXP P PU HA @Y HPP AO d0 HPA pF XPT0SiS(gi -LMP @ @ K -LMK,@ @P  R d800S80S 0S0K3A -L(MPR ( `  5 @T3 0S0S0SM (K0`PDpKW(0 C0KD K1@T (@T00S\0`0X*4 20Sp  p S*S0@P `00S0 $!$#KS0S S:0PbbLbbfi -LM@`J K.0px K.0P K.0$@0 PcKgx*9 -LM`p 0`0@W 8$H 2  ,塋 (K 0S `  H:XV @,: 0@ P, |! !=0@@8DH@T GTb T TIW 2@0  @T[(;/:/:/:/0;/9 R)P(8,H`0@W(8,H, 00KP 0 0R0% *` ], H9@P $(T2 T5 :T T 9 R^ 0,Pz,KzuW 2@08 8< @TW 8H 0@8H\U> 0@084HT TW 2@0( (, @T :TW  2 00@ 0@ ^ K.0@v 0L\\T1T:UTm W 2@0x x| ,&0@Pg  }T{0DSjwW " @00@@0D@ R|gW 2@0  U{XWN 2@00 04 BW 2@0H HL @TN,%0͌P8  R>/W 2@0h hl @T4'U@,H%0㱌P* W 2@0P PT @TU%,$0㖌P  <W 2@0` `d @TU ,l$0zP  D1W 2@0X X\ @TU,#0^P  Z/W 2@0  $ @T T ^ K.0y K.0sW 0<P[@,#0&pPy 1 0P p TP 0Q PQA @@AQPQA  @( D00 @PE E0 0 000f0C0 ~0( p(000p8X`0@ 4$D8X 0@ 8$H#@Vi4b.9O9 0-PL @R 0S0S R  DP @0$ S00 00+ZLb$.9 -L$0C40 >40HbPb@bb -QLM# @P`p, ( [@P 5", K  Ppf`0, K $K -`Ll40@!0c48 0!0c4<0P 0c4D0 0c4C@@D0@ 00Q0 00Q D;P@10 R 00d  SH,0 0C# L0 pPPP@ꫪ$b -, 0LRP*L0 OR, 0S*4@pD`@` י@X4<0,0 H8@H00 Qk,$b -Lb(Q0( ,S  3S001 001 R0P -L MQ@P 03SP KA0PP0L/ScL/L/L/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/L/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/\M/L/M/K/L/L/-P^P 0PKhr0 KhR0 KhJ`0 `tpP0S @0U5\00 P@)P~si(gix |8,ViHbPb b -L4M@PP` 1KQ<RO/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/M/O/M/O/8O/M/M/M/M/M/M/N/M/M/M/M/M/M/M/M/O/0Q:0K EV0[00[ 01PڦpQ: &0K2"[00SV&0[0(pQ:N0K( VH0[00Q:0K V0[00[ 01PvtWD.9 p-PSLMPK0C`@0%T  @0QPx@x -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K 㺄,0[S! -0[.@[01PY3T0V:*0K 㥄3T)0[)0[1001*@[PP<T000 -LM"0K@ pᆄ3T!0[!0[00QQ@P00U00S ; b1` T ` `U* 0` PᏄ@ -L(M@0 Pl 0(K0 /  )0Pllb 0 R 0 0( P @3T +T1 P PP p3T0000aa 0V 3T TP00P0 @啄ᒄ|2@P  (K<T<T င+T+Tl0 3  l0 2  )0㒕P0P0P0 @`0 $(,0<,4#:(K0 = )0vPllL@K @L0[SH S; ZB 0S> l0.  )0< WPllS8@Kc'  0IPD (@P  00Q|l0 1  )020SlDK0[0S S $KK0[0S(gi 0-0L0@SP ڀS S ߃0S00 0@0@ 0S 1  ǃ0T@00@ P @P00 0(gi -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K ?00 <4("4!<^00 >SM: 0V R*K?"[04"48#8 00@P  @+00h T`*0p@0@P0h @PC,0T0h `@0p@P@P2,00h (gi -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KP , 0R:0( ,0KpP , 0R0% *83U0 EP00@(gi9 -0LtM40 ! 0S /9I 0@/9I0S @ l? \? #=0@8HX " 0@/P`0@p 0'SP00`S, .P0`0@X0@ 2  Z(K(㻆P 00@X0@ 2   >! `0p0@0@-\a Q0ST @pTh 0Se0Sb0S_6at-P0`0@X0@ 2  $ 6S -10@#P (l,#= 0@,8Ha,'= 0@,9IV,8H 0@p,8HK 0S$0S00@X0@l 2  $ bQ0S` \G ^ ^ T 0S[ Q0SZ 6 \ ^ ^ 6 \] \ ^T ^00S S $48#80@\ \ ^ ^ 3S$,KP *P0`0@X0@ "800@80<@"00@0 @ ,0t0S 0S0S0SI 0S0S 0S$0S= >090S i0S d0)> 0@)p00S S1X<1 " 00@0@@T @T 0 R  B;PTo"00@0@ ŸR{ @00@@0D@XK " 800@80<@ 0)S(hP 40`sW @2 R@R00S 00S&48#8 0 `TX  ;P0S!h S 0S S 442 Rp pR: R. R,*RI*P 0@P  0Sl 42 0Sp pS:0S S:0 W 00S0 0 0 P PF 0 AP 9P0S PP  0NPA 40S " X00@X0\@`1@@P @D 0S 7^# ^@ (^  000Sp000l 00S Sa00S S_P W|P80`0@80<@40S 2H HL W H00@H0L@W siti(gib0b$b.9.9b p-L M)  0K@ `PP 0T Kp00e F TK :TP TP 0S0![ P P!K 0K8 -LM"3@0S0 Y 0 P0S "101202(K Y 0 z"00000202  :2<2) 00KP"0` ` ,< $4 !$ 4,̂&<4 80 Xpe XL 0p 00 000 00RT R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"gP0Sw 00S S00S S *0K{~"L 00S00Shhh tiP ti - 0L(S``\{pP{7Q PQA @@AQPQ100D000 00 (A(  ( ` \7` 0-0L@P U}P 1 0'S 0S S% 0S S  00ha(%P000S000 00S0 0 000S S 00S Sʚ; -@PLQ000i R5 h p-PL`@d{ U  U U -p0V 0 00p0V 0  Q 00p0V 0 00pp 0 pb -pL@60h00d0 -q``.Q00SLP@ P { i00/U00S00=U00S0d00U00S P F&0 0P { J001U00S 0P { =000#U00S 4P { 00403U00S 8P { #<pP8p &U=U~;U <UP>U=Uy;U <Ur 0P 0 00@ 9P 0K0H @PPx#00P@KS 0 !.0040 r 0 .rP @ PU EPP$8/$/////$UxUv #U U 9P Ur U$Uel0X  0S 0PXS \0(K  !0 P Ps@U; 1UlX7 0St0 @R$ 0@1S SPP@db[PP_X 0SX P00T5U+7UH@U[ 0U"q0 0 ,0P05U.P-U 0ES'.X 0S.0P,  P Pl0P00l0!l0P0 0l0l0P 00l0P^Pvi|8! (R-LPp( B(0CsP @@0S1` qP  0 0 7nP 000 0 0 0 -LMP`UvqP1 @0 0P <(4"4!< $K= 0 , 000nP @ ZOqpP ; p1^p77 0 @0 0 000  ,0@CpPp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`gpPP@q P  Jo@Pl1 (@pp , @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0HrP!  R4 000,0) , )<)00`,08^o@PP7@(K謌g -LMPPK p PK dK0 0 , ,W? 0Q  `K !?`P `o\~oX|oTzo KP uo 0R \ (K4Q  \K !`P8Q  XK !`P`Q  TK ! `P`\0Q S  0 X0 S 0T0 S 0 @@TP00(@CT0*8#8 $#$("<8#8"( 0T R UK 00T  T0 <00`0S U: 0 0 `  `00`\0S U) 0< 0 \  \00\X0S( U 0+ 0 X0X  XP P0S0K`P0 [@ H+ " B>+  L '0S$ 0S!0S0S P0@ 0K-`0  ,P2 0U  w`P 0SK +X00 @*\X0\@0K 0  W 80S< " d \0 $(:0S    R *8#4"<# #$# 00s 0@KP*0 xK0K*00K( ,0K 0 K0 ( 0z`P0PU L0 0@L0P@0 ,0S " P00@P0T@0 R 0S W1 0S- 1<1,0S SD Q QG 0 S4KP0K8@K@`P40 S  4 W h0S 0S ` R 1@01,00 @K ! B<0K&PP`Z1 @01 ,6 0S S 0S Sf ,W l0 80SL,20Sp  p S:0SY RWS;: 0N P`!P" #dP `P``g  a`PdPKAV &0Ɵ0 @0@,0S6 2PX0 0@X0\@  0S0S9 000 00S S%48#80P,00@ K-`P  P0S 1<<1,P " 00@0@,6SDş0 0 @P0@P3` 2P 3`X0 0 @X0\@00S60 48#X000, 00S6 0 48#80 0 0 0,d00 0P@K$E)@ @ K ;?80S44Q,$ 00S S00S S PS: 04O 3P40 X0S  ,00 40( _`P,0S " `00@`0d@P00lU",`x0p0@Px0|@ 2p pt , 0#`XPe 0V0 dlP(`,0S 2Ph0 0@(`h0l@@T @T 0 R B(PT  R 0S , N0S ,6Q00S#lP\1  00S[ 00SQ "48#8 0 JW h0S  4 V  p00 @p0t@P 00S S.(V `0 0@`0d@R,0SO " h00@h0l@D\0S(`0S%,00%(gi/9b p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0K@qP  0R0% *T>D0@P0  x0 01 x(gi9 -LMP`4 P~ ؿPz 0kpPr KlP  ( @@0( 0@0 0`0Y0 a 0* B'V{  '`0 0@4 P PPPPPPP '0S8 00`K0S P P2<2'4 p!0 0@&0@"K * K2@40P S 0 S% S Y00 @P(K20`K<2_'40 _'2  2B  !2 !` >'jj@Vig8 -@LT @T 0 R40S C R004   "000 @Tg p-TPL0Spb80 @`T  @Tph蚲gb p-@LK x04"40 d`04"400 PR ph &P 00S bb p-LP"0@ Ġ#Č` &P 00S 2100 40 00040phEbg 0-P0P@LMKP0`0 00P& 00@8ggg -LM 0R0%@P` ::VF  0S i 00S0SB S1@0S 00S PU PU 0 R B0&PU 040S 00S0C 0 0 (0KfoP ( 0R0%` *h)CS0`VhD@0$E D ¡0( #5#3 0/tib|bMb 0-|LP 800T0@  0@ᤡ0< #5: /#3 00 000uMb P-L \  R @T 0 S *01 0 S00@ 0(F# =9;9/9/9 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q001 1Ba0 i!P 000028!,10 1 Q! `V p p400 0 Pa p 0  00 00l0 d0BaO  04'40%4("4 4 b:Mb(b$bD1901919`19 -L8M@!P p l0S a`KQa `(0 K `P 00 R (3 -000 0` 0 0 0 0 0ka R N K.0j8  301919 -LDMpP@ Q 0S0S  0N`PK d ;`0 20 S<X 0PU 0S `(K0S 0S`0Z0S0 \0 h0 d <@Y`0S&\0!K ,2,"0  @T P P0 0T`   0`P d ` Z0 200CS+////p/0 m 6P V K.0i@ - 083@d R T 0S `Q02R 2S 0 R}h0 z ]x`0S `0Sh  02` Pm0 0 m sY 022:(b@29b1929 -LXMPP`0<4p d@ IP UG U U: U (Kd@  @PP 0S  P P$@ 40 S X R | 0l0X0 d0 0S 80(($^2P;d0 0Sl0X060@ ~P@< 3 0 00 `( UR 02wd0t;d0 h3 @ @ R80Rl aP PX00U02 0m :m0028 P4 ] 00 08WXU  ( 6S% LPK<4K&04"4 4KH 4 BD0 @ K@T @T 0 R BPT+!@00C000 @d0<@;d0 Pp_ tQ^ 0 000P 2S0ðѰ2 Xsd0  P6S <@K<3K&04"43K4, K8 40 0PKP |0 R z K.0g,08 L^1< Y18 b98gg/8b bg4bl299l0GS S S S 5S80 P0S0SPg  -L* Wd[0[0S S,5 RP 4-*L|P5 RE  "*A4 R *<K5P4 R0  *,U m0 00S l4 R  K.0m` m0D`) 0P < R 0X 2# S <0m @R@U@T 0m Q 0 0 @ 8#8S2d00d0 P @PTp P0  0Tf^W PaUc 0SW 0 U  2SO2"0 E0,U+Q  K.0_@08 Lk)U m0 00m \4 0 0 02A0"0,R00S d000m \P  @忝 @P4P$ 0U00S  "1!0 ^wd0  W 2 0N0 R0 4 40x  0:00L D00 /%4bgit79799@Vi`8979489898989:(b@29btP0S0SP@-0s l@0@0s H@0@0 @0@0s0@0 @$b p-P0L@`TP @T 0S PpTti -LDM0P\p 0S K Pd0 `@K@`d 0P0@ 0 \ XP T` p -PL@Vpߜ0`S h 00S 04!40 4 0 -Lhd Q 0 R  0+(q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@4b89$b -LMx@p8Kጪ PP` ԩTW80K0   K0K 0K00K0 840 0`,X@  @ Ԁ 90 0000 4 0000 8 0000 < 0000 0 0K8K0K0Kh0d |0 0@00 2K@ ᴬPqUR K1 R[(K0H@K0 0  8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ h0d |0 R 0|  R #310" cb ` | `0 R Kv K.0]0 DP:'`8 0 1'4b: QN99H99 0-\0L@PT@T 0Sx x0RөP 0xb -LAMp0P, p 2 R v K.0k]x0 l& (KT2@T@T T p0 x0x R❩P P[ HK @K(0H0KeP01 `  `EOK@ 01 `  !  ,0KP,P ,p00p0Pl00Cl01 R, v K.0]` K.0x@\ P K.0\8 0P y&,X 0 R X@0 R v K.0\x0 8 ]&g4b99xb@:999 -LMp0 , 42 R  K.0\x0 <&P(KHpK00 @_ @Kd`KGKH@KZTPK (\Kd@KcKP@Jp `  ,0K;PP%p0,0Pp0  t41@T T p0x0x R @T, R l0S0l0,0 R @K K .0T\x0 8P%嗨P `P L0 R  K.09\8x0 8`%4b:9xb0;9:9 -t@LT  0sP <P 2S@T p-L4M S@T @T l0 P @@2 R T5l0 p0K Pp00p0@T 0S00S@T@Tl0 p0PUK l02@T 0S00S@TQ@T 0@ 0S P6@T R 0@00 RKpuPp0p00p0 PP H1 R F K.0[x0 P%`P 0 Rp0@T 0@ 0S EP000000@TF K.0^[x0 t`$p0T l0 p00p0@To 0S00SxbTtisi4bx;9 -PLP h0@#10#T`p7 p@T 0 R0@ ⊦x0P 0bP 00Sp`0WV`|00C|0i_PP|0`0|0yPP|0p0|0 -L8Mp0 bPh d |0SK@P 0 R J K.0Zx0 8@Q$ژ pR000 tP @| 5T00CS0| ) 8 +$4b;9;9|\0 00 0- L@P |HP Pt0S0t0t@0hk0 -0L@pT&@V HS0S p0t0SPU P0S0@ 0S00Sxb -L8MQ0P`r ?R=0S8ڀ| PP2  VP@xt@(D0( @0T0 8g/@0S0 00Pl0Z  rb000$K @yS n`P P0 R R K.0Yx0 8`h#$b80xb4b <9 -LxM`PU1;xP x0 &pP l0l00l0l0l00l0l0 T0dT0X@L\0hLP \0`@dhl0 p0 X PP l0 PU|P p   | PUb 0 R0x0P 0ǥP 0@|  DK  0 d4 ^*h00 @00T*|  00 @ KB R0S ʝ |0b cp2^R:R40 x0S 4 @DK0@ 0@Q h00 d0S h0| #10#0R0SP p(K|0!0|08P|0P0C|0}PP] `1 RY r K.0Xx0 8,Pw"Jd0,p S l0 , KPP 0 R r K.0X,x0 8 V"3,,P l0p%dP,0hP,,pdhdh44    OR_ b$b 74bl<9<9 -LMPK@ HK dpK,P   `K    x@K0 @H0KG K0Kd0K Kc KhP 开 ` p @   ,0K,P 0 \, l0S0$0(K0l0, -$0L@T @TTti -LM` dKHKpK,` O  K K F @ B x@K0P0 H0KHKGPK0 KdKPKcPKh` p 崠 20P8 ,0K@,P 0 , l00Cl0T0$0_(K -L1pQ 1 RCiLl@T `P h0  V9 $00S0U  RPU00S"@TV4 U  0P <P 2Sq@nTV Ugx9! h4!0P <P 2S``ӷU `V`b4bTti@=9=9 -0 LRPbh0 *$0Sp" R 000  0 @T !P@TSWd00CS0 | hp 8  bTtixbx=9 -0PLrX@"`PN BTf $0* SB* 00 @5 @T6 R0000 0l @T P@T P @ 0``000_00  0``@TK2S 0 R0R,| P `H@+`,0 Rh0  Tti(bbo00C0S𠑴6@ -LUMP2<Kt p @`  a h0  0M(K87 <R<pW! 7 R 7@P Mp K.0yV@ K.0sV8 0<0[S 6 R <K K.0^Vp ;0[0S 0R0%p :W| d@KF P 0  48, K lN tK şf K 048#8 $#$("(@P@PVt@ pP &Kx  <(4"4`%&LT0T @0$%#5$, $%#3 000 0 4 8  <,$!$ , PKXpQ# @`Q01`P:0SQF T4 R  \`@P4@P $(/PQ 0S `\> 0 A< m0 00T7 3 R' <K K.0Um0 D2 ,0KRP , 0R0%p E*lJ@T,3 R  D@3 R $  @ 0<K@ @gc0S S 0 S [K# 0 VK_1K`K"  t2l! 01[031K 1["# 001K[KK0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q ~P@D[K Q@>0 $(, <4!4"\ U*@1 RP p K.0 U 0LE Rp0 p0R@1*TP%:*0 R6 p K.0T 0@z*@00Sz0 R  K.0T f@@Ti <0 R  K.0T 0TT@b4bgi=9=9$b6Mb|b,>9@Vi?99x>9>94?9t?9>9>9 -LMP`@p<K fX2 R h0  K(KY! $2 R 2@P K K.0T@ K.0|T8 0<0S80S- 0R0% @:P4 d@KH P#`\B 0 A@ m0 00T; 1 R <K K.0GTm0 D40S00S 0 R 0@P $( ,0K QP , 0R0% *H @ 0@ <K@nb4bgi@9d@98@9@Vi9 -LM`m@KP `R 00 000Sؑ ;K @@2 <2( &00*K"K)@K0 0: pp @@@@ 00`0 0 * B0 (`z0(0@@@@@@@ P+ m@ 0 @@ 00P 0_!0@0 Hm $H 2W04$48#("48#80 㦑@0KP 0@@%Z "P`00@0@"00@0@80@P @D$(KPJꬌg8@Vi-Q P-R 8Pti p-)RLP@` :R P!P 'J@p@phٵS S @phPP  QK0 0 0@P @@phP 0S0 S [@I @P I@" --LMp  0 ,0 0 Y P`0P @K3 0 P @ 7 0 :R$ ( LpP5 @  @,0K  P/  JY @K I(K 0S0( 0 0 nLpPWGNpP700 00 0 :RH00 @, 0 4@K 9P  4:H R d040,0 p0  0#$#̠`#8 0v00,R 0 :R0 q 0 R:(0 3OP P4@0( 㼪 l0( 20 ,K` 0 :R 6@0P 04 g,0S 2 0B0 @0@\ 񟗥C0XF0 F0E0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0C0E0xE0@E0E0D0D0`D0(D0C0C0,0S " 00@0@0S ,0S " 00@0@#0 0@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " B?0@1 A,0S " <0@1A,0S " 00@0@,0S " 00@0@t,0Sq " 00@0@f,0Sc " 00@0@X,0SU " 00@0@J,0SG " 00@0@ 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0T("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq80@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 008Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@p0`00% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_hk0k0k0k0j0k0k0l0k0k0k0k0k0k0k0k0k0 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4i4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d C@T*00(0S, 00000R00#3,05$ 02,0(00@c T: l# (0,00 d `4d (0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4(0,00 04d ,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S0h0P00ܙ0Й000 0X00ċ0X0ԗ000̖000Б080H0000@0ؘ0̘00V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,,'8&8%8j%8P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0_ T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aLl0S 8!EB C800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n8~8 n8w88!da 0SC{[00hg00kI00+ n8V8R n8N8z E8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0'8`(8B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p'8 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSP``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00b l0\00 RtZ\ R80 b0N l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z*8(8  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b05 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X*8(8  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00hl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  @8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p '8 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0H_p0`0`(8 -LM@ 0 0=K90``(8 q 0- 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@bbbG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  *8(8 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0*80818(8|1818 -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0+8@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q08+8080 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ BT@D@00;@9 -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbVin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  Q-L 8 p-LM0PK  % @`P  0ux0 0- L@P 0hTX90t -0L-p3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -p@`@PL L8P$1( <0D $00H@!0C00wwww 0-0 hA  $0|  LPUg0h虬0  !$ $ !8@0@!t1*4 t t!40L0C0$Kwi8gwi,uiwipipyi7bbpC9bbvihC9 -t L@Q00 V h W8hr0  "!kV bC9C9@-@Q >0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L duiui,uiMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ 9P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K Z 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KT p 8("(8Q, "*46*, (00S 0p pyi  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 X88 -L/C9 -L>0^0P0@ P* 0Y`p@00T*U U  0P J0SjZE Z p(p p888X8pyi D9 -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V 7 KSi $ (    s -Lp@@`  ,PᢉP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q+1+1,1-13p(KT80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ ttN 0;c0 0 5, 0 / 86,uiD9D9D9`D92800$*!00|P@pp0 R8P\ L0R  K< hp80 yi,uihyi 1pyixi p-LMP !. 0@;>00 `+.  0;>0 0p0 Rt 00PxP\ P0R  K@Q hp 00Px,uihyib 1pyi0xi@-X0@P R 0S \ Rxi@-X0@P R 0S \ Rxi01A- ($1$! 1@1@ !LP1P~A k0`A p0pA 00 0 0 0 0 0 P0 @@0 `0 p0?00?0 0yi xi$yiHyixi8yixiPyi\yixixi(yiLyiyiL1,yi|f10>0S00 q <>D 0+ 00)@ 03@pŸ0SxD &D JZS D0 @46ZS#PP @): RcP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 p"Q0S P\ 1R , K , h`pV@D0J8ZD0 0(K)68; D #;1 4Q@p(0SD *JD P0\ 0R , K, hpnP\ 0R , K, hp\0\ 0 <0 P04 080 2 <a 4^0\ yixi$yi,uihyi 1pyixi@yi0yiQ9P9P9 p-``LM^P @ 0000@^Kpxi p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600p pyiLQ9 p-!:LM@ P0S aPY :#d1L R@ L000@ap81 RHxx ! 1 0S : 00 0`p0 RHxP\ 0R  K hpP\ T0R  KD hp$yi,uihyi yi  1pyitQ9 -L; 0 g yi00 R$0 Q! 00K yi b$b -0LM0S | 0@T00 KKhWL00.*@ @@@0@ yi$bb b 0-0@0 0LP$0   R00 Rt qP ` `000@0  0@0$0)$$ yipyixgpgQ9 -L(M\T(L2L ( BϠ01l80 " 0|8Q} 2@ < KPr 1  4K@ B0P @4 0 @G)Pd4`VYH* @8`JVX=8 =$*(":X1 0"P- 2C 0S0$ *"%0L000Ppp0S P\ 0R , K, hp<   @< >80< S @@0(@ P@v(K4rgg:bili,uipyi$yihyi 1Q9Q9 -x3xsLMP00L 0, P U4 0So`@P E201^ 0"!B  APP0 " !B 000 Q P pPT UYZ @: JT * P (JAT:bRDB$r,0! 0! !0!0@1CD ?FD@b$J@$B!h!021Cc!@!08!81@ @@ rQ 0P 0P 0@0 P@D(KX 21C! cJ |gpyiPR9R9,uixiyixi`yihglgXyiwiyi`ggpgxgbR9gbR9gR9gR9ggR9,R9 0-LM@80 [00Pp0 R |@8D8P\ D0R  K4 hp`yi,uihyilg 1pyi -LM0@0b8#Ƞ\.P+ `0p$0`!2 0SP5 H1 R 0R 0Qp(1 R'28#80100CS0 0P\ 0R ( K%(+hppph0 R P\ P0R ( K ( hppyiTyi,uihyigg 1 -!!:LM1p@!T, $ ,0P`j0S 0j0(K n0P00  n  0|00000"0,0!B0L WP @0S=0gpyig - 0@ap@L0h!R ?= ?0R% EP 00#! @R00  00#!H0S  S 0 0iF0Svi,uiTyi -0L0Όn`VPp@ZJ%:{P %6;#;K jV! /0?0000?bbR9 -LM@\pP4 \`0`$: R.OP, $6;  #;1 P@p0 RP\ d0R  KT  hp00`$$yi,uihyi 1pyi0yi0S9\S9 p-LMa,:8#*! #P3 2C 0S0*  ! 00+00@Pp0 R8xP\ L0R  K, hp uipyi,uihyi 1 -LMP`0 M*&!*1! &::06S1P!B 2C 0S09 :X# P PpT0j0pVP*@  H08T0j0pVP:8#(0@0b0p 0S 00Sp (K0iP P\ @0R , K 7  ,hppyi,uihyi 1 -LM P`X%:*P&!*D1! &::6 Sp1 p!P!, 2C 0S0# :W#@@PL0HS H800jV@:p |P0SY0h@P\ @0R , K$ ,hp,uipyihyi 1 -!*(":LM10P"" 2C 0S0 0* `" !Q:0Q *0b"!B10b 0Si -P!LM`@V%F   0h0P> :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D00D0  )G#&R:0R: 0a"!B10b @PP 0T0UD00D0  D1p81 R $1P1\ 1R , K, 0h0p 0h0$  0S@ 0p0` Rl0(`0P\ @0R , K0, hpSi,uihyi 1pyi 0-0LS@P 0SP1000T' h1S 0 T 01S 0S 0S  R00l00 0X   0 0 00P$00,uipyivipg - 0LS@ 0T0000,ui -LM@PP @ p4Q 0 pR Q 0\` @R^\aT P @D4\ @T \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S c0S h3Q d3 R 0RL3p0 *t00t!t t1 $ 0R10K o1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00pyivi ui8gTyixigpg,ui -LMP8  80e S030#U00 4 %*4 %!*! %::86S1\!t 0"!B Pm 00Si Xh:#u@T] [ 0Sw$&Rp:0Rm*0a"!B10b`002p2B RdV4  0 5%R55SSH0SL L R0R01!0ATD0`0óD0D0` 1ZU   @D0`00D00Q=4  4 0 ZXpP8 Rw00S 40SD 40 0S 14  (K` PP\ 0R , Kq, hp0 S  0S l8  20S 80(j0S 0$ Si,uihyi98pyi 1 -LM`t PP X "&R :0R*0a"!B10b0<0 < p@@@@V  Y  (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< (#&R:0R*0a"!B10b< R$ D0< 7\ 0  \~ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN %RD5S<SH0S6L R0R01&0AT/ 5V2  <<<D0`00D08VI  @ @D0`00D0W@d <D0^ @[<0L < 5< D0`L Rgg5S[[4q 0S  l 0Si  4La0S 48  @ @p008 d0TDp0S44 Zi 0f *:$  0SpZ p0CSS P\ 3R , K, hp?0SA t3(<WL0P00 0P V <3 Z(30 0 \ P @ @p%R55SSH0SL L R0R01"0ATD0`0óD0D0` `"Vv  @ @D0`00D0 P`40 0Sp  0S r 1Lվ<<D0`0D09@ ռ@Pp P ] !V*   %8P\ h1R 8, K4%8, hp8 <0< @o 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ h0HK 0S D0X ,0H0 yiSipyi0yi98 uiTyi,uiS9hyi 1gS9 0-LM \ZP0 04PT@i80q,0 0t8g ui`i P-LPF 1h1S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0Pvipyi,ui -LM0!00Pp0eS P\5\, K , hp@T0D6P0D4@9@5p:#:S/,5,%$PQ,KP} '*(":10"P 2C 0S0 ,00*"%0㔤0@p0pTS*㌮hP :*#:"*S6*H4H$$@Q  0XP? 8000 %*(":10"P 2C 0S0 000*"%0㔣0@p0pS*LXd#0@Pp9X< PX43<#$Q,KP p2 0P 8, <!*(":10,\"s 2C 0S0j <:#5  X040 p0S]*<p0S <P\ 2R <, K<,*hp  8 21C <0f0000 ;+ 0 0P 80,0 0KPKpP\ 1R 0 K0 hp 4P0\ 0R 40 K{40 p0hdp*P\ H0R , K(c, hp%yi,uipyixghyi 1gh0yi`g$yidg0 !Р!0 ! ! 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0!c8b0bb,bi~i -LM3cDt#\0s dC0S XC0S ( ("$0,30p42 \P< n 0Sk @Pt OKㅫ2~Ϡ "K(2 $ ȟႫ<0 0<PPZ0S? ``p p, 8R ," 60Q*42@02 " 4 1 <02 P4 UJ,," 6`0 pS1娑XAa^\|;(K82L!082 08",S00S, 0ES꘬111h1h1h1h1h1h1h1t1h1h1h1h1h1h1h1h10S @0SN "8"8 #$!|tlu3}i,ui!c,b0bS9Xyi T9ʜ~iipyi\8T9T9@BS9\T9HT9~p@g00^0H PU@`D@ $@K(0  $ 40MZUzj K?bpyiT9 -`1LM0800 0(0K pP (KKpP@0(4 P 4 Kp0p , 0 >GpP0@@ 0_  Kp0 ,GpP0 00GHu 0-LM   $ h(0 @!P + 0.@ 0@!.@ @1:40d  4P@1L@E@0@!L ҩ$Q( 0800` E`0$0004 K0tvi51A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xh4bp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4S\b40 $ R ((0"4S\b 0\b( (P08#808#80$0$$ $P08#8 d@d 0Q 00 -0L 0+R 0  hl0l弦P \0 RPWh PD0D @^8[0 uiAi4gbT9 b1 :7-9T9 - LM0S @00匦P@@ 兦Px@pp0 8`Ph<oP, @bbT9@T9 @bbpbT9p@ Pp-L 2R 2 pB00b 0崦0l"S S00S@P P0S S00SQ000 S0 S BP׹ԹP0-S SpQ @00ACSC\1H1411111111111111111111111111111111111111111111111,11$11111111111111111~0Q00@@ T T0 H @0 8 ,0 DSBO4gibbU9U9 U9T9bT9T9 -LMPw -?)m0?`S P  A 0;0S @   0v0FS0S\ 4T P9 H9+R@9@)89*  0,),9 d9)ɟ000 X3I@ȟؘȟ bx @``夨 a,Ơ  0ڸP`XPP8 @T:00C)00P0c1*U,0 I@9#9S @0^:7BAD@L*̤0 1P0b*U0`X I$IT`ǟ0 C\LW:0d0C *0嬤0 C\ g:0 0C07*㛤ǟ 0B1\0a0:0 0C06*ㄤƟ0pƟ 1B0a\0z:0 0C0d6*lPƟ(0Ɵ 1B,0a\0b:0 0C06*Tş0ş 1B0a\0J:0 0C05*<şh0 x10b0x `%pT5dHşX0 C^#:05L*$nTA Eg2T PT?C E]T P4@ѷD0T@ ğ^N@P`@&l0@@1  0e@(8孷 :@ :@ :@ :@, 9@0>02 a2"&  0t8l5h+ x!l1$` $2 "@x!h1!1 1!1  ! 0 ,15#Il1 000\`0  (K0圷,嚷(嘷@bLU9,uiuiAi\i` p@@"gb1pbdU9iU9iiti bliU9U9xiU9i`iiiiwi|ihV9V9V9V9piV9i0iyi W9:?~i W9 uibUUUUQ @\P ph趴 0ph譴嫴20 @ 塴垴x嚴p嗴h唴20,X叴 L勴20,Y9l9Z9Y9t98dZ9Z9Y9Z9TX9Z9Z9Z90Z9@Z9Z9 -0L0S S S@ 0TLH @DSP 41Cc/qgZ9 0-00L0p0C0SPࠃ @^   0.020 ^D1D111181h11`111h1`1t1 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0"0Q] 0@PP7 04SP1Z00j 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P#PP"#P0 SP R00 0S 0 480 00S 0 480@PHO8 N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |{08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040[9 -LPp`@P P 000$ 0"U0P  0Pg -0LS@`LPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 pN00( R00 R 0(P0 00 0 000000C2Cp ڧP 0 0  r`P ` -0LSPpF 0SpB `P p=  p00 P600;000p PpP0:0 00 @ @[@B Z (0S11$1$11110[0 R 06P = uP p 0 00[0$ 00b $0[ |L Y (00[0 Y (00[00[0 pPepD9 0-Ld\P P1\ H1\00 0`Q! 0$ :P 0ă \ #\ @ 0S@ S Q PT $xhTP P HO8@b -LM0R pO , 4 P`,  VP- 0`S0S8 5P 4 ,P 0 0  #84000P 0R ,P ,(K Q-LNT9 -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@$2 p "20 x@T ^ 0S[ 0CS2 2 2 2 2 2Rl20  Rt20 Xv$ 2, 24 2 2 2 2 2 2 2 2 2 2 2 2< 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2D 2بx 0. 0SP U0S Ȩx 0PS@ QQ 0A0_S2l帨x P0@S(K>0D!0<媨4n0l0SP垨x0P @R啨x 周x 卨x 剨x 全x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ..l9l9|999999999HO89d99 Y99ܶ9Զ9̶9Ⱦ9 I9ص999999 999ĵ9е909D9 Q-L@=9 -LMp`P`' PPP` 0@00@0@T4| (0|`庠p000 0S P W`` P(K0S 2W02 :  @P 3  <`: ἒ:㾢V W`2 |000 Q <0 @R zR{ R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q`C 202202  202,04@KS!2(022003 S2ձ02ű0 4P 嬇pPY 80S 2 81 -+ 1`2 `   O}X1 -[`Rp0Sl$ PP 1!-2:2@2<2  P 0S:FP 000   뼠 :xxP6 40 RdΑP_< : 㺑P` W1@bPO8HO81 21180@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$$@P! 2`U,)`P2 00 0SxP CO` 8O -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Z@ -L M P`0p7P  P 2 L 0S@ 0S P@(K>0 !0Q$P 0 0P)08 <041S,0  p @,0@S 0pS Z I > 寠 媠HO8@b' p-0PL2`S@2@Spq00r S\ o80Q 0Q   0CQ 0-LP@p0h -L@P T, h:0  !  !u -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 003S0 @00h@040TP Hxh400$Pb@b9TX9@2H99(9 -RL(M000 `  L0 \؟pP  !PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040h>0"0H@Qt0@uL  R  pPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P  0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  @0s PH K `P`(KY0P`0P`˞P`ŞP`῞ NHO8 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` ƞPP p# @P p 0 0p00 R0 P0  !40 00pW00  a0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pl0 -LpP`@P P P 00 00G0P0p`0000xPJ N -Lpn`P @  0L 0'̠''D;0(T @0pPU@'@  p-L`PK@P P  0, 0f0C P0`:P p@ 0"200 0p0C0Ss0S 0@ <0= $$R 0A0 0; -pL@` 㽝PP p @P p  0 0_0C p P0  0#$ 0 pW 4^ 0$ R pM0u -L@` ㅝPP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p0u -pL@` JPP p @P p  0| 0_0C p P0  03 0 "4 0ypKW +݌0u -@Lp P @2 ^PP @) p$00 0` S$h%2%2H&2&2'2%2%2|'2,(2(2(2<)2[ 0  00 ;05@T0#30㡜@@\0 @00 30 0  B∌0 @:0@T00 [0 0030 0 + @T d[0 0030 0 + @T L @\0 @00 30 0  B=0 @:0@T0000[00 0""Ġ " 030 0 + @wTr03 0 "#  0 #200b[0 0030 0 + @TTO000K[00 \0#? 0o@A= [0 00 ;0`@2T-0#30 !  000  00\00    0 :0=@ 0u -L@PT `P e .@P \ T0 0x10 R0 `0  !40 00XDP@hpt0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT>0u0S+2+2+2+2+2 -Lp P`@P P l 00 P `  C0W0000&4 0`Pa p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K  p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P㛚P0D@T ;J -LMPp@`$@ ÚP   $0K `@@@@P $Q 00  00  f K -L MP $ 2pL@1㑚`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @$ K0 @ N -L,M@`,@ pIPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @㾙(K@㷙(0 @᫙ N -L M@`,@ pٙPP @( 0K ,0K@@@ p'@P,0S@ ,0 ,   ,0 0 R T0 G@o(K0 V@ N -`LepPL d0( 008,d 040" P T % 00 @00 '7< h@ $P0 0bQ 00  0  1R0 '88# '40$ 80 i f  Ԋ0089(8WEV92H9 0-@L!88#P!X咀@P 0 4( 40bS40 000hS{0Xb -LM  00H4292 -LM) 0#H4292 p-0( LP,@l` R62626262t625262626262 0S0C 0, 4+0<0, 8, $)a0O@Qph)p0 0 00Cs 0 ph40, $)a00%0K<0phu0<0$ 48 P<$0480 -L$M 4 ,000 0@P^4@2] 0, %PS 0 t@(0D $@0 0D@04 020@iP@@p0D4D2,  Py6 0W*(( (h(%D P`@ W :;0@!0 D004 ,1 p0,l00⤃ A00 <02 (K (Ko<0N& 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,3%P 0 C(Ko0u52 p-@L!88#P!N`P 0@ 0<0,04 ;,08 @YV ph z0"0<0 r~p %Cphyp@9Xb 8 8-#TL%`@P 0@ y0p ~PU y.0" "2 KtC  2<2Xb Q- L Q 0C@000S A  - 88LM#DP$~`P 0@ yp0 ̠奂pP@0T X,@ @@S 2Tp 0, 8~pP202Q ႂZy2T0-.2 Pp W T .72 02 ./pP2T02P 2p02 .p0 3Xb 0-PL@%̂%00 <2 p-`@`0 S00Ɓ0,( L0LP)%2  0\ 0Q000CO@剛4 |K (r00X0ph'!2HO8TX972d1 -LMK 0 KhR8 -P L d M@8 &}pP 0@ x@$K 9T ,9T} K0CT 0CT 9T 0S@= x9T '9T Xp9T :cPS2a2 -LM) 08>PS2a2 p-0( LP,@l` R^2^2]2]2$^2]2^2]2]2D^2 0SH0C 0<04S0<0,08;,0, $)a0bz@d* php0< 0 00Cs 0 ph40, $)a0Dz 0I00ph l0<0$ 48 KP<$0480p0 0 -LM8 , 4 0@P_82^ 4  , P0 R 400@t( < $00@04 020@i<Pp0L 820 , YF 0@Q _  0 U0&!:0 0D004 1 p0,l40y4 0 00 M4 0001 (K (KoH4Z !;0 0D004 0 p0,l40y8 2 0@Q  R0S0  8,@P 40O(Ko R 8#8 S  0 F0  +`D]2 p-@L!88#P!Gu`P 0@ 0<0,04 ;,08 @R V php0200<0<0pftp Opho@.b 8 8-#DL$`uPP 0@ o0px t@T0 !22 022  IjOxo ~ 2<2.b A-L@Q d2Pd2@d2d2Pd2Xd20 0 \0   H P< K0O@004gC 0-PL@IyZ0Ey0l2 -LMK 0M KR8 -LM0   LP * 8pP  8`K|@ a0 P80K, K. K- K7@K+PK |\1@0 P< <\ < 儌< (K 0@,Hp`0@ P D P` 0@ #D p< P`0@!(#Lp4 0 0@ ! 0 8 <04 1 #000000 N 0-0L> h0 @\PqP 0P1S1S0ha0hHO8 -L0M0P<0 ,0 00 40 80 pPF0FAP Pp`( @@K P 80K @@@PP @0S 0S 202 /  0 + Pp` Ջ@ 0 0S<0S< 0 Sk d Sh  Se (KP000P Pp`<00S S| @3<#0S 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@<P0 P4p`<0  S S%0 48p` 0P - 88@#tLMP'{r`P 0@ JmP 2 Am P0 fvPP p0W Z,p ppS 2WP , 0qPQ0"42 02 ?vm0" W-.208#82.]PP W2"02OP 2P02..0 tPb - 8 8LM#T%qPp 0@ p l P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,b -LMpT2pD2@"0 S2<24$S2ס(92ǡ n, 0!0Q000OO! I)f0" Z 2R PE 2=Y@ a#N0 00 00`ӎ0@728ʎL0@KV z %P00S 0av(K0 00   `  <啎 @0呎@bS2HO8TX9^2d19ud@vdܺ99 p-2 1C`L P hR0000 0  000 @TphLih p-P@ `L0S R0000 0   ph6 0@p-LP`St2t2xt2(t2(t24t24t2\@ 6P 28 1C0P `0p@@@9Li 0-0@LP 0 IPPU@0Li -0LP<`  "!0C>0 ,p00 ,W@ ~00 ,T 0 !!g p-P0`PL00@8 ,000T08 \p謄i - 0L 0<,謄i - 0L 0<,謄i -Lq@q 9$9 0-t0L M@P00< ,Q 8x @ P P  0 K0 ^K0謄i09 -40L M@K^0< 0\K謄i p-0L@ Py0< 0`\00< ,T 00<0 \ph00< \ꬄi -L`P@000Ty2y2x2x2ލT/ T* .y9 00 #00    = 2X0@`PT T .q1   p9 p-L M048PK4 ` x 0@0 , (` mP 044 L p4 00 , (` mP Kp{y@xv2@99 -L M4000 , 4 00K(0 @0$@  @@ mKxv2 -1L!M4 080 0@0 P,0<000 P#p/Cb1L#`31C0!A}R?b1L#`31C0!AL`DYx8 hl($묄ipbb0A@Mb494z299vigN  0O   ! -- -o00~N01@pdPP > 0d 0T05*JWZ/ Z,K 00K]P`0`0L00p0 R P\t0 \X , hJpWZ (K bpyi,uihyi 1(0 R 0R,g@0iG-0M  "!@Qr 40R PQ R f R0Π` 00P 0 R 0>! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ 0g0giii0 0ᰄiii 0-H LP0S 0@  "!@0  "!0i P-L 00 $ $勊  兊ȼ9 g9 -P@LP`p+0  "!0 8R  x3@P 0` p400P Y 0@@ 0 w 0!!L Jb0gм99  -0Ld0 SXr0@  "!@b@Rj 0!!0@  "!`0   ! 090!0Sf 0!!0@  "!C0  p! 000X!0SL 0!!0@  "!&0    000 0S2 0!!0@  "!  1  0  t 080\ 0S 0 !!biiiP 00(( 0000!Jiii -0L@  "!@0!!$ $0 1h,iii 0-< L0P@!!@0  "!0i -<@L4 u( 8 0 谄i 0-@L@tppp0@ ` @A10 P0@ 0  "!,g 9i0g0g -0L0@  "! RL 1000 0 1 0!!0g -@L`'0DS0 ! $40 0   !89i - 1L 1`?ops+J쐟0Z1 0!!QU PP 0@  PU0!! ' ?opsZ 008 401oLii0g0gii00 0 S & -@LP  -@LP 0080 R  0 Rp0 0g@0g 0-L04@H 0\T0P T0@P  0 0-L04@H 0\X0P X0@P  0 P-L@ 04 0\00S  gT9(0_P21H 0#R g(0_P21$ 0#I g(0_P21 0#F g P- L 004,0P ˆgx9 -$1pL ` 0_WRBA< 0 V (2222222O 啈` _WBA< u0  q o/0_W `O f0` 0` g9 -0 cX0_Pp21P@ CL0  _T21C h7g -40_P@2Lk 02g -0 `@TLY000_T21 CPN0 rP_T2C Pg -(1L`p@ 0R 8 R0 R-_T21I$ _T21 C0  _T2$R1Q CTP@ @040 $`_T21FR  0Rg -_QLM8 RY0 021H8Y``VM _YDY0 02QR 88D"0HRpE ?Y0 0,0 ,QW3 18 T0`040  40Q 0Up' 0 P` 0@  PU0,0WS ڊY0 02QH`(K8   _Y , Ƚ9 -LP p@@}``y@@ P-L 0 $ $,  &ȼ9g9 -T1LM`P@ 00#!Q Ppp@PDPP@PX0h}PpTX0 p  ,!0P\+  1P`+ 04 0004 804 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  [dD0'R0@Qbi89b -LM\  p]6"PP ` ( `P  !$04@80PP< 000 @`0`b -0L@P`!!(  BRH2@2L282L2L2L202s ,40 \(0\S0000 0, 000!.\08 \R ,0 \ 0!!tttp 0-PH0LS@ S 04W04 HP0 -PLp @`,,1 \JiKfLcM`0@0 S S:@@DR9T h0 \ ,; \8 , x0 -H0LS@ 4< 00H 04h-u2 -LM@00p`".0PP  K0 ` px( PP40D H0``$0K00 D $h d0DNFbipb -LRM@XDp@( 0 `( (0 408 0`P 0PKPL$ X$10l 0S 0< #30 0R:l@TP ml0 X `lP @_1C`V @l0 Y  `0lP@J1C` V@0@,\ SRd@0Sl@T 0s @l@d @Pl 0 0l00 l0l00l h0l$!l0h 0$1l@`0S]h@h@P`@@TK PD h0P0h!00 1P`U40S1hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ 0P6 d\ H0 QH0X0l TH  l0X`d 0L , `P@@T 54 { sT@H\ }Qd@` VLgL  0SUH 000000@H 0 00H0 0H0 L 0S2H 0=0@00@H000 H 0<0 02H3L`  0Sg Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@v< DH,80S, FDPD< P DQ D RoXPR@LtH080?@9H DD<@P/@)H0DDD@@@L t 0SqH 0<0<0H 0;0H0;0H 0T0V PPL0S0S0SH00000@H 000 H000H 0000H00/d P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qs00 0 0 0H00 R'4 P]@WD@NPH`B@<HD@L@0P*`$@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@yD}dDS89 -LM `c8QI 9L< cD cP1=@0(S@ U'c0PS@c> 0 cXX  ~c0 S"3"3"3"3"3"3"3"3"3#3#3#3"3< |ictfcp  bc`V.T\cPYc 0S780SNTQj$Nc0lorux {@~    3cX`V 0  +c0S S $cp!c 0S hc 0S@PD\ 0<#0C 4 c 0PS@80S c80SPp<@D@Ÿ^0" T0C@b80pS PTQ bpb0 b0 xb0 hb0 Xb0 Hb0  8b0@ (b0} b0 z b0 w b0 t b0 q bTbX`VoXU? R6(Kb-b*b'b$|b!tblbdb\}bTzbLwbDtb <qb 4nb,kb1 0@PXebU (Ko]b<0S SVbSb989X99TX9Rh99 9p9999X9999l9099(94989H9\9l9|9999999999X999,V999 999989,9L99L99 99 -LM0 4H`K4 8" 0 P @(KTK0 K` ;PH D0T p P L `0 \ 2  PhK7` S03h0 5* 84"PT00T  P(W` "R{T0K0K0 `;TT  0!"  `0  uPh 0 pP X0K0K0  0`\   0T  `0 \ TPh T MPd T FCPT @IPT :SPTd0p00T0 "RU31(K0!R!TK !00K `; T00T P`0 T K00K `";TTK0K!;` T0@) Ph TT > PB T h 0Bd Sh+3*3*3(3*3*3*3*3*3*3*3*3*3d*3T*3T*3*3H*3Pf|3@"!10@Q^T d00\$ H R$"R; UQ0U PX2QL PJ ,0S<2 RUXX P X@ _T@ WT0X1V/0\!,0  YP d @P d J00\ ypP \ uJX0X p \1P@01 U\! P1s@P KPDP KP}_,p1=@0S@ Wq_0pS@i_\ 5@P \ 2J0X0 X0 @0f@U_10@p O_WS8T8b,99TX9L9 -LPp`@3 $@ T`Vp @3 $@T3 $PP0033 p-L,M38`K @004 P _PKp3 0K40 K0 ` 0PP84 3T38 #40 4T3  400 3 400^Pt99 -L,M@QP` 3@pK 400 P ^@ K3 $0K40(K0p 0P@ ^@@$ 0 <$@T3( @400 3 40099 0-QLM@ Q Q 89P@YQ S80L >~9 h8c9@0Q9-" 0-3Ls@P 3XPP 03 400 400 4000 p-@L`Q PU P 1S WJP 0$@T$ F? R 0S|0 R 0S0 RT p0 4JP0 RpT84a8 -LM` P#0@TS X@T 0S0 S ]X@Tp]03(K0 0 S0 400pPÕ…Å ?00 P ]3 400$- P \υ0P xx]hs] υ0x@P <g]3 400 Y]WZC XZ Y* 0R WZ$@F? R 0St Q X P 1S IPO  0R 0R 0  P6(2("3$2# "d32h#"30#3• 0T2 $PPT 30CSC0!P0S \  ZP2 3 400y0 ,IP0 RT Q. KPu}0 R 0S\.Kxd0 3#0 d3h#0 3#2 $pP0 3#x0x d3#99,9h9L999T88 T 0 ( -"99 ȥ 05"2"2"4" p-LM`5Ps`@ Q Q Q xh99h@Ql0h5lxl@ll( 0Dh6xh9t 0-`5Ls@P& l:PP"P;l5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R GHP UX `b\b -LMp `l%0PU0XPU- 00CS0  0SQ400 @P 0QU  8Ŗ<Lņ P 0 400XPU[0`5$K0͆  400@P1:PgoP} 0D5VΆ Pl 0S0d5 ͆VNX5 @ @~Pd@D%k[ 0SX%Rd008C \1@@0C@D0C@̌0CR2 d ,0X 1@1 :R4 h 0X 0@lPP  0PqY .QP ,00 0x 40@X[Yl'L999\'`'9X'H$ $$l9L99:h'9 0-@LP0!R 0S EP 0 !R 0S |EP |0@TGD@T T \ 0 SQ 0SP00P04a8e8 -L*0 -0L  -@$0L $0 -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q DXY0 0  P0 089 p-0L`P00 ,@0 \ph*Y49 -L$0@P 0hx0h -L$0@ $$ 0-LP@T  0"%| 0t S0C1%$ 00P0#S@T @ @#rX9:d9 p-LM$0P@P `)@K\ 0W0H kP 00P,  $WKpgp9K39@O9x9G -L M0tSp!@ dW00 0P 0W(K0S00 \QJ1"000`p2A@P0@@$(P@0à, < 0<K 8 4@ 0P 8 =: L0 0704X(`FZH8l9999hI3bpI3K3L3 0- PL$0$00. $0$0  $0  $0|@l0T $0P@} 0$0$  N' -LM@P`p 1C0 ` p0@@ 0 0-P@L C 00000 PuiAi  -40LS 0 -80LS 0 0-L<@@T0 \400 D0H 0X0< <0 < @09:9 p-LP@"`T 0T@Tʢ?T QT LSpLpQ T Cp&+L9 p-@LP04 0 @ 0( ,P 94PD Hy

,Kl 0 1 x\T%'K8@H (0,0 ꘆiTf8tf8k3f3xe3e3 bbbTX9D4g3b,0 R 0s30S\i -L0@$ 4(001 p-L0P8@4 #h(@T008# T08#004 Xp 0-PL0S 0S @ 004(, 0 @04(, 004(0X004 0Xb 0-PL R0@T 004$ (000$ 4X R!0@T 004$ (0`004$ X004$ (0 084#8$ X0b -x@LQ 0 R 043$ XQ 0 R 034$ Xb Q0-L@ Q 00S0<00PU&T00S0 0@S :P 00S0gb:iQrg9,0 S0P r 3b 0-L@L0PS 0P  q 30 0h0b 0-LM@0q- 40,R, 300PP0 R   y0S x8hcM0S  h0<8hRM ,0RB v$\i99@i,u30 RR\i` 0-0 P@L 0X 0X 0X0 -0@L P` >Up U}LM0S $ (@08#8$ Xih9 -L0 @P` pT T M (l0U008#8 U08#8 Xi=U00 X89| p-0 `@PL (U 10#pU sM (p\9 -LM pR`@a R"w$0K*00PPj$0!$  0X$ <X$ 0X$ 0X$ 0X$ 0X$ 0X0$ X0S $ 0X$ 0X 0$X0 S0 0$0 0$ KB$ `0X$ 0X $(0X LL@b9|90l 0 d0R R P)0i 0\0 0 0C 000 0 0\i` \z3 -L@Q (K9 0 40 08\001}3$}3 -t0P L@@ 5004 , 004 ,@8b p- 1L @P0`40\U {U, 5wU sU& U U pph\5ge04 d0\O004 \004 , pJ5ph:8b -t1LM h1+R ``VpWp@Pw, 8 4 0 0 5 ~@ y u@ pTP 5840 ,(KoruiAi -2LM P `0 04p\0@4 1\50004 \004 , 004 , 004 ,@$PK04 0\004 , 004 , 004 ,@T5{yw0 04\$0 ?B#1 0 $  0$0 $K8b -(1L R`P>U< 㔿0 04p\0@4 0\5<:+004 \004 , 004 , 004 ,@-J@8b9 P-L P P 0Jhh9 0-t0L @504 L0\0P 04\00500h8b Q-L -LHM044@ 0P hIIhbpA(9TX9D0  0S S S 0 S`b 0-0L  0S%P0  ^ ^0 PS n @B21n@P0(0e/"b0 0`bQ0 0``bQ - L0S0@T L0 T,T 88S 0Y 8h8L#8~4T6 \b@B -@Lpn`P@屿PUPV0P0 h -sLp3 -@LU^h -0LS@ PPP0lTPeq0P 0P>: Q-LA  -LM@31C04`Kq@$PK4 T T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -L` Z 0PS @@\UpWPPU T1 eP S@ HUpWPPU@堠TFPX#0S9 0@S0p堠0W  P0Ӥ0 P00 o3P@QP 0S T  놺00Ժ0S0 S@00@@PW QT00D<0h40Ba{ dh8::gfff p-L`aoP`l@P@U@1T c@Hp5@D_YPd T:@}p p-0L @PS `%늰0:0%0`:0qP =% ተ~%phb4g p-PL`r%p`h@ 0 0@phD p-@LP᯼0`S 0S 00p3p00 -L -L 0-LM@se Z 0s0 Z0 X0\ 0 P`0d h PiP h\b@0@ @ <0K0H9<3P9$333X33t3qgL22Mg>PA-tr MP`U`2\2PODl28Ÿ1C 0P ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00wbgVUUUi1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PLmP iP@0dP0h7 -L@Pp`PP LPTU@ p-L`n PPPUp     @ T 0 d߆ 0PPP^p: -LMPPPK 㡺@ P+HȽ101(pKa` +ѻV3T0\ `S( $  `X( $0@@"( $0T``0\ (pK~`H啽 00!00 cCa0 ᝻V d0SlhQ tpp@W (0| 0``h$0 0d( da$ <00S ``V:QMbbi 0-LP!@p0hb Q0-L@P Q 0L0S 0P00:H50 ㈽0L0S  〽H%H0P00 -@L00P0L0 0-LMLP@U K00 [HP 0P0T L0  0Hܖ3 0-LM P@0`ؿ[ӿVοQɿD0D0 P rDh 0=/K$ 0y%XK03h8TX9db 4R 0S p 0P p0 P p-L M8`K@P  /T080K@ 002K2K0 K1 K\08,0 !P D*D2[2[   !DKpD0u\999 p-L M8!@0PSKp8`K .@3@  U002K2K0K1K8 KX08,0 P @C2[2[  CC0u999 -L`8P P@ P PD0pW  P ,..( 6Hq0@00;00000Evv8!00H9B@9 -LEM$PP`81 ,8 8# * &pP 8141 0 S0 (@ᴄP< w$0Qg峄 0", 9P<,@`  0O 0 @TPM $" \04!0 ,1Ss0@< 0@P`ȡP `0,A@#T@!Qa ?8#808#8?@ ?8#808#8?08(08$0q !O P P (1S33X3d3p3S(KCCC,!0 d,! R(0!8.0OP`8 0(1KJOK,8 php㮴@*b 0-L@P&0&0l3 Q-L@ Q 8188`媺8818D0-n 1$0   '@:4g -LhM0<1t 8t + 80]408!0 0#  BP]ωmK@ R@ T 00@ (P R00,?881S00t >{? 2 @ @@ @@;@ 2n/@H_DCHS%0P>yO0@DPKN fTb )088#8 ϠD K8 3KP (t>tLL   0`&01$K1P0C0C0`|0 0h |`@PpHP`#H8P `DSHc0%hyO`>0@DPK DPK O)08 Ƞ,ȠD0KU ?> K80 KJP tp>0   6) 08 Ƞ,ȠD0K ?> K80 K1P tW>tS>0 0 p_DCHS%@ P>>a@:9999P3 9d999FB,98 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PKO0 8#808#800 0 B4 p8ph p-0L @` P 0(0z08#808#80 8 ph>K -L$M# 200l1 0(K@,0 PLŸR00 y00! (Ÿ0 (;00 c #;0008 < 00i10 > 600F 3@C 8^@4@ 0  @@Sd;@ ,0P 00 00! (\ 40S 0  0:<8@00i10 0 >@0400:@e3:3 0004 \XPH}<,(ȯ3909@9999P9999 -LMp 200l>@ TP 04 @`=Up20 +P( 00  G0@6 0T R P0000r P 0 [:000tU@ 0@E:0@000]$KP 0  00 00,:000G000>0$ P` 0 0@  0@$ 000$ bQڰ08\{P000  0 @9:ȯx9999\99 0- L0P@K0h ȯ p-PL@8`P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40P0ppt333 -LMP \`Qp @p @T V4 0`D @29&T(  (9bbl98L99 - 0L00S@ 00S00 00S0 0  -L M<`Kp@ P$0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `#0  @ 09 K!@0K080K4  4PP 0l3K0P ,` P@ 3 K ^0@0K18 K40 9 K3[8#8} 3 #09 S" 6 04"40(Q(A 04"40Q. 04"40P33(( SS3 'NEFX -L⊪ 0 hC9b 0-LMP@T |8)Lwd0d`0a8L% 0K8IP@$0$l8 b09:iQ9b 9 -LM0$PK@%@(%@@0  pd#P@ W ,0;,0|1  $K(PT,0K` 0z5, A$,t0x@,0K40 0@ (P, ,090,04P a@P04K@$0zD0e/", ,, ,090,0 D@qg -LMPpw@P 0  (希0@ `p"@P V ,0;,0$0   Į@qg 00sS 0S  -(0L\ 0\b - 88Lp#0\  10<P \ l0020 \b|b - 88Lp#0\  10<P \ l0020  \b|b -LM0@400 -L Ƞ ȠX,^   <P 40\b0$ (0  P-Lp` 00PU R ,@l020@T|b -LMpZ0  PU S00 ,0K`PDp@l0, 20, @ TX(K|b  Q10<P 00p0Sl -`0LM R L0 K0S <0S 0$0  K0iii 0-X0L P0R@P 00(0S4$00S 0iii0 bi0  bi3 -`0LM\ L0L Q <0S 04 00iwib Q-L -|0x 10 @Qx L< 0. -@Lmt0  0t0 0- 10I,00  i - QL M`Pp1< Rp8@P" 00K4 K40 0( K,0KpP $K(04@KP  @t@P400( p<@[p0S ᜦ04p0 0p@l` -@LMTPp` 1Ta !1T` 1T @1TP 51TC 0T\@   00 @ 1CT$ \1T00 R ($ T p 8D@P/  ^0T i0Q@P 0s0S i{i 000S 4@8p4 00@P `WUW$NWL`P ɤ0 S0%Ll2@l 0 0!rT@2 !  &0`00S0 W00P0S@T R@@1 `@Ꮴ#`T9 -@ LP  0 0 - 0LS@ 00 0  000000$ 00sS 0S Q<0Q 1S \0SPb -@0L R 000S 0S  0ggg -,L\ \ gg 0-0 @@ @ @ @RLP x0S tp 0x@0R Q0 0#0@00 SQ00  0000 00 S  0-\ LR@P 00Stp00  -0@L0X@0X00 SX0S -L M; S V \P\ 0l@L00Ta @3P ;C; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00@0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P + 40 9 PUV ;a  `=0SL00 RLP SBl0V ;   0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 KpggbggPH 0P 0Q `0SX0S   b -00 0LS@ \ @ g -|0LS@PQ \`V p\`Vp 0U\0 pP\P\`U  r* l*d9|9 Q-Lc*9-00 Ƞ Ƞ,1XP b -LHM\@`  #(4\ :40S P 4\! 63\k D3\ 3\ t  0pP3\ 3\ 3\ |3\@< Sl$0< S<1S`P  P,3\= 2\ 0\o 3\PIP2\ 0\z 2\2\ 2\J 2\0P       00  0P0 0 0 0t  0pP  00p!0 N>PPC  #m 0R 1  i> PP@[0P     00 Nl P$010H  0P0  =t PPz .  l$Gl 0PPl1W W WW @W W@WWW@ W @bW WWb -LM\ 0\ 0\ XP, ,1 P0\ 0p XQ 00S00XP ,1 r 0, Q}f~fvt|f 0-LMP@@0@0CS088@- @.@b -h0L Ƞ Ƞ,A0S 0400400CS0b 0-0 (("ALXPU 0 X0 q`0S 0 0 PP x(b9 - (L(" PP#0AT PP 0SP `0SX`VP 4pC0H0PP X`,Pb p-X@LT` 0 ! PaU  " 10`P50S0Sp0, ph, ph(000S 9 p-0LS@P`(0S  l|PP\P l0 $0Q Pph U pQ 0P`0ph00. 0-@LPQ 0S \P l0 $Q0h( l p-`0LSPH0SH|0Sl1  X@T% 0S" 0`0CS0000 R00H50S80S/0 31C jP! 0Q&ڬ 0 S00 S P0 p00PS'0, 00+g:9Xbb 49,0 -@@ @$@@L0@gg -T@PL p `D$$ $$ p0 g343g -X2 00| 0PL@P UX&d0SP l l0@ 0p l0 0Ct x0$PUDp`l0$ R0 X. P*  p&Pl  0_Pl4(10S,&X P0P m' (rl  kX Pl Plp`md0d@&H\Q D}& 4x&b9g 4 9bbTX9 9gT9<9h90Q 0`c  <8S@08#<@8oS: S>; SP 00Sh8 -L@Q (4@4h444000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\ 4p?4>4p?4>4>4>4>4>4>4>4>4>4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4>4\?4>4>4>4>4P0 S0 0Ô0<P P0 d (0812cS<00<00 Q00 B00  000 0 \S 0-L@80 080 -0L6S@ 8 -0L%0C@5S8A4@4@4@4@4@4@4@4@4@4@4@4@4@4@4A4A4A4 A4@4@4@4@4@4(A4@4@4@40A4@4A4@4A4@4@4 A4@4@4XA4@4@4@4@4@4`A4hA4@4@4@4@4@4@4pA4@4  8  0< 10,p<  -@\, `0L<0Y0CPD L0X8@ HPT   0S \0 Q0 t00 |l0 p xh  -LMP@`p00 pu 4 $0 000 00PT0p0\0`0d00000(K000 0i-X0T $0nQ 0 R$ 5` R $0 R0d0 0( 0CR0d0( -LM 0A^SxdF4E4E4PF4E4H4E4E4H4H4H4H4E4I4I4I4E4E4E4E4E4E4E4,I4E4E4E4E4E4 I4H4E4E4E4E4E4\E4TE4E4E4E4E4E4E4E4PH4(H4H4G4E4E4E4E4E4E4E4E4E4E4G4E4|G4|G4|G4E4E4E4@G4E4E4E4E4E4E4E4E4E4E4G4F4E4E4E4E4E4E4E4E4E4E4E4E4F4F4xF40(0 , m,p (d0:3iS<00<0W8\P ( 00p (<0  0@ @ppؐ$0L P1 DHp@tPx`|0hl ( (p (p< p (,0< l0< p (,0< l0< p (,0< l0< p (,0< h0< p (,0< h0, , $pP, $p(p ( pz@@( , t,p (@@k@@( , e,p ( ^< p (,0< 0T< p (,0< 0J$T00cSf` 0AR$0Z 0SW (0 CYpp0d0( / ((0Ap0( ( p#<0p (0<0<0p (0<0<0$ L<<0 x0H (|@P@DpPt`p 1h l0  @P` 0ؐ (,0Ap0 (p0 (pd0,  p-0@0CLSJ4K4K4K4K4K4K4K4(L4J4J4J4J4J4J4J4J4J4J4J4dL480 S 4( d>,0`Sc PBQ *0S  0 SQ:(( d>0Sh01100 p0p0 Sa`(d0WP00@0$,00( 0d 32aS 0(0d( 03,nR  B,$0 <, <00<0l010p0/P<(< -L@Q O4N4N4N4(0$ F<0 $0(0@hbh -$0@0(L\P  0\0`P  0`0P  00P  00P  ܿ00P  Կ00P  ̿000T  h¿i p-PLM@P`@- 040 \ 0d0 `   ݿ  ؿ  ӿ  οKpG ¿P    0 @i -LM, 0 @S~BTP8<0@I`0K 0  ,KPF `00\8@X$1T\0 P 0 (KP P T,00 0 B,0 0 <0@000( d03$ P ( d03$ P0J0|b -QLM@ Q Q d( 0D3>b$>.D $ 0 (0Dd $02  -LM@P`p 0@000 P! 0@@` 0@@` 0@ 00 000@p@` Q Q Q!R<00<0 ,R<0<00<0 0-AL@<0)Q9V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4DV4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4V4!R@P ,R @PU (0@$ 0<00!R0 ,R0<00!R0 ,R0<00!R0 ,R0<00!R 0 ,R 0<00 -0LS@ S 00\P  ^ :!0000C9Q^0/Q\\0 0 C^\\0 0 C p-QLMP@J Q: Q `P $ 0S0d0x 0( 0CR0d0(xd( 0D3>b$>.$00a`CV D0`P $0  D0`P  $\(0D d0 1 `P $ R  D0$ -X `Q`ppPgUL@T 0D0T `0S UT x`0T ` R $0 R0d0 0( 0CR0d0( -@X`Q`ppPgULT 0T D0`\ UT 5`T ` R $0 R0d0 0( 0CR0d0( -L$M0Q 8  4 gRP X;R /L;R: @;R 8;R 0;R JR APRv oKR& MRT`X@0$S 0 `fS0!aL\XT xX@T` KnR3 ڐ:R <R rR0S 0S0!R CRllQ<0 0 0X$0( TBR GDR HR<@U T0RX 0CR00$0` RD $0 R@ ( 00CRd(0d0 >3R R !B0<0(cR fR XRd( 0.@Ro ARi $0TR a`R !0bP$0V 0SS 0( 00CRd(0oh8RI `8R X8RE4L 0`lR ;hR:0S@`5ژ! `0`S@K0S@`$0@SAژ! bP` 9TX0 $0R0`` 0CR00Q$0 0S d"4@ d 0 3<(R nR`1`!@ dR ,$ <, d(D0$0,<7 @T4\ ( d02!`S0 BS(0( S<0S0!c@<@(00CS񟗡b4xb4`\4`\4`\4`\4`\4`\4`\4`\4`b4`\4`\4`\4`\4`\4`\4`\4`\4`\4Hb40b44p v4\ p4H j<0($ T0$  c<`K0 %Np  P 1 #4P4 Jz\QV R(0 p/l0SH4x 3\0S$ ^! p@\00<`KS0$ ,ğW(4 0@p  P 1 #4 p^0 @4 77 Y30S@` 0@S)ژ, JP` !H`PLPp? 0/S5Le4f4de4de4f4f4de4e4de4de4de4de4de4de4de4de4de4de4de4de4de4de4e4de4e4e4de4e4de4de4e4e4e4e4e4e4e4e4de4de4e4e4e4e4e4e4e4e40@S~ `pQ $K 0(@K@P$0( Pp@0D H`L`(pC`C````````0S@`Ìژ, 0`S@d ><(@R dR`1`!p gR ,$ <, d>,fD0$0,<| d0 S0S0!0C$0RL ga0, DL P0@H0Yw$K?l?p$?h?p!c>J?u&99909(9 99 998l999 -0LSP`" Q"@0! 0@T2D 1C@p`@D 0! @00TXk8xl8 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P Uphl8m8("Ƞ,L(oR- :  S >;  S F/ <0 < <8SL$ 10;C  3=8S$ 10  >08S# 10  <  >8 S # 10   3\ ~0C\ 0C\ h0C\a 0\- #0%2$` `0 V@P -@SL  A0E 10#@7 -L@\00 0 0C0 売 h螲 -LM@p `ϲPP D 0@JP ゲ P  0<@0 S00  0D@0 R  0 0 D@  S1,0S1PQ 000 p-`L PR 0S0S R p@p  00@p00pb 0-@L0PS 0\ 0cS0?000P -`L @~P 00CS(pX \00 T00 Z  4@$0T48 804@  S8D h@0S@4 m tJD$8pJ@1c!<0HL $ 1T0$ X0$(0P @0\`0d0 <0 1c80@ a00 2 PlOJd3JHJ` c,2,"0(2 $"0 2 "02 "0Q0 0I(0F1 0 0A Sꈊ4444|444444444 J@$8JD(0 |(p+E(p  00!0 (1(!0 1 !0 < (00 0 \  `8P @< 004  b8@P \0 <" `|  (p p(pR<. 밆4o44u4,s4p4r4Pt4n444hx4x4w4`o49 -LM@PTp`N0 S3 0 0S6(0 0 0 zP 006 `P(0 P@ (!,048 0B~S1 0< R 2@0 4p q<` 8pK00L@K80081S@ 0B~S1 0<P  P@  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp !T0PS0@E 0 8@<#8 P@ 0Z Q T0Sl K@U<  㻧7ό@2 0B~S-1 0< R 0@0 4p p<` 8pK00L@K8008n0S @ l K@P04cUUUUU@4 4|4 -HL@ @0aP0 000ZP 40c9,c4999 0-LM@0L04 P P@@ T0S008  K000 =299 Q-L@ Q h%008 R0 0=20<20<2P 0 <20C<2008 -HrL`PVq 0}/000DR00#`B 2 @DxT444<4o0 0=20L0gap0S0 <20<20 @20@210@ h \0`Pdp00 pd00d"RJ rP00 S8 =2S 0L00L0 0  T00S 0<20C<20 =2Sl00`"R 000I008iS儧0| ||@x0t @```@xP00=rHcc49H9TX9b 48i(i(9$g0iDi 0S  ,00 S 0C$0!0v03 K$ R PP0S pp<;D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@ \Dg 00C0S 00S [ -0LS@+0S  R000 0  B , P8e  0- LP00@P 8Pl u0 -80@ L<0OPD0< 0D0 @0 -`L@BP P)$ RP$D 2pXp0#10# 0%0 000SI ,0PPD01 U 0<0 PP1D0#D 0<bD00D01 pp$0S 0 <2S!l PP $0SU0000<0@ *qP|P989 -LMP@ST08@ `@0p @iP@@rK蔼4 p-LM@`P+0 0K K`K`K 0`K0K`K`K#P  K0Kp -L M8@#hPP @ pP@ 0Č.0 TPY0@0P $(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `P{P*0[  @01K `2`K0K/K.K-K,K+Ka -LM@0K p-LM0@SP Kp `PPV e ဢ0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@Pr0  K0KKK0 KKKKKK0 p- 0LS@ ,` P 31C  0Sp:X9 p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @w 0 P 0$ 0P`0 @ 0$@ @  -LM } -80L 3( 1C@Ph:`9h9 -0LM@ 0K0KK0K@K@K@K@K@KK p-LM~@ATCd KK KKKPK`K@K0KKp p-L@MPAd K!  K KK0K`KPK@K@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0  K0KKPKK@K@K@K@KuK0 0-L@MAT 0 K0KKPKK@K@K@K@K_K0 0-L@MAT 0 K0KKPKK@K@K@K@KIK0 -\0LM@A0KKa0K0KKKKK@K4K 0- 00B1 0LM8_@#\ #8KKKK@K0KPK@K@KK0 0- 00B10LM8_@#\ #8KKKK@K0KPK@K@KK0 -LM@ _0K0KK@K@K@K@K@K@KK -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L@Z0 4 R: Q 0 Q05:0!S S p-LMP(@`T   00x -@Ll40(0S (0,0 @,000hmXc\c -L$0S h 0@0l$0S0 0 0@ hm`c -LMP`pl1@T(@T 0S0S: 0S:( pR,0,0,0  B m@m0e @P 0 P` p0  0,P e 㴟(K 04P00 0 P 0P@  8 0Xc\c -LM@R@QhB` u@P 0$0@kPp R-@ 0Ka@P+ 0$@ 0 00@S00  P  00@Q 0 0 0m R 0S m`cP0 S  0 S   S0 S00p@-0`4 \P*0 S @  ^:0S ^ 0Sp0S@@VU  -L@p`PP 0S 40S P P P S P S:\  R @0S B40Pe 㥞 p-PLP 4P L0`V@@V4e ㉞LP e マXP e } 0 10 e< phs p-PLX0P` `@6X0`@PV pp -LP`p4e ቞@PP pP`0 0p0( p00 PP0@ e/ -qLM@`P! 0VDP@ W `U$K-K 0pP `,[Z* [+0[V : ` 0`~P  ` p-LM8P 0`Pk@P;Px -LLPp4@P@ 2`@TE  e 0ㅞP; L0 T$0P pRS 0S+ S \0 \*S 0SP e 㕝000S 0S@0 R 00 P T0 p 00@ S 04S!40009999 -LM@A 0 K0KKK@KKKKKK-<2S\0 R 0@o404 ,/ #30b:,gMb9 0-LP@P 00h 0-LM@A0 K@K0KKKKKKK@XPP K0 -LDM 0`Sp L0PU@@3U4e ܜLe ؜0 040L0w* ;K 0TPP: [R8[90[ePP @ 0?PP@ T e 㪜(KLP0SPP00  0 \+Y P @   08P P > _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[  PPp e 0P4P L0W 0@@W  lPP @TJ@TZ*KP*0[ 9 -L ! 01 R101 01XQY QP@S G 0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\  0S 0 4 \\T 01[OH 0KhP!  -L^KBM@KPEp `0 0  PO,V@ p = p<0d A@E0;:PD`d  Td4@d ! PeP &@ d` 0 $K99999 - LPp ` ;W @T ˗ 2Qq \*qP&W  㳗,q89(998@-  @ 0 4$(8XX"(#!\ R0S$0\ Q r8Xv8 0-L0P@PT T 000h40h> -00LTpW1 44L \ ` P@ 0`SP 0 0 \P f =8P f 7P f 1 f-0 0T0 -LMT0p000 P40 @0S/ 0S-+T 0S&`0@C P P0  D;Z P T0S T ` 0S(K P 0h0 0   1 KP5 0  2T ` 0S rT0S00 0 x ,  0S00, H00 4T ` 0S P 04  <      0 00 00 00 Q00  0`PP  T0St p00 <`00 ( b9@9d9999 -LLM@P0@ JP5 Q4Q7 0S VpK uT`[P00V00Q [S[Sゐ`sXV8p8P f W P f f 0T0(K o 0SVpK  T`[P00VQ [Qゐ  f !P` f 0㜖`pP \` X "2Tp 0P `0S00S 0S$ , KP,P? 00S H (AtP  }B<f ѕP8x <, 40 PP _fyopWQ00>0S S\f 0&PF V4p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pppV  P g 0T0 R 0@0<994999X9P4999 -@L0S 0 S  \! 0bS0 -LMP0 <$21C01 0>=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WIt4`444p4p`P@HD@ ,0S 5*0JSH48444|4@,0`S Z 񟗶\5h5p5x555555<55H5j!a 0R@S Z 񟗓5X44444 445 55H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h c(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h A0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h 04X04\<$21C01 0z10` !10!` n h 0u`\X #`0 p@-0@SP S`1 `#01^0P5@10L\!N 1" 0f0#RppP  p-P`L@ 9@8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*xPcg0P$K - 0Lq 0Q 0`00d 0-LMPP\0@ @X  @ @Xr@PK0P -L M@04 P:P@$ X pp C0P" X GS8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K 8 = -L M@04 PP@( Y0 P'  pP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KyP(K 㷑 t5R00R0 Sp-LP@` <0 @ Q``F 0  ㍑ph -LMR@80 pp 㴑8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKZP00P00S0,0 Y G8 M,(K -L MR4 @p ` ` vp s8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`K{P @@X (K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 $Q Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@* 090p PBUpP#TP TPXP XP@P @PPP PPP<P <~cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 p Oφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕ|9 p-L?L`@P€  00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !yPA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ TD1S BT\1S V`DP ]K0 \  _D@TW(KK 0D_W - 1LSPp @`1"  1 S`@ ! b1S 2S i/_ Yi 0-a1LS@P \PPP  㨉0XϹ 0 9Pi 0-DPLMXa@ $K 0$ P  \K0cD4 -@Lp`PP DW30, Xb10Ya1P ,9Pi'5 0 PiQ Q 0S 0-@PL/P h1l!PP @  P@T0舒8 0-@PL/P h1l!PP @  P@T0蚒8 -`hl1pPQL @ ,P@T iꄒ8 0X 0-PQL@ Up00h 0?C0C5S5P15(15(15(15(15(15P15(15(15(15(15(15(15(15(15(15(15(15(15(15<15<15<15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15(15<15<15<15<15<15<15\03 rL03 m<03 h-5STX9d8ȑ8cX8|*5*5*5 -LM@K K  0cPKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp 0-LP0@P1S01 1S A0 AT 0 1-P AT10C10 010C10 9 -LM@0P`pXP  K 8#(T0 0 <0z00 <Q P p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp 0-L@0PP0 00 P0 B 0 R000h0 -LP0p`P 01 s@N=00 00 00 00 00r` r 0@P00 <QA -LMP0p`P800@0LL0MpQN`O`PR`S` L0@`@K -LM@0`pPP10@0<0NĠL0MQNPOPPRPSP L0K -LM@0`pPsP  K0 08#T0P0  {00 <Q P -L MP0`@GP. 0BS+95x959595:5:5<:5`:5  0K@ RY0S 0S00S S S 00 b0K`T T 0R0 R D 0@@{P  RTXpWe  00 b0T T00 6T1  \T% x 0T\00 TL0Q0  0T800 @ 0  0T5 T 00Q p 0@0 PH 0PP^ TZ  T M F0Sh c00 04@ 0@G:S 0S 999@99\9 p-LM`0P@*P: 0BS>5@?5=5>5=5>5?5?5?50j i8(h4$k 0 <Q  R 0PR 0($ 0,0Kp0S T0@0CS0000 0PTP KphT}\ @`840" <S  j i(h0$k0 0@S<0S =Q X0S| S~ 004 D0!PS4< @0PLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS7pI5H5H5pI5`I5d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iuiX@Y@\@`@Y0PX0.Bi`i>0S7=}`0T04> H0P 99 I9999̒89999,9l9998 -@L0F 0 4JS00X0ĵX0ĥ -L@450S 01 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKcK04j -8LMȠ,Ƞ#84 |ؒ8 -@LM00hN -@L|M0S00@NS000(0RR00(0(00 (0SP( P0(0 m"0(0 -LM@Q` $pSJPM5L5L5M52 %㼠 400 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko"`0(00(Ko00 0!0(00(0K5L940S840 -LM@P4`0P3 pW00 00 0! T@  0 P0(Kok0+ R  RW\r0(0(Ko!T@$ 0AP(K0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKnP -L M`@pP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KIP -@L {  h p-L M@`WPP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K2@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b? (0h*N~ V'9 0-9P=@L9 YC ?P o:P5RP f1P203P \'P03,P 0,3$P m0$3P 03P a03030H 4|B v< p999 p-2LP%G9`@O ^㊢00S 0@T7P30CSP3Hp☪l -L`   9 8#8  )2S<9 9  h@@ TP pp>QP@@0$oW -LP@P Gpo @WT7P" 7P$  D =]2S 9@0;9!Hh菪@hH,hHP h H09L9 -`LP@pP@ F01T 0CT!  00ⱝ@4T& G0T 0T0/ġ@ @ %@608#8@6 0 R @6@@@ y@Y@0"@Pi 5i 6i( -@LpP` & % (@@T ( T hYh9 -LP@`pP U %~@ (z@@T ( T &@,H$h9 0-@L. T20S7  I26S$  > 7PP? 0 08#8 0hgu m  0- L P # @@T #U T !0h*p9 p-L`@PP@4U0@p -LMP`pR @P L K2"t3#|CCCC:xccy$ K@P4 08 Ƞ,Ƞ#8G `D$?!^0C p/p0PS00S"0@S$Pf   0P" P"2SP 2SM 2SJ E*@K}ᩚP H 㰺414!9!,1,!|1!0` h\1!2 1_0p@"2 A 0r 0@\"R  㴠˙. ۦF]|Y lT"0ၠ"㙠9V5a598909f5U5,X5h5h5pi5R5TR5TV5992S -@PL P hx -2 @SL# #  P P 37 -3 @SL#$# P P 7 0-L@P ; 1P ; 00(0{@ -d2L(MP   0P" P"" 0S;93= υ0p O0pr _ *@K@0@ 0υ(i?0T]M_Z % 0Phٴ1!91!|1!1!2!1o0p@"2 A!1r5 0T"R*  )@ᣔ ,P >W R*@K0@]00"0"ppq8x03iH859ps59 `0E9H985Xv5x505X5x5lz5K@30@3'59 0-PL@<P61S TP8  P1S GLP r6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -@PL P hط -PL`p@P -9W;I9 WW" 0 0@0@x h嬸W i/0 0@0@ p1S0ki/9 -LMP`堺pP K0 0@0@\z-0 K @1 1S.749 -3 @SL# # P  P $7 -@RLp` D ; 0 0P9 PPPP,7; 1 w7; 00l9 -LMP0,0 @p`"P 9@ V VV(KH30H3嗻P/V] ̠A0 L @岼 ,0K`_ 0, 嬢 0 48#8 S,0 0 0@0@HC 0德H0 0 @0@,00@0 0@,0  ]7P |P  q 0.0 0 @0@59 - @L$4#97P (3S "P( /P, 7(G7 -LM0S  0 Ƞ8,Ƞ#8 nP Xc 0-LM?0@ PK0KF0K0K@K@K@K@K@K*PK069 -L MPp@R oP "K!1 @/@1!d3#hslps Kù@P 囹0PS00S"0@S 叹P9   0P" P"&@K ,`ᝁP ٶ 㤡0 9!0 |1!0@ 0phO݀@ H.- 0帶9559095855l59 p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`K~PKp -LM`pᛸPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PK\P p-L M@`zPP Kp?0F"0KB0"K K!KK0KPK PKPK`K;P [0[ -LYP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K"@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ -LM@P K@0  K0KKKKKKKKƻPGе9 0-9P=@L9` Y4P t?P4RP k6P102P a,P020P 003(P r0(3P 03P f0300N 4債H |B v999 0-2L@⍳⊳*9P@00S 0@bE~+0⬍ 0-LMP 8#8,2S<9 0@\2  ?8 0@Q2 P @@ ++!0T 8d #8 )@< ?Z8,;;1" "b -LPP9@@ *p" Sogd @MT9`   Dm7P( A7P z$ 6# 2" . *2S 9@0;9 +h莍@娴h+,墴h+P h +L909 -PL`@pᤶP@ )d1T# 0T  00ⱀ4P@ *6@(@ *& = S2 @S# @ 6@3606b0 R @ *@ ~0-@@J3  `$ `3 ` i 0-@9=PPL9Y ׷墸P4RP η噸P102P ķ司P02P Y02P շ02P M02P ɷ0200 4 ߳ ٳ999 0-LM@ ?✺P  ijK0 ?⍺PP  L嵳̠2,/ P۵r99|5 -2QMLP`2@p0 ^B"-^ Ϡ,͠0 ?  lC4B0b2\\  姵>P 6 0j=K30359 0-PL@mP61S  P8  P1S x LP l6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -PL`p@P -(9W;I9 WW" 0 0@0@ hW iW)0 0@0@ 5 p1S0yiE)?9 -LMP`ߴpP K0 0@0@\干'0 K @0- 1S)E49 0-2P@SLRR <P IP 070 -@RLp` D ; 0 0P PPPPp7; *1 d7; 00l9 -LMP0,0 @p`fP 9@ V VV(K 310 3۵P2V\ ̠A0 L @_ ,0K`壴, R 0  $, ,  R0 0@0@ C 0 00@00@ ' a7P |P  dk  X M(F0 0@0@|59 0-@PLR :7P 2S dP qP 070 p-3LSPp&`P f 1Z029@ 00S 0@|z03'p^ -LM0S  0 Ƞ8,Ƞ#8! 匴P 8 -L@ 尾P).P ] h̼9 p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K*Kp -LMpɳP6 0 4S ,K0 K P !0!(K,P  ̠8Č#Č"̌ 0P ˿ d  ,Y <̠ČL8 ČD"̌#D!L  0@P P,<4("!4l̠ <($Č"Č%̌ 0fP P  ,GY $T<999H9p999 -L MpBaP 嘰K KI@P !0PS00S"0@S P   0P" P"\n2S 2S8d (_ 0P P2f 0YP& k%O@`zP 7 |0| 9!t0t |1!0@ 0ph⭜;z|03&,9999909`5t5509 p-`PL@ KP b!P0 @/D0@ R phN(ph 0phr4g9bX5 -(L"M"(@0K K0KKKKK K K張 K -LMP 2Sڲ0$!08#8  Kh/00Q0" "2p488S@`  pT` "2p488S@ 0!B!O0,0•)0 0P" Kh -LM9P@` K$@υ 0p@9/  00 00 n@ j7P {7P w2S 9@0;9Kh%L7Kh%40Kh%TP Kh%09L9 -PL`@p0P@ <$t1T# 0T  00={4P@ r%6@(@ j%& = S1 @S# @ 6@2606p0 R @ O%@ 0@@X2  0L   2 ?  ("(  i -RLM R R K0K " p-`LP孰P p0 0@0@ph臮49 0-2P@SLRR !P .P 070 -@RLp` D ; 0 0P^ PPPPQ7;  1 E7; 00l9 -LMP`,` p@GP(9@% T2 TT 3S% TK 3@!k) 3 S0 3ʤA0  @;Ҳ(Kdü D c ,0K`p1> ,`,``F,` V p 崘,  R 0 0@0@@0 0 @0`0@ `"0 R7P |P  9g -{0"$0 0 @0@5x9\9 0-@PLR .7P 2S <P IP 070 p-LM@"Pq 2SK 7P 7P  ==P 1 DeKph#,^Kph#WKph# ?`P  GKph#2/ `k9@0;9Kph#τd ? @平P  ,Kph#9L90995$59 0-@9=PPL9Y 儱P4RP {P102P qP02P ;02P 02P /02P 0200蓻 4Ǭꍻ ꇻ 廬999 -`LP@pŮP@ !0T 0T  00x4P@ # @ @"608#8@6 0 R0`@@ i@ i -邡ႂLM0j`@P2p .1.00 \  @00 0! Q " $K0j 0 @j@b0"!B 2/LL  `P $K3038'5 0-PL@+P61S CP8  P1S 6LP ze6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -LMPp`ܭ@P K 9V;I9 VV. 0 0@0@s 姫V) "$K 0 P `$0S 0 0@0@1S0k!0 0@0@9 p-3LSPp 9`@ 00S 0@kvNt03!pK 0-LM@P PP  0 Ƞ8,Ƞ#8D  YP 8P 80 SS8舜8 -LIMp`rP庭 08 Ƞ#8,Ƞ 3P1>8@KFxP pS oP 0$S0S1> 0Sp^Pw (0S@(0@SP$0uP 0S$0!"(0@Sʸ2S a02 `R@0Sڔ2sTP  @ 00S0"20Sʸ?@:lP0pᚰ@P0 ""0`S0@0S"0S!Pg   0@0S"0Sʼ2s 2spW2s 2s Z` =K0K0C ;PKX 2$KO0` &DK~x< $8 #44"<,K ,0 0}2u@ ?1!9!1!|1!0@ 0Ph⹖Gtv03 Z0Sp $K222SC 0 $00B SAB Qa0B7 BSW B? x2"0 Px2O TH<ݩꈜ8*09 5|5t5|99 999P999 -@LSX30CSX3h蘰X3 0X3SP0幨 p-`L@0PP6@0 ?  #0 0 3S 00p530# p0"00p 0-PL0坫P?  2S BT 80@T0hT50 -qLM0P(3@0` -,C;QA40+ @(2.0(3$(3H   xX30X3$ X3@0CSX3T  d105 K(< aJ<0>P30P3 69 0-PL@0'P%3S" 61S <P8  P 6;601S +LP ob6 ;&600  BQr0C 00S: BQ  10R`!d!  10C10 -PL0`p֪@P =W;M= WW" E? 0@1An 墨W iC? 0@ 1A p2SxviX3H0X3X30CSX3Z9 p-LMP0 0@0@`Xl0 K@$2$ 1SBKp49 -$3 @SL,# 0# 0P$ $P( $7 -@RLp` D ; 0 0P+ PPPP7; 1 i7; 00l9 -LM`0pPP&U& UU h0l0h0含PCUK 0Ÿ0BD0  @X30X3娬X30CSX3'(K,0K PO,0S 04 C, 0  G? 0@1 A R"A? 0@1Aᇮh@p 0壧hX3D0X3 X30CSX3p꿠0R P^00 @0A, x@ @ =7P P  `  t zA? 0@1A 69 - @L4D#7P 83S 0P8 ,P< 787 0-LM@0KPP K0X340X38 D0P  PX30CSX34< H0PP ֵ H P<8D<3,/ P08ǫ99 6 p-LM@PP` 0P Kp@ĠF@0  KK 0KK`KKKKX3 0X30 K⿬X3P0CSX3᤭ -LM@P`P 0ӨpP KLN@0 ' K#K(0K%pK!K&pK$K"KX3 0X30(K⏬X3P0CSX3t -LM@P`pP 0壨P K@$L?0 KK$0K!K#K"K KKX3 0X30$K`X3P0CSX3E -0PLM @ K@b0P[ -LM@PP`p 0cPU  @ JGĠ0 K KpKp  >   7^ p-LM@PP` 07PU xZ @      K0 k4 [0[48#x p-@PL 0 P_ ? ` }@0P~phMp130 300S0#R00S 2 S# x p-LM@0ԧPP KpM `K  ґ= 8#8  -2S<=4 =  0# 0[<<P0K PP{p K?0 Q0 U A 0-LP0@P 0 h ` T @ 0h ' 0-6@=P6LVP}DP D廩P+DPHP H岩P0H0@P |0@38P 083,P p0,3$P 0$3030ӳ ͳ 99x p-L@P`0 -# x0 7P դDpr7Pʤ9pX P H ?  H0S D0S 6@0;6P}}py0WP p09L9 -`LP0@pᙦP@ 41T 0CT!  0xp@4T& 0T 0T0/t@6 @ @608#8@6 0 R @6@@@ @:@x@1i 5i 6i( -d0L@x`$0C0@CX3p0CSX3=@? _ @tx0S  oloPU|_ @0 -LM0S  0 Ƞ8,Ƞ#8  P 8 -LM`P(p̣0` @P ã0$K2pCh3tClS*M2CCS3( Kd@PL(0 40 0 Ƞ8,Ƞ #8左?4-080@0<0 `R>S4 0@S4P/ 00S@8<0S80s$ <0s! @0s .@K 0pP b &x[@\STP n@J   xPɏ1!=1!!1 1!!31 #x` O3"0 b's/0   0P/"R  t-moP |=z ~J"0s"t996 9689999966 6@666 66 6 -PL@`pQ @P 101J!1R"@10d!R`A@@10dA! !/00@ 0@ (@L1017@ 0-@9=PPL9Y TP4RP KP102P A P02P 02P R02P 02P F0200. 4b( \" V999 -LP`bP 9@ V VVpp2/02إPVh蟧B 0*rL9 0-LMP ?P  K0 ?ߨP Ӱ @ ?@ P周@P  Tˠ24/ @学99#69)6 -2AML@`Pp 2R2+N\\  冦P ~ 0岡K202'69 0-PL@嵣P61S P8  P1S LP [6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -PL`pg@P u9W;I9 WW" 0 0@0@ h3W i0 0@0@ } p1S0yi処9 -2 @SL"" 峥P P ڤ7 -@RLp` D ; 0 0P PPPP7; 1 ٠07; 00l9 -LMP0,0 @p`ۢP 9@ V VV(K2/02PP?VN ˠ`|!90p h⾋|0@0@p0 0P t1@ia4  $99P-6T&6,6,!699 -LM0S  0 Ƞ8,Ƞ#8 P c 0-@9=PPL9Y qRP jRP cRP 002P 02P $02P 0200 p-`LPѠP p0 0@0@ph諞49 -LP`ẠP 9@ V VVpp3030PVhCO 0傞sL9 0-LM@ ?FP : nK0 ?7P + _ = @PP  TH̠24/ Pn99@26986 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0B 2o\\  ,âP  0 K2026689 0-PL@P61S  P8  P1S LP AW6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -PL`p᤟@P 9W;I9 WW" 0 0@0@< hpW i0 0@0@ p1S0yiĢ9 -2 @SL"" P P 7 -@RLp` D ; 0 0P PPPP"7; 1 m7; 00l9 -LMP, @`pP9@ W WW(K303叠PoW| ̠A0 L @媡 ,0KW,X^084 0LT l ĜT ,084 0Z0$ ᱜZ   |00 @00@  [7P |P  V  j 0 0@0@CC 04v  pڡ86l999P9 - @L"#7P 2S P  P 7$7 0-L@XP 0fP7P 7P 2S 9@0;90h@&0hP 0h0h09L9 -`LP@p"P@ .0T 0T  00/h4P@ d @ @Y608#8@6 0 R0@@ @ i 0-@L9P@00S0d.0 p-LM@` P 婛KpB KY@P 10PS00S"0@S %PJ   0P" P" ~2S4 2S1 2S. 0OPK0` 9 40}2 f@ \0 10)1 01|!0@ 0`hԇbeg@B 0=99*8:g09<6`561699 -LM0S  0 Ƞ8,Ƞ#8 4P c -@LEEX30CSX3hX3 0X3E -@PL 0P 0h p-@LP0`P 6@00"00p&30# p 0-PL0P2S BT X)0@T0h&0 -qLM0@P `(3,C ;R' @$(3H 2.  ԜX30X3$hX3@0CSX3T Y T博0⑙ K(<bO<ZP30P3D69 0-PL@0凜P%3S" 61S P8  P 6;601S LP S6 ;&600  BQr0C 00S: BQ  10R`!d!  10C10 p-@PL 07P_ D`&3S 3 30S 2 S#Prphspx -PL0`p @P =W;M= WW" E? 0@1Aᥨ ٙW iEC? 0@ 1A # p2SxMi3X3H0X3*X30CSX3ᑠ9 p-LMP0 0@0@`X壙0 K@$2$ 1SKp49 -$3 @SL,# 0# 0'P$ 4P( $N7 -@RLp` D ; 0 0Pc PPPPV7; 1 J7; 00l9 -h2L$M r99x -pLP  m@ @yT*  p W7PC 7P8  J "H0S D0S 6@0;6 PnP  /09L9. -`LP0@pP@ & 41T 0CT!  0x&b@4T& [ 0T 0T0/9f@6 @ Q@608#8@6 0 R @6@@@ @J@xᖻ@Ai 5i 6i( -d0LPx`$0ē0 X3p0CSX3o=@O !ex0S `o^ Pm -LM0S  0 Ƞ8,Ƞ#8 zP 贡8 -LM`Pp0` ᚢ@P  L0j$K2pCh3tClS>2CCS3( K@PO(0 40 0 Ƞ8,Ƞ#8@?4嶗080@0<0 `RCS8 0@S4娗P3 00S@8<0S80s) <0s& @0s# " .@K`.0`pP  W ꬣ t@ TהHӔ_ 0̔  xPK1!=1!1 0!3 0Ox` #3T 0bd  0p'!"R  e^aP xk  F"0qe"e9LD69,S68999909 C6T6F6P6M6@6xA6A6@6Q Q  0$ 0,B$ A`p.l.-08 ?0R<  C480,`t.x. 0-@Lk L P0CQ 0S0h =8`. 0-@LO 4 ,0RP 0_0h .. 0-PL8 ( 0S z 0@@u 0. 0-D0 L@# 0P 0000S_0h] L'. 0-@0L@ 0P 0000S_0hG L'. p-t0 LP@`P H 0000Sph+ _0 L'.: p-PL@L`0 S Rph 0=  x_|. -`L0pW ͠ @h]8P^xp 0 g`pW<0  h0 o 0  o .vi.89 -DpL`@P 0$@L': 0-(P@L00hL': p-@L\`0` R ]0PH 0004 0` 0 R0  ph ..D9 -x0x`PL@0Tp0 @ ;80!P 0$00C 0@L'... -pL ;0T!`00`G,嘊0S"=0@").6 {PU0@00 _P$ 0S -00CS0:00k0X0 00<0,000 0(j.cL9: 09,a6 -@LP p`P00h. 0-0@P00Lr000. 0-P@LQ  0 S 0  000S:R   B} <0 0  0h!^  0000h^l.p. p-L^ @`P  ^* ^&0 ^"1 P 0S |pl0P T0 ^ 0 R 0Cp 0PL'.... 0-LQh@PT0  0CR0 |00 \L'.. 0-t0LP@ۓPT TT T 0M00 00 00CS00h膘l'' p-0PL@ḓP pT` TT \ \向T phphM04 0000CS0Vl'9' -LM0` 0 2Pp@ၓP"T" TT; T9 TB 1A 0%͠] %L @僓00000CS0%K  0K@従 R0 QF Q? 9CSi6h6h6h6pg6pg6h6h60 M0 00炖00CS0  ? fl'' g69T9|9 0-@ 0L00PᥕP| 0tА-0P0CS00L 0@ ]-0P0CP b $ C0?`% V Pq%-厏`$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SFq6q6q6`p6q6|q6tq6`p6`p6`p6Tq60@"02K0"K*@K2K A=0Sf  20SZ S08#*@KK!PK0`20pLK&zW?F K4KytP`V000000 R  Byhy1! M 0@] 0P `1 0@P @ d0 R08#Q 0*@K2K0"K2K?      L''9('(##'''Df6p.* -LM= ?Rp` 2RS 0RD Bp2"p 0 00@0gyP2P"@]0P4B4Ÿ   @徐-0 0@? S+ = R 1R4 -d0CRD 0RI T1 @1 >$K0S@? *pK2K"Kh1 *pK2K"KP1PD!0S,1R 0R0ASt6t6t6t6\t6\t6t6|t6\t6\t6\t6\t6\t6\t6pt60 00 00p p <8#  'l.p.''Df6'(*(' -QLM0`(!($K1p 0 ?% X00DP\Z,0@ - xexxP 0-  熒P }0( H對 4%=㩍809.|.'''',m699 -LM?pd0 \`,0 N \D1Q  A1,A,Q0  60 10Q @80 p0pᴠᶐ,0@000-x0 ]@0P}@ 8p  @傏 f\0@P@(K(Ko=L'..'t.'''Df6x. -02L PRc  R 00 0000S^BAp0P r00`S` 0@XU=  BR` ړ|1Q 0A!ha XAP 050 10Q (AP gP+00AP \P,00@P QP005忌.X`@p0y X孌s D姌m 0塌'...'''T9999 -LM@P` љP 儌 K5pP8 1!@! 0 `p0C `d!(0CP\1p p p0`S @00S1 0@S P   0P=  P0 A0  "P 6 1PyP `%T!L0  @Z39l'p'..|''9.L99l909'b6 -LM0S  0 Ƞ8,Ƞ#8'  P 80@ 00CS}6}6}6}6}6}6}6}6 P P@7P,@nPX@l`0 $H0AhSw6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666660 0 R Q Q0-L@P   0@~T  08#0`08#0@jPj06(686(6(6(6(6(6(6@6H6(6(6(6(6(6P6(6(6(6X6(6`6(6(6(6(6(6(6(6(6(6(6(6h6(6(6(6(6(6(6(6(6(6(6(6p6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6x6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(6(66(6(6(6(6(6(6(6(6(6(6(66      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 48000L0Ba21C0aT  Q  R ,{0 0 颋.Pꄄ666666|6|6|6|6|6|6|6|6|6|66840,($  I9999999908 R0-LP 0h0 @0C 00h @ *0@08 xNwP 0C <0hb9*(&D -LMڋP#j?p,K (K,KLP L0P+K@N'K0*K)K&PK%Kn$K6 0-AML(@P0PS i000U00 -LMHP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0K]P 5 i K9 -LMPH.l$|.@0 $H(K(0K'K&K%`K$@K#pK"PK!PK9P  E K9 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   >V p-X04(  Q@P PL0@`[o~ z phu> -X@L jx8#<,"(c, _D(R  hWfdh -LMHP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K呎P i 坈 K89 ,0- PL@0N 08u[@Q \00HS X00 0R B0HSQ勊P 0C <0hOa p-L M?0P.L.`"K K"0KB0!KK@K0K PKPKPKAP[Kp J89 -4L@9$   08 #(hD -4L@48$  08 #(hT -LPp`@  @ThhT @46%CA($H"(0H$(1 0p`90 -?LS@ (0 )0 @ h04 $) (0-"(LXPl@Mb @T(LJ0T S0|9 -LPp`@ME @T,h詇T $("(h99 0-@LPT  T  ?0C0S 0h p-`LPV@ V@@/0B0RS@ L@  ("(,$  ("(ph p-LP@@dT mP dT8Dp,`@0 @}@Tp9d8 -L@0r#`P00V0SNPF0E=/Qp1p#R,6<666Ē66 #3!3yDp V ""2! "D8S H8S FV  F"No,i<2!\  "" 2!#)D !!1!#@ !1!#)D zVH! -tL!oH1!j#@  c1!^#)D X0V  Q L H0!C#)D = k -70 340!. * -XL888,88ܣ888 -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0KP   K9 p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0E-  0<E-0xtp 0-0h 60LSP0CS006 0hn(庅00 @0@08 0-ß 00 ˲00,PPHH#CA- 0 ß  P稉P [(KX3 P4X 0!R RT8S S0 { q#D0820 00\p4X 0k0@@ c@@ [@H$H@H$(@4 8 41S#H卄 7 0@4(> <'< P0@0/.000b 0q @B `PDAM0@00DT!040 "84Qp '.0 4!P垲 ! 0 P PjP@ ᇲ S 00@@a @@H$@X8a 4 < l00/.00ʠ< 0b0dh`6>9 p-LM6P=@S`2 xH8S1SS P @2 R{ʬ1SR @LP  U= K⒗@P tP  I= dPa1  060 Q Br0C  BQ h1 RE0G@T/0S*,00 tP  = 8P x 1ASq Bx 00S:A BT  10R`!d!  10C1 10R''  70C7,00 tP6;6xxQ010 0@0@x -RL@ ZZ  ?Z& 0 0@0@\0`p lP 0@H0 @ m0瀈9 -LJMR`p \\ \9 h"ˠdB0L  @&὇(K ,0Kk, #R0 0@0@0@ TD⠐wPPj ; Ᏹ1 ɂ 10 @! P lQ  0T48<#8@!:#:0 0< 0S( 1  1xp 0 p0C 0F=0 01 1 0 ,1 (0KⲐ@!SdTW  "PP@ $Kx|8p0x(Op,0 N\H Wo 0k21C! c. P0pU圅:P@) :0 㺇@P  ހ@zp 0ᦇ@PF@P <̀꒏ (ƀ€P 庀 @@ ˠ0A- wP@D8S  6 n ~ 560;@06D(R  @d B@^@兀W 8"VS`9999<99PT6D9 -`LP@pႂP@ 凂1T, t10Sh1TH 0K@4T@ @1T" 81T  ᖅ4P@" 幄606 0S06@ @@ @ v4P@D8S 6A0AS@@ v0K@6A0AS|@i ϖ1i i i -L@Ml4P 6A0AS 4@ p-PL 0` .0 1T~00S 0@lHJP 00@P yDl@P r=!pC $X0  C <W -LM ݌P (Ko. ?@P //0PSʧ0@0S/0S P   0@0S/0S?s ?s 8828"0 C $ ~V 2 "` C `< sV  &1P pOI0 p/1/88 H@hDhi t i @h\1`/VN>0@<1g -@LP 00P  x00P: p-PL(`@V0$ R0 00S 0R: 0S  0  1V0S 0S `pp1 00phC -LMp@e PPB 0 0@LMt0s 80z0< l0Ruz@vu\0@ 0vl m0qpn@o@r@8X 0.`P  e" K<0<@0P8 e `S 8 N0``><bP@ <@8 e` &b0 @K0Pb 0 P \XP46 0-@=t=PPL=] tP0 0-LM@P T0 LDT0DD  LPtPwK0'6h: - L w x: -@L+=@0;=hl p-`0 0@P0@L4v6 ;&6@D*phO49 -PL@`p0T 0T  x0B4P@ 4 @ @)608#8@6 0 Rxጜ@@ [@ i 0-L8@P ; P1P ; 00㉢0ܤ@ -0LM`RP,0 p VV "R= R ",͠AHX0 L @RP\Yv(K2bS02,0K`2,0S S A? 0@1A=vd=@   -v"P ,00 0X, x`0 0@P0A  /  CA? 0@1A6:x9\9 -LP`"=pt;@P=M Gt@V E? 0@1A2S \QNhKC? 0@ 1A 0-6L@P)1S' PF 2S 0 Sڬ1S$ 0h  yP/1S1 LP &/6 ;&600  BQr0C0 00S: BP  10R`!d!  10C16;600 00S: BQ  10R`!d!  10C1 0-LP@x0h -L M P̠` ß 0 @@@200 \kL4P 6uK480 [P (u8<p @0P \u8@ @0pP#@K_08$ #0K0" K!0K6K 4P t4P tbL_PLpTPlT0XS P @8@H P<8@ D @P 0t(t͠PHX0   @vPPt0 MPK0` {_  v_02b?t0 =!0 1!x@ x`a> AT::x9cT6:::$:D:|:`:6:*8:g:t666 0-)@-P1L`QAp# ( '&%$"Yxh6 -)LP #p3 - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0s s:: -PPppL* 0 $P `U 80S T V0@T404040@QTW H0 ST404040@QBt: -LM00`@Z 0| pp  0$  0QL< P$ R 800 QPR 4!P00P0S  Y00S P<0W)< < 4<8  4 0 4 @Kd d0, @@ 0 2TP $000S$ 0040$0$40HP(00(0(K s6(6 : -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lJLTB -X0L@lJ 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00h=CL0& 5C\0  L( 0+CL0& #C\0L0"C\0  L0# C\0  L0# C\0X 0@ X h00<0L 00BX0L0 h X0+0 BB`0  LX  0h0X 0C+ B`0  X 0@ X h00<0L0 0B`0 x 0-TL,0@ 0P 0P Ao0S|0 oP S | 00PP0S -TP 00LR`p @$<0 T ,00@4h , \00Q0S 0-(0LP0X0@08X0 T0$4P0T 0h p-X0@L$!;98 T8}PdU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 X=I0@&}T 8 T0$4 @ @000l@X0 G}I0:H:6 0-LTP 6& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{2qY$8 80T$8 8X0@80T$ 8 $84  X0  h 8P: -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES66660& 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P 萦8 p-`L@P  xn(0pL0 P8 TP0 X0h T$8 40 \pphꐦ8x:8 -T`@ 0,@00PL8 T0$4 8T0$4T08 p$4,0@0,08T0$ 4  00 0, 00 00300  0 000000000000000000660000 0-(0PL@  0ES66,660&V00p0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S3p -L P 账8 p-`L@P  pm(0hL0 P8 TP0X0T$8 40 \pph/괦8x:8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P666666666666666666666006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES66,660&V00p0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S3p -L P 8 p-`L@P  pl(0hL0 P8 TP0X0T$8 40 \pph/8x:8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ES66`660&:000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sfp -L P 8 p-`L@P  pl(0hL0 P8 TP0X0T$8 40 \pphb8x:8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ES$6<6660&p000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L EP \8 p-`L@P8  p7k(0hL0 P8 TP0X0T$8 40 \pph\8x:P8 p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p6@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS77770& +0 8T0 $4T98$ 8ppp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U T0$8 4 P8 T0$4@ R\ &RZ X0`0B%S&777777777777777777777777777777777777477 &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 80 < T0$8 4PT$8 08T -L P 茧8 p-PL`@  i(0$L018P0 0T@?>C2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`ph X0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@0ꌧ8x:8 -@L8T$ 1<8 0-(0L@P0  L0"SU U U  o000& gp0~0i: p-@LP` i(0L0 P8 T@00X0( R Xphh T0$84  \pphd8:|8\: - 0LT@+UP0 3@50  S R ? :Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 TP TP8T0$X 4 000 0008T0$ 4 00@ 000  000:i9 -(0Lp L0,S@R R R a0&  T08$4! 0&gR T0 8`$@8PA0  0T$8 8h: 0- 0@ LhPP 00 3@5 ? 0TP  TP00蔨8i9: p-L@P`P  g(0xL0 P8 T`00X0T$8 40 \pph gꔨ8x:8: -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ES778770&S00m0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S0p -L P ܨ8 p-0L P3 LP@`( 0P?> S0P0  f(0L0 T`8 0P X0T$8 40 \pph?( P 0 3LШ8ܨ8x:Ĩ8 0-(0PL@  0ES747770&r000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L GP  8 p-`L@P:  p9f(0hL0 P8 TP0X0T$8 40 \pph 8x:8 -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L^$8T 088T$ 1<8 0-(0PL@  0ESd7|77X70&*00 0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L uP 08 p-`L@Ph  pge(0hL0 P8 TP0X0T$8 40 \pph08x:$8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESx777l70&e*00D0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P l8 p-`L@P  pd(0hL0 P8 TP0X0T$8 40 \pphl8x:`8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ES77770&e000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SBp -L P 訩8 p-`L@P  tc(0lL0 P8 TP00X0T$8 40 \pph=ꨩ8x:8 0-(0PL@  0ES|777p70&$000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp p- 0`@LPoc 0?.C""gc(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4phBcT0$8 4`:8:8T: -@L@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0P6P0P 0-(0PL@  0ES"7#7\#7"70&{000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L PP ة8 p-`L@PC  Bb 0?>C2@0( L 0P80TP 0h0X T$8 40 \pphة8x:̩8 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S '7&7&7&7 L0"S0&z00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L VP P8 p-`L@PI  tHa(0lL0 P8 TP00X0T$8 40 \pphP8x:D8 -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S *7)7)7)7 L0"S0&C0$0 L0"S 0 L0"Sp8T0 $48;T$ 80 -L P 褪8 p-PL@`  `(0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0C1L' 0;1ꤪ8x:8 -T`@ p,@0pPL8 T0$4 8T0$4T08 $4,0@0,0T0$8 4  00s0p  0  0S S S0pp0p"v0p00 p, 0p00000p0p0pp0p00 p0pT0$84 0p|0p0p6p0p 0-(0PL@  0ES-7-7(.7-70&R0010 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P 8 p-PL`@  _(0L0 P8 T@0 X0h T$8 40 \T0 $84 0 \;\\@0:\ `0  phpT0$8 4`8x:Ԫ8 -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 #_T0$8 4 000 _8 T0$48@ T0$4 000000000000000660000 c7H :D :P :84 : -1`LQPp@(0 0GS 27172717 L0"S0&I ^"L0 S  L0"S0& `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@Ep c,84 :7 p-L`P@{^0 R$(0L0 P8 TP0 0h X0( R pphd^ T0$84  \pph N^d : c8\:<84 : -0 3B5L  ,0JP ? 49 -@0LSp D0S8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h7e A` -L@e(h 0-@0LSP D0S@X0T 8 T0$4@ 0$T8 ;8: -@LP0\ X0,B# 0;8T $88T <$88$   L0"S 8 T048;T$ 8 L0"S 0& P0T$8 400S.8?7D?7D?7?7D?7D?7?7D?7D?7D?7D?7D?7D?7D?7D?7D?7L?70& PXGP>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, Pi9 -L P X8 p-`L@P  [(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  gP0pT0$8 4`X8x:L8 -L P 00 0Q400P 0- PL004@@&0 p-LLMD0`SP Q S 0R d@KLjE0+8H0 0( 4KPDPKpDPd@KLUE04KHP (P DP -@L004400 p-LLMdPK@`L1E8004KX0(0 0+8H0 0( 4K P80D0#80Kp0 p-LLMdPK`@L EL0L 0SD0# (0 0H 4KoPD0[#SKp#0 0-LLM`@KPLD 0$0 04KTK0 p-LLMdPK@`LDD 0H0 70R4K08H0 ;(0 :PD0  1Kp p-LLMP@`80y-@Kp(@P d@KLD0H0 +0( 4K@` 0-X0 SL@T \P%0  &X0S0 : -h0L@\L P00Q00S 0$ $ h&h:@Bb : F7 0-L@LTP+  @T 80 +P80  P \oY @TLP P 00]Y800 : : -80L@L0S 80 g L0S=Y :  -@L   @ !! p-@00L4004PP Y`p004PP hY`Q`PP80 400,PP80 : :a 0-80L P  080ZLP @T0L H0P L0@008080 0-P@L80 080P X0hBRP pXP 80 0800h,,X80808 :P :(8 0-L00P4 P 80 080 0@8080 0800hv608080 0- PLU@ ~ 0R0 0000`0 0 0h0 p-PL@h00`  `0`@0`\0 P$phl0Sd -L`JT0PS\p ;P\@T0  $T0S t80T0s80 080T @T0s @X@#Fd : -@L$X 0RP hWHL79 Q0-L@ Q 0hD5C580P0T00;5P\#0 0-PL@W000 L4 080 < 0\ 0` d0d Pd0| L\lph@@8008040hTX9J7pS7TM7 -0LCp3 80R00  ( ,100 !0 $1(!(!l9l :t : : p- 0LP]WYW`1>@0S@ VMW0`S@EW!1|?Wt :W Q \5WHph2WL0W10 ` *WV$%W :X99TX9h99p9L9 : p-0LS`  p  P  @p -L Mp FA0S (K02*@R`  VYs `@PP00U0SS U0 !U U `Y[, ,@P0 U 0 0f P0 @  P!0P XP, 0I`YV `P@PD@P@`D@U  0HsVy4mV ` gV `o :0 : : :P : p-`L @PT   w@PT400 ph00 R0S| -LLMQp0@0Π; ; lK$PL `@;00 50 0@ 4 @TKp \7^7 p-P@PLH`p@r0! [0P@(D D @T :O 0P(  Tp<48qg p-0LS@P p 1:`P <:S000p0 R p| :!c p-L@0`0P S000pH` P0 `P XP@0SP0 00P0P0P@ RPp R000pp : : 0-LM80080 K@pP 800808 80080">P@800808400 0 4P P 8R8 DP8 R : : -LLM`@pPP $KpKL`=<180 @p P6H0pSHP P0 dWPP L@T#000 @T L`6 05K0,8P0 0 P LKcP ]P @T K@rK50( :-40 ^ 1 <14 R40 0-P@LT#0$0 0(00h茕 0-@Lq0l 0RP0 d0h -PL @40p`W0  04  P0(0i04  -p`TL P6"x0@d0h`l@p@*|@ | 0`00g0 m# dm77 -L?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????UD'8';'x9'$;'9'$89'8' '$8'n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPP,888D8P8`8l8x8888888888888888 8888ieee80211_newstate 9 8̵93$80 (8G(,89$08!4808880d<840@8`D8RDH8ULL8pP8TT8|X8 d958X\8R`8d8h87l86Tu9787p8 t88x872|8878687886 80,8@8X8!T886\85h8t :7x8d(8p8l9R`87|0978A8H8C8J8K888@8I88E8E888858879789890'88!88. 887Bh 97*8"09O8\t8`8J 8hL87v$8l,87X(8z,8 "90848D9788B<8786@8Z98ED86H86 L80P8G$T8:X87H08Z\8E\`8:^9Vd8wh8l87p8@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ijt8T|8U8S8R88F8I8V8E88G88B88X88D8 8 878@$85,8482<86D8L88T80\8d89l8t84|888 838h8@8888"8 8!88:88188H 8@8J 8K(8A0888C@8 H8P8@P888fX8g`8`h8ap8bx8c8d8e8i8j888 arp_rtrequestigmp_init}E#(DoKgpqrstuvwxyzc*b*,a*`*PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@@,S,,,S,S,D ,P ,X, ,, ,D,T, ext2fs_blkfreeext2fs_dirbadentry,S,,S,S,p,,,,P,,x,T,- -09 - - - -<9|- -H9 - -T9uao_find_swhash_eltb,bbbbbblhvmmapbsy\nd6_rtrequest0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs0h0h0 h00 00 0 0 0B9B9l9B9B9B9B9B9B9l9   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dma_busaddr_to_paddrAF968AF968 AF968`AF968AF968`AF968`AF968`AF968PTG968AG968 AG968D(G968D0G978i8G9T78 i@G978 iHG978 $iPG9880$i`G988 ,iPG9880,i`G988 .ipG9T880.iG9T88!iG988 !iG988)iG988 )iG988-iG988AiG988 -iG988AiG998AiG998AiG998`AG968`AG968PA G968pA H968A H968A $H968/A 8H968?A LH968A `H968A pH968/A H968?A H968OA H968A H968A H968/A H968?A H968OA I968 I9,I9(I94I9@I9HI9TI9HI9`I9hI9tI9|I9I9I9I9I9I9I9I9I9I9I9I9I9J9J9 J90J9@J9PJ9`J9pJ9J9J9J9J9J9J9J9J9J9J9J9J9J9J9K9K9K9K9J9 K9(K90K98K9J9J9J9J9J9J9J9K9K9K9K9J9@K9HK9J9J9J9J9J9PK9XK9`K9K9K9K9K9pK9J9J9J9|K9K9K9K9K9K9J9J9K9K9K9K9K9K9J9K9L9L9,L9@L9J9J9J9J9K9K9K9K9pK9TL9|K9`L9lL9J9J9J9J9J9J9J9K9K9K9K9pK9|K9J9J9J9J9J9J9J9J9J9J9K9K9K9K9pK9J9J9J9J9J9J9J9J9J9J9J9K9K9K9K9pK9TL9|K9K9K9`L9J9J9J9J9J9J9K9K9K9K9pK9TL9|K9K9`L9xL9xL9L9J9J9J9J9K9K9K9K9L9J9J9J9J9J9J9J9J9J9J9J9K9K9K9K991O9t;10O991DO9t;1XO9(;1lO9O9(;1O9O9(;1O9P9(;1P98P9(;1LP9lP9(;1P9P9@````` ```[9[9[9\9\9 \90\9@\9P\9\\9l\9|\9\9\9\99\9\9\9]9(]9P]9h]9]9]9]9]9^9`9<^9P^9l^9^9^9^9^9_9_9<_9P_9h_9_9_9`98`9d`9`9`9`9 $a9 Ta9 a9 a9 b9Db9|b9b9b9c99>9>9>9><9?h9?9?9?̋9?9?9? 9?H9?d9? 9? 9? 9? Č9? ܌9?9?9?,9?<9?`9?x9?9@9AЍ9B9C9D,9DqD9Ed9F9G9G9G̎9G9G$9GX9Gt9G9Hď9I9J9K9K09K\9Kp9K9K9K9K9LА9N9P9P,9PH9Ql9Q|9R9S9Sܑ9S9S 9S@9Sd9S9S9S9TВ9U9U9U$9UH9U`9U9U9U̓9Uؓ9U 9U 89U T9Wx9X9Y9Z̔9Z9Z9Z89[X9[h9[9[9\9\ȕ9\9]9]$9]P9]9]9]9](9]\9]9]ė9]9]09]`9]9]Ę9]9](9] d9]!9]"ԙ9]# 9]$D9]%|9]&9]'9](9])P9]*9]+9],9]0(9]1d9]29]3؜9]49]5H9]69]79]89]9$9]:\9];9]<Ȟ9]@9]A<9]Bp9]C9]D؟9]E 9]F<9]Gp9]H9]IȠ9]J9]K(9]LT9]P9]Qġ9]R9]S,9]T`9]U9]VĢ9]W9]X(9]YX9]Z9][9]\9]`$9]a\9]b9]cȤ9]d9]e09]fd9]g9]h̥9]i9]j09]kd9]l9]Ц9^9^9^<9^d9^9^9^ԧ9^9^ 9^ H9^ p9^A9^B9^Cب9^E9^G9`<9aL9ad9a|9b9c9cԩ9d9d9e,9f<9f`9f9f9g9g9g(9g@9gd9g9g9gȫ9g9g 9g 9g H9hh9i9i9i9jج9k9k9k,9lH9md9n9o9o9o9oX9o9o9q9r$9r<9rd9r9rį9r9r9r49s`9s9s 9st9s9s9s԰9s9s9s@9tL9t\9tt9t9tı9t9t9t,9tP9t x9t 9t IJ9t 9t 9t(9tL9tt9t!9t09t@Գ9ta9tb 9tcL9tdt9tn9toд9tq9ty9l9t9999l999l9̷9ط9999l999l999l99$9l9909l9l989l9@9L9l9`9h9l9p9x9l999999l999l999и9Ը999Ը999Ը99,949l9@9H9l9X9`9l9h9l9l9x99l999l999l999l99̹9l99ܹ9l999l99 9l99$9l909 l9l9l9l9l9l9l9l9l9l9l9l9X9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l9l95 bpb5bb= bpb=bb(b0b(LbbP bpbU bpb bpb bpbH9P9l9b0b99z99 9(949<9D9L9D9T9\9h9p9@x99@994999@3@99H9P9l9l9@99H49@99989499,99`49 9,9@9849@9809HT@9@9GCL9P99\949`9 p9x9499HT999@9@9809 99`CGCZ)IeI999ZIZIIIIII0I0PI0D99I0$909I0ED9<9]I0ED9<9PI0ED9<9 I0ED9<9FI0ED9<9@I  IH9P9D99@"$9X99-/`9l9`99`99`99`9999`99 ")A 99u EE,949L9x9@&o@o @o @  @& 3BI0E@I0EHTI0ED9<9@I0ED9<9I0ED9<9 I@(#0Vw`99`99 99909<99H9T9`9p9Pttt3V 99p9V9`9p98V999V9999p9V999s(949<9P9oo PM\9p9k&h= = s qPs&! qh99l C99 9 9a\bTd3222d322c3C(.} ["$&'X4gklrf8 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] dK2hh8<3L3ؙ3ABCDEFGHIJKLMNOPQRSTUVWXYZ㡱vt100DB44P4\Q4i4 O4|N4@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!99999999 999$9,949\9d9<9D9L9T9\9d9l9t9|99999999999999888x044x4489L9X9l9x99999999999999 99X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@@@@>@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^D444D444t55555L55=y8R|8 |8]|8}8~8I88J8R<878 N8 z8 8 8K8T8@#^8T8T8T8T8T8 T8T8H@T8 N8 _@88b8\8 8 Ȉ8 8Eވ8 h8m8KZ8A8[r8(80F8 88jȎ88?8n:8 8J*88abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    +5t+5`+5-5,5,515.5-55dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRKxD5 E5`C5TA5465x<5H554585(  2 v      W 1 Q `  K5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   J5  L+ L HJ5L2 D   O  { J5o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |]5tk58c5 B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- r554y5  JK0 r55Ș5\555$$0$0$$$$$$$$$$$$$$ $@55 5@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 055(52V{%1" `"'`~%ZP `5 6 50w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-,66D6hF F hF fF 06.6d.6(@6>6=6W6pW6@V6url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d , address %s RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: specOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitplcpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmppreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfszifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesall%s: can't handle af%d looutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentryroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: failed to queue raw tx frame %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzeeegf2fifrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route contains no arp information arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp%s: bad gateway value: %s %s: malloc failed %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaituvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_pgrmkm_alloc1wkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requested uvm_map_teardown: rw_enter failed on free mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map: kernel map W^X violation requested uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitnd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 scope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionmainbuscpuNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4unknownCPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %dintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled, (manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s-%d%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoopscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %lx for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wswaitwswait2wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$u/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s axen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii AX88178a AX88179axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s %s: extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d urlwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYRTL8251 PHYmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctskSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d wireless network adapter%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus Xid'({^~: 888888888̫8Ы8ث888988888 8,8 .0-)('&J% !$" 53d:x:̌::bb̌::b(b̌::b,b̌::DbXb:ȁ:lbb:ȁ:bb̌::bb:܁:bb:܁:bb:܁:\b::܁:\b::܁:\b:$:܁:xb4::܁:bb:؁: b::́: bD::́: \bx::́: $b8b:܁:`btb:܁:bb:܁:bb:܁:bpb:܁:bb:܁:$b8b:܁:Lbb:܁:bb:܁:bb:ā:pb\b4::bb4::(bb<:Ё:Pr84č::v8dč::(v8dč::,a5i_SrYMBGQTj U^x;ԄPAcU!2Bib!IA.{ q](u9E,g)(Pfb>zTwGIjZig*l=0F`NLͯeerKTGN5)̔;CQ!ECąx d9L9 Dv{Ţ\எ/~E<B!jR^9 ;,Jv'oa`柽pXÝM47S> ? 2;JG&W}Ľ7 4k)0KKy2^+"F,cHf -;IfR@õ'YgL+DnVwqeV|讒3u^(9? d&`5r CŒ[='?kWo\,}LW{w ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && { ifconfig netboot >/dev/null 2>&1 || [ -f /auto_install.conf ] || [ -f /auto_upgrade.conf ]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin@ dev etc mntAmnt2Ƣsbin tmpB usrvarinstbin.profile8} install.mdupgradeinstall  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) echo grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf 2>/dev/null echo $val "# see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!"; exit; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets rm -rf /mnt/usr/libexec/sendmail rm -f /mnt/usr/sbin/{named,rndc,nginx,openssl} finish_up ELFa(4`"4 (pPpPXVXX44```TTTۣeOpenBSD -L0! MP@ - bR KR MR GRkR gR  mR wR $T0@ (%T%@%T!ER00 !T00 @0xS S *ST8,0 (1U800" > `4 -0L00(`d` -0L0~0(`,` -Lu0D -Lm P00` -Lb0` -LZ 00d`,` -LM$`K✠p圀&  @PQP @Q` 0 D T 0R00 (0S`(``40 R0 ,`d` -L T4, -L T4, -L T4. -L T4. 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0`,`d` -L1P``8q8L  "KPP  / s`0S tP00OU0@0V 0000 00 0U0 0 0 0S0|0V 0  `Te0 f` R*Rb<0 00d``4$` 0-LMPK^P \%0: S D4 K@@P0: S S000K04m @ - ELP 50  k@PD40S0o DP4000 T0$ 4L@P 0 4l$A@0000S|8T$D0$D4 0S 0@ Pd0S 0 P 0 P㢶뀃S $0   $0 `0; S 0 @c$ #"T0Hc`V <OS0K,m]$j]v#0sy3Q 0Ss*0  Q 5 啷P a "0  K叩0 0ШL0 0 0 0  P0 0 0 0000000 0 00 00` 0 B000Q Q@0A AP0 0081А(q@00Cs0~1 1R0R0R 00 l R R *p bQ 0 00$00S1T,`lDd`(` `0@`8 `4``@Ԑ -d2LuM0Pb4Ki4K 0( P,04 0  bR, 0@=94 0 =,0 4K9 1@,P 0F 0*yOKP PP0!dPPT@  P R T1TRMKd0P7  P$p0 K03K,p >p   JH0P@PX`$0 p S  0S@P$0S 0S(Kd`m4 -8QL0sP0 @c$ #"0p8q 0 30`p @0( ᝵P0 `V`@ Pl 0S0C0TQP 0  Z <凧 90,`D(`4MЍ -L 㺽 U -L0M(PKAp0%`+gP RP`% eP"oP sP jP```<  0K10 R` 0P  Tp0 0bASPIKAApԨP ҳ ,0INK0@D0@D0  t0K8` 4 p , pGP \0-S 8P 0, 屳Cx8S(4<d -LM@pPg 嚂`P 0S nS0oS` =PP00 @ᬤP @Q  0U0P P00 00 X 0000X  &PU 0 F\00 ,K, ?R0S@p6\0"S4 0P@P -LMp`ႤP@( P(K,K  0mP(0S3$KMЍ  -LM0S S SL0 0@#0(( Kh0h4  -0L  m UD -Lp,P`@Pʲ 0 `$00$ (0@ -L`PVp@P  0tp0oO  tm  -MLMPa 制`P ¥N@ P $@TY  17<P t]@ $@TYK(PEPE)0opP10S0#3P RPPPUp ~Vv@PTP$@T Vh@唐PK 00 0`=VT ?  $@T(K\TPTXT -L0 K M, H$0@H @0 000 ?Pe bP@@  H$S~p$00#D < 8 4 0a0@SMD̪\Ȫ0SdcBG@ P R r@P00SxRbRbRPP,`pWP 0  s00 2U"  Q0@ 0S P $@T 0K\\sPPDBHq@P ,a ! < 10D0 80080 4 H!}ps1 pR18 040DR0Q  R`Z00R00S< R (10S00SD1APMP ,@P@ @0r0 0K;<Q 00S  00 $0SVPH PA0pK  0KeP  _P`Fv@TmP`U(KS|8Hx8XG4TMЍ -0L X U< -LM@P` 0`3PpY0SWʟY;  0  ̰x U p-LP@:`PLգ@ P  $P@@Ap4 -2LdM0ŸS2@P |x2T 7P < 00X@80 4@ 8`K0`pL0 H@ @r`0` ,p  8K\ X  0\K6 1D0 , @T T *   0ND @ (TD @0 9#@0 T *  08KW 80㐃4`T㐖) T *  0LK@d `  L@$H`d `0 6&`` TD`K0d`Kp`p0`K ` p p$ p6<_< < P0Ro(K܄Y@ p-LM`K @Pp 6 6Kpo -P 0`㓅p @E$0L0@!0 @ !k -L8ML L@P  06 P`L@L00U@p80 4@ 8K2Hp D 0pS@p <  LLL @T T * & 0အ 㐅T㐖) T *  08Kk`p 80c4T|' T *  0HKu@P H BD0S%P 0P@ PC6@@K 0C 0C8 7BSx8|8t L!(!!P!! -LM@pPg Lt`P 0S nS0oS` =}PP00 @^P @Q  0U0P P00 00 X 0000X  AU 0 M00 ,Kᜫ, ?R0S@pM0"S4 0A@P -LMp`4P@( P(K,Kˤ  0mP(0S$KMЍ -$0L0S 4A U!! -Lp00p3 P``0PP @@ kP@ sP P aP @ pph00SUTT.DD< ,D!t"!ST"MЍ -L5MЍk0@-XP @0 S S 00 ӑR\00 \00S- 0S Br Q-0L(  Q: @0$D$ -LMP`pM $K4@M0S 0S $00TS#T 0@T$ -0L | U`$ -@kM<LMB0@3S$$Lht 4TtH>  <> @0P P  P &bJ= =hT? D?`PU@ 0!0T PP U0U0T0St 3@>`}@PL >@r4=.6$=j = /=c =(< < << <<(.<-<7<-x<0 l<dPv Zxp6 X0 ,Vv  & 6 @r  &0D0 D&F0G@$<6@C#Q 3R:Z&XV2 ?(|2"@L6vC#00W #*Y/ L0S 2嬆X H0XL  Lp2Q &R@FH RD2TH@ (2R R H 2R T@F|0S~ Z P3T@1|@ wx8d%T%%%%%L%HoD@&&<X$&8P)4h)00& ,D&(T&$) d&x&P S&&&&"&&edA '0'h'''')'(<(h(((())D)\)x))))*@*p****+ ++ +8+D+X+ph`+d+l+P++d\+ `4+S35e: Z t0S<t0 @t@O0 S9Z:;DD*16 v00 倀X㐆 '0 Z|D! H!Z"x0 Z6 Ԁ Z|6`pF0Av0 Y% `6c# X0R@Q Z T0S#%*T|0匆Yx 0@1X TP`S@<!p0S0a @*  ("p!0B Z2 2Z2P2: Z 2Z0G0 Y`x0 @!T  &XbT@ 0qP@UP!T@51u>; Z0 Z0:U * Z Zʠ 0; Z3 3Z2U ZS 3ZRP0H #X0 I>0R 00U , T%l0S\0S00l0 Z0X P0 \00 S0X0 p ZT0xh0 0T0  |0%tQ%pQ%l%hQ%d` \0%XQ%h0SP T%%LTD P% %H Q% P,5`VDK-D0K8K80 4@ pbPPNh g>KR0C6 |T x0"& A c% Z``0S00S H0S &R X :@X  0ᶐ &@$&0ST#3* Rp&L'0P &0' X ZH 6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `,00S880 @0 <De0v> $ 0@0 (  4 t(08Q* 0( ;0S 00 o0(08Q @(T U01U01hL08S X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQTPl0 0 Z0S0 00 V00R:&Xh:Q (0 0 520#$ 00 0 P B240#$ 0 0p, 0P , 09 Z600X: D+& B(KMЍ -LM04PKpa@d 04 `PD 0`PG p00@T!<P`uU<UP 0(0' 0FS(K $P@ <(00S x;00(@ ^U 0(P?P@ -P 0(0 0$K+,|33333 P-L 99h44 -LMp0 :P0 000K0,K00 e 3kPPc 0S` =m@P l `cVTjPC,00HiV0`P,00? YP2 ,0$03lVKP$,0 0)oVAP,00 :P ,0(00S,P0, 0  @P@Q0Sy 00S(K-4444M444+ 0-LMP 0X"P@00 " 08S @b@9 8h"4+45$ 0 0~0 +00C -0000$ 0 0~0+00-00S $::  00 $ 00S <<  00 0$ 80 0= 0  K$00  0$@+0S  $", 0 0 $ -LM0@S00 K0 $0 0`t -L$P ot 5 -L$Pnt (5 -LM K00"p$Pt45 -L59h"n0$"@5 p-L ML@`0KP 0S ښ00KpH5 p-L ML@`0KP ~0S 00KpP5 -0LS@ hK! 0 << 0 p-L M@0K`P ~0S 4^0 0KpX5 p-L M@0K`P ~0S w-0 0Kpd5 D0  D0 -LM0Pp0`-S000P(K 0(P f@P 00S `9t0 0 0S0(9fKp p5|3t p-0PQ`L@ kP  00 0 0 0: P0SP WP  000 00& P0SP CP  $00$0 0$0 P0S`P/P  000 00 p P0Sp-x.02 0-,PL0@S 1L000@0pt -0L0CS0 Ql M00-00Q0^   ?00Q@0 0^0 000hx3 p-l`L@PTX0 P HP8 0  ppt @:4pc -RLMp`P 0BS     e a P_@s7T U Q Z@ J @T Kh @WZ P8 Z08Z 8 Z7wZ 7nZ 7eZ 0]Z t7TZ@ T7@KZ  47 BZ  7 9ZPP? 1U 6(U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4{d@4UL0pU04gU 4^U@ 3@UU 3LU  3 CU3:U p31`@U H3 %< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!@Ty.vaPKZ  \ 0wP0t! UK P `A0Kdpd0\4!U KK(KD:T:`:l:|::::::98|87708@8888h89 909@9l9:9:07`7@7P7p7777766 777:999:99(:8:;$6566646D666666;+;; -0L U U$; - 434L\Mp| x a0@S(| p p  Px  tp"0S|`AIPUt"bp\2x@K |0x1|0 催P<H38x P$sD xPW|00S xKD0t xKDt xpK0|K`,Kl0 h0 >P6~P1P,|0@000C S1 Oz,0@SP |0 !YR) Pl 5?|00|0 |0Ql0S x` K[Plh0S xT4 K\PH6(KSx8ST;\;d;t@t;ht@;4;;;gt;MЍ -0L 0b U; -MML Mh20`S@PP2P"K\D20P0: S #\T2"1Q0T KP0: SXpPbNNK @D@D0!p P`1: 0?x[*K[P'@10S#414!Q(1K0P: 0R 0R  |0R 00S, 4'00S #XPD>0Sp00S o< T0c\ 0PP  uK脅dw4|<<x,< -TTTqLlM`@PfP LP PP: nP sP hP30PPPP eap00 cR1P R R 1@KVP \ה0: S`  P`P[|xT<S\{4MЍ? -LP(@`pB@D 0T4 (p 0@8P 0|40 ,0 $0  0P?>>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0QPK 0vQPM  0jQPGTQ000ӑS -@L啧|咧t叧l匧d剧`c .T T*H~@{88 ㄝ UZLZZZZ@[[p[[[<\t\ -LMe_~K@ oKw st K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 娰K`$& -LM(Qt ,Qd'30QP 4Q0 830 80S00, < 807@@00@4 80CW@<P20PP0P ("P2P20``0` (Pp2Qp 4p ZP 29 @@004@a00,0 9 @P@`0` ,29@@<0P ` 0@VU,20pp0p p9@p@W0<p `p `P0@XW,200 44 84 R20P `0`@p 0p`@P@ @@P8 0_284p\a W4 00S(K\\\\\\]$]T]]]]^ -(0e/S<(0<0(0L@ 0 Sw/eRL^ 0-LMP@+P%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 0sv@KPT 0-HLP0t0@S @00LE0S0x^ - L@?E0Px^ -BML:M 0D 0'0P@4 .  @Z`1`@@TBKLL4d H 8d H员8$P0 8$ 0H#9P 00P<  0/S 0<4 H@Pw :&P( 8c1l00P$P,UY 9PPI<`P P90cC10P @T,K9 D,00 PS t 8/1#[ 9\P0  "Q@@P000  P00000  8144044 PU 0S00X0P` @ ,K0 ,00 S|8 000\0`@PU 00S0V0S(0 KP 0 0BS(ʑ804$0 4$ 8ǟU PP P ZwP P atlP0,K ,00 SP;;S( JUP 0,K ,00 S, 7BP 0,K |,00 S8w $/P 0,K i,00 S0d DP0,K V,00 S4Q  08?04$ 4$ HPC P> P9 P4 P/ P* P% pP  `P 0aC0S0S 8X :X08ʑ 8/44044 U8/44 ,K`0 ,\  8/4$ 4$ "V8d/44044 ,KP0 ,\  8/4$ 4$ "U2`P1 C`XpP HP3"0cC1 @T000C S000 0,K 0 ,0S00S 88/000 00"02pW Wr+Vo ,K@0 tPP`a TL ,K0 e000 P  @@A@2EV0 q,K@0 FPP`3 T _,K0 p4000 _P h @@eA@2PWp8/4$ 4$ 9,K0 <$R Հx0 8.44 HD$1sPd 4$@T$@X@T(KXh|^%^^^ ^(^^^^_ _0_;P_%x&l___X_________``0`H`h` `` -1LM0S(0080S"0  3 *#*00&#0 0S 0Ph@bP 0S HH囝T8#00@ӑ3@ #0#00 #nVp"0 S0 @b0TQ ڐ20S 0SS x20STrQŸ 0`P B00CSH I(I|I8JPwT]nTgT10S 1 0R0DS|e/@9t垍pP `吉f0PPD0@0 ,PP $ !P{Ṍ$00S0Q X 0DSOT e/@pPP `P x80g@g US XgSTP4edAd8 200 "P:@-0@@0` p @ `PpW 0VUT -LM4P @@0`d0p4T @@0P<0@0 ,00S 0 P Xh -LM@ p 0P`ᐳP, iBT 0 @<\c -LP`Dp 0@-; 0P 0d 0LLL @  T0 0@hhhhzcT -@hpLP` J@T`7< @@`p@`{輬 0-PPL @@x@T0hs0 p-LlM`KP7/pL e@P4 % , P1@Kp$irdAdPQQn p-L`P@0 SRR ]P@@Tpp -@LP`p!pP VyP$ @@T -Lch`8iLi -d2LJM0S @K 8Ÿ 0S00Q0SP @10S 1@G`A BCDEFP  P`@P>@TJK0!@'@ t9P 0rSJKL!D1@/@P@ PrU<000JK0@ PJ~KpG(0K@K 0L H0o`P P$K2\a0 t兇@T ^ P{PUኊ(K謌m&hOXG>nm-0 CR 0R0 S900 0-LPH 0S S 9 @@00@0 20018\Q  0xP0訆lKn -LM (R  P`P`20 @P`x0 @@0P` V U`,` 1Z,  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q,P2 `, \,P 0 2  -R`pL`b9 @@p S R  QPP   0  p-L;P`00S@P`0 0 p -MLM, 0Sfhp0@p@P0p `p ` P0XFWD,00 c 0c#r"Raa   ! , 0Y, 0TBNK@D   (KiP 00S  u8'4[($[ SSa B RR,2ࠐ, ^\(K8nzccT`n\TXT M-AML M@ @DB^K8@PEfĖv@80 0$ P`  01v' 0 !vp5A$ 0S @ T S5!"p@\  pW R0D 0  (K\TXTnTS?Y@<nn -1L(M04 S8 k 2 RfP 00C C  P/0 , ȟ 00 ,0 @P0,P@ @P00!4 PP`vpw0vw4 ( @PU 0Tu x圃0t  7#@ 2 @@/A@@4P8 2@(Knn$o U8oHoo -L$M4 0 , 42 PP 0@ `p@ P@0 $$! @P0@K00ppq pq噖0P 40"9 @@00` p0W V 0 R 0|l0#,@Q0PP0 K H440@"(Kzo$o8o Up(pp -LM"9@@0`p\0!@Pp @P ppqZ wxxU t1R Q\0S 0S<08 400Ă? B0P 0P,T)S& 0S"0S ༉9@@p0P` PU`PU` 0@TS@ "Pi   0 0$ڕ(Kcq$o8o U,qq -LM⸁`p7< @@00@P xt!, 0 `pp,q. < 00@ T S7< @@0p pW `PU`p0 p `, cpP`,q(Kou< 00@ 0S @VU P 4$0 `@`dTPP弤(Kqqr,r$o U L1-LDa@pP@ U$!  eP"0S02 bPP 00S0`00C0@T ^ L4"P@0 S0?SU S+ 0?S \TXTtrT S-Lp!0Pc UP DP\dP uPWX 7< @@0(P4P8`p@ !R  `PW q@PA @QT pP @T a 0tt0/S @@ rP8w(0'謌(s$o Uss -LM2, pR,A,!(P( @P` qP`, 2 @2 @ PXV& `@P 00 Ppqݓ pq``ԓ, 2  @i,0" 00 (K$>ttXtDt$o U8ot -LHM2P L R+P@ 50S| 00C C`p  `@P0@P @PDPH0P$Pkp@Pqpp倓tuPPw)QP"( WVVW X\TP @Q< R XY  00 q9#@  @@A@@PPLH 2@@@#0NSnS PL2  )8 \0 40 @ 0 0C C ZP0(F"@P00@ ,P S0 S( 0 K q0pK0pWP   W0X 00 L P0 @@0P`PU` p `P弉pP0L@r0@@0P  ` 0@0 K dq PU``P9 @@0Y@PZ 810S0,0KPA PL 42 80 P@@` 0@ST 0@T00K`#0O&'"< 0H D Q@ঞᆁ@P X0 T@ D (Kot$o U8ouXuuu^u(v -LMCDE@FPG`@A B0ptP@ P`` \0P 0S<<Kh6P$$ 0KXvvP_$o Uv -LA@P 0rS@~`q0`0P` !0S`Pla00C8SS PLHQ@@ T@44T(10S * 1젟p PP oP00@xoP@@Te|đ@d^ T@XXT0S< , 06?gww>$wlZTXT,w8w^ww -LMe/oKH5H/044!06 P!   (Ko聑&oP@P u@` P@ PT`U" oP`@ PU TV@ PTpUhT0ST D x0 VG`p,@ $P0 0 `ppq pq&,`p0@#P0 0 `ppqi pq@h 0`p8@T#P0 H0 `ppqM pq8`p4@"P0 0 `ppq1 pq`Ґꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` q夐 oKe/[uvx嘐7< @@0pV  U x0S)0S&hv#R Q0S0S 7< @@0p 0 R0SR} 0S0S`dTP@t'w$o U^>{ -LMP*TT& U&*PK0 @@00@00 0P00Sa0*PK*0KP 0)0KhPP嶎ap@W00ϓWڔp "0S 9 @@0@0 \ <B{8088S 20000  8 4 4  R0S8R8 40  P ``  040R`8W 弩ᘐ* @P?{P:0 (@P@`0@ S Pb&  VUVU P0: t @2PP PWP 0 b(K U|!@|$oXzh| -LvM @oKe/T HH@P; @aDY00A 8Y1(` zJK "0 @p@P 0SS``a @0"P @PpP`w0 @@1HP`0 S:0S*coOK Ẁpa2V>C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P yl9oK y  !1 R! oKe/?(K|{Xz U||||$oD}T}x} 0-LM H(K K0K0(@ $P ҄pL KK0d?} -LzM g6 66`9 @@0  "Y 0ᘠ! 0@@0 0@XWTS !K0@T SVU5 YU0O?P`P``4;D1 A %0@ ! 2 A !  ! @L50@ş @@Te/oK -LgNK@D*M@D e/J0,0 [P VP  PP 80:0 ,K >n`P U(K0S)0%@@0@0 (K0(KS )(K0D&@@9)`0C` eKe eK5gNKS:5 5@DS:@D <5 Fe/qKe/K 9KN.KA0 BA B:  * 帊 (ZPȟ0S  )q0:K0:K .EP |)E0`uSUS OKe/  e/   hQC #XQ MQ AQ<  Q ?Q4DQRRQ UQ[cQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ^ rQ sQxQ zQ wQj P Ke/t 000500C0{ =w Ut p  P x&0Hf@0@@T^ HiZ (V dS0 ,%M J `Fş0S  <V @@. 0 1V d0( E0p00 |@P 0STE0KP Yp 0<%=`P  0$<ui0Q 40S @ 40S40S gNK@D@D,e/`P')D$7P P0000ӑ yS P00 ӑnRP,400ӑyPgNK@D@D  M`Pde/@b0S 30S QpQ `@0p`p @TP0(p@ Pu  0  z 0,u}V `Pu 0Sr y@Phi  0xbqOK e/yPbPe/  e/ e/K kh e@ OKe/ e/ e/ lS `P M&0S  0P 0( e/00!0|0s03Sp0 XLOK e/P P e/ @  ,P0(K}}2f~j@~ ZT\\TXTp~rdAx~ U~~~~XGl?@STh^(P|MЍe' -T0L0S@ 640P (0 0 06P حh -LM, ,0Q 8P60P300S.00%gQp P0 `DV U@0`, 0S@P,0P0 0gQ k4 5 0 X P `  p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ P@#0T@0T0\ L` 0fQ_ 0Y@TP 0fQ T0T0 <00SPM5@I5KpX p$ P ` mT -?MLMC`pP30S9 SQV5QVp3 0\fQP#N500 Q R30SŔ 20?fQ"]P ?KK(@DR@D?+tP78@K0 3K4 P0 : LK4 Pu0," -?KK(@D@D?+tPPd0! ?+tP @V!8K0@ 3K4@ PF0x!4><1Y@B P K  4 P0)0 !40 @_ 0X f4 0KX0, 0 KzP ,04  ,0 `0WPV(KX P ` T @m؃d4`ح 0-0L@T 500S tPڼ 0P0# ;;S 0@ sPp0 @ L0P@TP0D 74 03@0X P ` حT  0-T0L?M0S@00S ?KK0P@D?+sP 0K0P X `  -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0dQ8pPď P01@P1+90S! 50S 10ESP+0 SDt3 $1 0S 0S 0S  0@TT0 0 00TSPP T0 E3|00t ~3 l00Q PL/38*3X ` L P ̄T 0tT -t0 0LSd0 \@ 0Td RP$ @3P L `  -3LM0S2 2 2mP2u 20S 20S 2"2Q 2208DR0S d2BpP 0: SH0D@@d2F4@X20S L20S @BPw001w2P K ? 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 p`V 0 0 CPRP 0 \0 B00 @00@P0  0|C0pK`  ԭP 4Dhd ̭p8h 0tT 4H p-LMP K`@P0Pp T  T  h@L@  08P pKp舆h Th -L M0U@p 5 005 5 5 5 5 4 QdꈮTT$4@  $PL0$1h4pG 4Q !ATjP1 P0S #P V "P<K40K2P b]K$PE⤠PEp \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SP$"nP`K 0;l0S 2lKpXT -LTMpKPa=0`P`VUTSd@`@a ⵓpPK 0@ᝣ<0PpK0@K. 0KDP\-0 CR 0R0 S2 00 -LlMDŸ@Ÿ^ \P`p^q kp28Ka=0  RQTSAAa U 0@xK>1PxK0C@t1P[ 0P8 KP P000-S 00 00 00S  ph$ 0P0P! P ʳP00:U0S ll00:SLQ10 0 $(0W?Pp褭x8S U P00X 0P-L 0SHpPАРP(,Ⴓ`P=}@P C P|xS@P0VPPS0    Up 0S;ؖX\ -L j`0 U -L j`P U -LlM@P㐀K/p @8`0@P 0pSP  P0: S 0( UVp$Kؠ4 -LM K`;; 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@YPP00S0#3 b7Pp0@ 00S S00 P0P@80     B@֯0 0 C8XT -LM8 8 4 /_/P800O0hPo匟p , 0 00@JS$\\,8\DP\\\\\\\\\`L\\\\lx\\\\\\\\\\\\\\\\\\\\lx\\\\\ ,\Dp,^,NP 040 = |(? = 0-S0S, c 0,0 i=W= pe-00-=  X=bPVT \-00P= 0-00-0F0=1,,0 00== Z  0Y P0 G<00 @0< 00< < << <0|, x<0 p h`, 48L,pp,0S=;0S , ,<4 ; 0BSPZ ^0B8 SaW`00JT000 3KP/@TK D`p?Px[ pXPP ` ,PyP%PX+0S  @PP  R h h0`0 0L*eP`ZPY :{{h*Wd:0`*W0T DP9P` ^P\Z00J@T000 6ӰP2@TQ `P CPf°PP |uXPP l /PQP(婰PW0S"  @PᙰP P P10`00 P`%8x唘儈ZP49 ,PlG0S 0Se`OP 0S]70Z88儧P0c00@JS^L%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%#`%4$D$`%$$`%`%`%$`%`%$$`%`%`%$$`%`%%$%8%`%`%`%`%`%`% !(!X!h!`%|!`%`%!!!!`%!!!`%""""##!`%#p膟@~P6PP 6P 6P 5P5 P %d6@P X6P 5\ 6P\@phv`*a0BS!T""""\""""""""x""""`00000 ` 00$00tS@ R[[,PZ45Z (5Y h4Y X3`P ᅯP @T 4X` pDfd@ R,LS@@ Tfj#3lQh4QPL O84@44@00  ,BWK 4W K@>@dP0V0= P8)3%PV/-U0"U0##0T0cPT\PSS0 ,#R00 R00 Q0048"pB @1("(2 P  " R  2R  B P/ T1Q ) (1 \RXr` `0 S|@5\R>P(20S`00CS0 /0  0 P00S!1 |00S񟗏('(' ) )(8 P8000hA04Szh4̭Эx8p|`8D TȭdX Tؚ̚ UT$\TP(Ld  thx0 ,x <pc<[ܭ̛$ ĭ(0n9  0``XTLSp 040S04 80 B4 !L0 8P000|@04 S0 (K -L@L0S 8 0R, 00 QXܜ U -0L`p0 PA?R R *RJ[RG!QQG (10SE /QCP0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS  p-P/Q`00C@ nL R  0Tdp0P0 P0A*00AQ@*00p p-@P`L 0P <000CS   0Ppp 0-L0L@P 0U(P  Q@T0d  U -LcMbMKKM(@D"@D 8 3 ( p#3mK`F`F K*K  0KPm0 0R0A`KpRV1 :*K(:KVx P,&RP \R0/S 9SK00CS& KP2SP  0KQ S @`T K 0fT  ` KV* R V ZKQC :K(=K 0` c Vp]  K0SX 0PSU 3KLL X0I  KP(v0@P *0S0R00S :K8S  K( 0U0(KQ 0 <[S:K(*P3=K0CK0Cll(!P<[S 3K*KAA(!K0(K` 8Tx U -CMLM`Pp.0S Y l00C00SӴ0S 0/S  <S  ? l<0C<0S HKP,r0 @ P.0S 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp,=0 -L@ဨp  Q.SW|p 0S0C W` PiPl 0##!>C=S0Hbp0H S]0BtB BtBAtBAtBpAtB(A 0 <#d !>Cv.B B 0@<#!>C0  0#"@!>BDS0k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0Džpq -pPL 0Sd&/T`P00  S,UXB .UQ   w PR00EU0F@Pz ZV 0SP00MR CR cR mR00000X\ $0` R= 0S P 000X% 0S" P 6 #000  0R  0R 0p \0P P0@@@@, H`ԡ 0 0-@PLD 0SA Q0S_P4 0#S \S0#S@ቆP@   # @|;p0Q0 R 0S  ㊝P 00@ 00  0=lȢ 0-@PLD 0SA Q0S P4 0#S \S0#S@5P@   # Q@p|p0Q0 R 0S  8P 00@ 00 d 0= @ -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 ᕞ -h LM0S T`p0PU 0P` V$K - LM0S0 0`0pC 0 SPpG1S | 0Sp 0S 0X `V*X 0  00 0(Kx| -` L0S `Lp0PU p@哙ᑙTP` V' -0LpW- 00S)00S% S# S! ; 0`@T h0S0S 0R 0@S 00UiR(  -L@LP @08 0MP\ d -LM@`Tp. 尝PU& 0S0S 0 S 0PS(K00@K0! 00 0 0(K= -MLM\10SPO D10S 0/S BKAA=PP & 1a0Q䠟0 MpP 0@K,K 㨢00 0p堢0p 0&9P  00PK1,0,K 0 0 @嶑ぢ00 0z(KT -LM@PU`p=  P 0S0S 0 S- (K00K0! M$QPP 9P 0 @ 00@P0 0 0P2K0K +g (K= -0L@pT` QP 0SW @P@D 00 0` 00@= -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 㯚P2 0@ 000 0 xP 00 P oP@00S0x@0S㈚P +0 080( (K<x -0L:P -@@L0S 0P= -@@L0S 0Pq= -@@L0S 0ΙPZ -@@L0S 0㷙PC L -1L@`Tp0 Q@@T *PP$P' .8P  ֙@P "8P 8P @0 00@זՖ$x -x0L@`TPp X AT P  ÑP:0E0@ -1L@`T^ 10S\ |10SX; 0d P @U, H0S0S 0R 0@PS  ! 刑0  S;00 S00000CS000a_EPP 7P p0+0 0L00040 00PA(a(   -MLM1@Tw pP!@T; nK`F⼑`F0S 080S0S !  GP  L!_GpP @T a= 0R0S:5 1ʘ`P% @ 0D8Q MP a=00 @l0 00`\ L <᱕ (KG 8Xx 0-@LPU 0*Pld0d@` -dP0PY08 0,0GPHȦئ 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P $U 9K04 Uh --LM(@ P  <RSK -0- LP0M0 0  0P0S @0S |08S p00d0d T>H U8 $v> K004 Uh\ -D0L @R !P   0 0 D 0-L@Pt2pPP `+\0P OA%@00S 0 K00贪XGPDMЍ]M 0P Q0A000  B@ Ѝ 0-P`L p 0 y  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 Sᴯ -L Q#Gܪ U -l1LM0l  y 0D8M YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ 1Q0^l0  L00@ @]l4X@T (KPTlT̫ث -|0LM0 K m@P3D0@ @p@30 fKT4t-0 CR 0R0 S00 0-LM@P^0 !P)) 0 33PhQUTPE@H00S< K0h( K0hg$@L`ثXTT -@L0 0Q 0 $0Q0 $ hh -L@Q񟗤l~t~hp <hpxLWQ6~~~~~ (08@HPXYWUS0SO #SHFDB@><:864;0Q xt?lhd82T!PhH0 $#$(,"(h$ Q Q  q0ShC <8#"h̬,pḼ@h<`|8\İа D -3LM,MQ (K@ 30S  lLdkP K(@T*T IK@3(@D8#0ߖ K(@*җK(HJK0#(@Dbϖ*×0"Ɩ*㺗20S "ẖ*㮗P% `V"嬖ꂢ@P~ 0~ L2H 04~ 0("哖 KK(@(A*ㅗ K*(@倗1 Ra 10S] 1K@1@P 0Zvp` 0Sv6(J@P/1)K0 B0/0@v9K00C/0` /02v/0T /0 &v/ 0 H K0L/0v)K0 B0/: K 80 ' K(@ *JK(@DS ](KXTT\P`|\XıY@D -@LT  p3Kp3#D\ -L$M@H <KL U1H000T ,70  L K1 HP@j 0 `S@@ D` &0 S6 0 S pP D0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P@@$4 pWş` P`^`0S%0S0S*D`0#p5 ᷎` R0 H 0 0 B0 00 0403  rL0D0 04!48#8@HP|40S /0u/@0( hY`\D@`0 FRL5;DD4p0 S A@PR P@0 T$*0T@:@PQ* Q:L30  D`@0010QPL I@ XDH0HP`Q @11:Q1 Q}p@WJ*P 0@$4,<4("4g! apGW JiTO "0S0l 0 JR !pR@T 0W T( VP 0500@ c>'W` p'*P 0@$4,<4("4! dpW\ J TXBS$3  % `4E 40K00@000 ' 0)[R00@ 0  0 00  0`40030 ! D40<2S\@K(P "|#K K0 KPdP $>x30 3@ *0K@RP830 2@ )0K@BP20 2 00K2PDpB@KP,#<0K@P P|< 80R"80KPPn0;CS0eaBP"00PP 2Q"S "Q0S@+ 0T Dݻ@80$@p A0 p\Kl`KTKPKLPK 0   0 \0 05KзP8 0T @@P~0S lj#: P0 傎 @ y@ R 10S:넰lx8T{Gz?TгA?4(@Xl!S.ApPش`4<̵$0<`Tض\MЍP -0LS1P`@t( 0S3T 00,Ὀ`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R| - @L R000 P -LM0 ,  )O P`4 0CL 100R 00 `0001  L0 S  `0 X1  00H 0P,1p(0@S0  "0001{U V   q0p t'@0 00C0S  c 0000S Pq0 p 0000K101E(K|,X` M-LK0C 0Cp4  0pH.`<$2 PA(0S| 1x Pu (0PqlT (0($4@_ 0(000@S@叅PPxxF <$ 0@S ᒂ*$P㊂P(0@S4 0p00S ɹP 00DdKlt1!(Ph@((P$00b04pPÏ 0 0C0(K|j UDXd p-4P0`L@ᢎ0P7 ⥎P10 0L0S' `0$ 0 000C S |tttttl0 0 000000  00pp|< p-8L@ChH1PS  0D P6ph 0S 0 R0 0 : S&L f|00S V `"\ L00SHP10f1phpl| t xķ -ML Mp$ l4 dK< G  0: S00h4 h$5R@T 0S + 0S ƸP! T  V0`00 0,0K4pdK`0 \` Xp vT0K;8DP0S@eP1 44 0S ?P $ P 0S 典0TU 10C1_l3x#0@S0 dX3 @@d @3i0: S= Dp@ P 3 Ÿ0 "@_P`0Y"0 PPLR0,0K\p X 2 `0 @dKA0<"',2 X200S H+wE~KpG82 pG0"p@P 0EKH`G H @ PG "0 0f"@PV 0dQ# 0M@P|xBP1 h4S00C08 HA   p|l$r @(@101>00 00 p4sl| GKN000S (Kt ̷ط| 0  LlxX`ȸDH -ML Mp`@Py fAK @ @0/W  V V0W 00 0S:0S:Q@P A.KHH0 Q B B4NAK AA HK( t( -LM0  -LMXb0$p, 0 (@NP4$0S0 0S-,0T*0PdPP#0So H,@(0 TP0PPP0(0 0(04PQo0@ 0$@O$0SJ 0SG(,`YC00 P`  (0 PU` P$`0P1 ,0Z00,V)U' P"Pd(P 0 ``0SOPR(P 0$@ L,@D0T00000(K|0 -QLpPB88Q,0ST 0E0 @0 o 0 'j5!"@ 0$@$!0$ P 0 0SO 0$@ ~5( `"P b0 (0@  eP`tl0` ~P ~$0S 0S| UD -0L`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q PTL` 0-L@4,!PL00S' `0$ 1 000C S T\LdLlLtL|LD0 0 0000000S0 0 00 aR08#80 0cP 0 4⥇ 0|< 0 00H 0-LM@P0`P~ aP00 0AS ꌸ0008 8l`| 0-\0L @?PD000S0S P 0\H 0-P0L@T 4P T00T0S 4 0S0S: 00 p-0 0LR@`PU p 4!40Pp 0-h0L0S XX 0 0CAP} T@D*@}}0000HTL -@LPz}00茼 -!LM0P`@0@U V!0S:0S* \2XXJWG@Q@(0@ 8 4 0@ @;$0" 0 ʁ$P, d0 0P0O0 0P0O 8 K ! ?00,  Cd@d0 09 L0 D0 (K萼|P - q@4$8 00P``0 0L`0y(@0PPr`pp\0P@00 00PSPTA(@QP|й -QLMp  P W0X 00!0S:0S* hZd10 R QD14PoV;U8 a(0@P 0 ^42 0R,0 0d00  0 W ?K, 0`To 0 <5!"@0 @@ <0<$0@?@1 0 |H -0p0LWP/`$`ಀ@E # U*W!00S 0 t2"@#0WH00S @0 42" t|ܻ0Ld -0LL@Tx?d0 X00S L%DP $ 4@d00d000|Ժ -0L: SpP` R@l  q PRq hP p-0 : SLP`l0@@0P`Vup 0-PLM @nU  T T0U 003 0S/:0S+:PP0'HshPEBx00S d: P40K@ Gf ,*K0 ,(48DP -Lp`81$0B? P4}PP? 1 ? 0V 0 P0 00W0 0@0@0@ 0$@`p U!(,0 (4]h0h 0R X@d0 0&/P8 $(00 Q |\HL@Th -ML MH 8`\0< H( <(  H8PPBHY4`F#@ 0h ` 0`p08 PA0 ZY8 0 0@ @ 0v8 H42 R'8Q$*@(0D 0S H8BK!@00@P嗅BKAHP@  D8X:1@@K8(A!A4( L L R 08HS H<H0 0m5 @(0;H80S00  ) H(L@00 08L/PPH8i@w  Q QY|0@Pt0 0  P Y4X:@(000(K|<лxH -KML M0S000,0P> $0: S S  S S1Q;P@K 6%RKK$H0B?  ,` Hp Rg80(S00Q0S+ @0 040( $P@1$C1/ְ!0@@ S  Bdp W`@PK@pK.K4 B$ `4\P 0CD PŸT 4  R    0 , <80S00  ! @00 0W NPP@ Q qxyt0 l0PP@P 4 #1@`pX(K|лHx -L`p@UTP  *0 R  H n@0SxP0Sd3` 00C0H M<00  ,00 t`@`H -L0S4 岮0000 $000000l$p0\40@T12 eP4a 40StV2 @ #0S 0S np P0S  0S L0S_ P屮x#0S 0Sd `妮0SP M0S@ !0S0 0S  > 3 3 0 "0S "0" 0 0b2Q T"0SP6@K P4bU2 0 0hcQh,"0S T2@@@T D("0S 2@@T 3!00!Q0!090S 0K+A00@000 00b1v1v1v0S" 0Sp l10Sd` P TKP " (4,0K 1P 0S  Ʒ2I02 Y0P0Tx8Lhܻ(S st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0Po%X:(K`l@ TL|@TķXH -ML M,0S0 R0 0S-0.S*0@ST H)0@ 0 P8  8 )L0Sh `0e 0Sb (00 P89089 U(0L 01 R0*1K `000JK )1Kql0*a[S @d}P T8 / 0@`T0%TK8(K @z8(K` z,0@f0,07 00C0 |@? P8  8 ,0SpP L0S0! *K `0)K0)1K(JK l,Q0 0 0PF0b(K0 ,00,06 00C0 |(K@@@T4 `V T}P+0@ 0$@L&L0SW `0T 0SQ @&`  P8 8 EV%0 S Ɵ  0 S ş z 0@ 0$@0 $ş j\%(K>K$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00 P8 8 8 0.S$00@m P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0AS,``,0Sڴß0. < ,0SQ 0S 0T P< V0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx""T20S dH P< p ,0S00@!L0SU `0R 2 0 0B S T\LdLlLtL|LD0 0 000000Q, 0B S 0 0 000000 006py P8 8 |0  00C00(<Q89008 (K|\{H XLd` ,8`<l| -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` Gl 0@ 0$@X0  00C00 0 0 J 0Z*TL`\|X -Ԡp`L,P$ Q00S8 0S 00@00nT  R<0 08, 000C0`pGW 8d -L@@B R R 1 !! v P 00C   nppWo``Fe`tn@G!_v3 0@4l DTn`0@dn^ P-L@ ,00S  hq( -L M3X㠓,  ; @P|c+ fs#`3R,XpW,D PU,, +'4 0@c00 jn4@A ?$4@2 0$Ć4堤404Un4Qn04(LnX?004Z0d2  0 TB+40S2PUy0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` @d0 00Sd0\A,%'@P+6P 00S 冠p`P@ 0R@| aA  T,` 40 (KP|S@TdX\ܻ|  -p6SMLM@`V`@X6K`Pat ,0: S M Px &5PHt ПiE0Sȟ 50S P0`S$巟l50S  l%0@dUde`5pp ppppk k0S P4P(0$<0P @9D0S40S4-K B BP PP@  ,%854# 20dP@0T0T <ğ<8ğ8$4ğ444S4$@40S4F43ST# 3R0S c$(0#@3P=PP .|3|#[C2PP(3$ R DtB0S 20Sl2RBjPPT`p4 S  ӸĔ    P VDP|| `P4U<2 00B10@Wj<2P0Q ALj2P  Bj1P:6j1P0@+!0@P04 21004Qh1 \1 jHA j0S01 P 1k?$KXT`t@P|\p(Lhܻ| (3Ptt?jd`<<X`\L@TH@-`0 X0 B@ Q<0<4 0000Ptd -Lٿ@㘳нͽϿ@ -LMANK< )r\s f0  㵽K -LDMRl S V0W00l  PU10000C0Sl  aX@< dK@frl0 JP0d0 l0X ,@Kh Y0 T P 1`0 100 \` Xp dK$ 0T@K0`0 \@ XP T` Pp 0 dK rh0 @` o D0R/0h 0D:\`KVWH0 V W h ?00bh l0h  ao(KؠT`90H -L,<pPp0S 00CS00@Ӥ0J@t@00S0#3 tPP 0h0 0S0 0`00<00SL06#3 0WPP<>XTмܼؼԼT\TļPT̼4ȼ - P0ĐL0`p@T kmPP PP|X00U T 0S0`00 ?0S̼\TlȼP4XT -Lp`OQ嘁嘑嘡@3b0@S(,8-8-,8-8-8-8-8-8-8-8--8-8-8-8--- -0-@@@@@ 11@@ ܷ@0 + p0 0R000Sp00S l00S`00S<00S ^8P@<0ؼмԼܼļT U 0SȼMЍ -LL0 L \ 00 (0 $0 0 \0 -0L0  -0L0  -$$ 0L00  Qd d00A00d0R0R PK8ti  -,0L00Sh匨 -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X gPPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S g0PP0,0 @cT dg@(KSPT -QL(M5K ! g00 0K  # eP D@0@ 50KLV00 (50K0wPQK8i  -QLM@ K f IPPw Kd&@K4 V(0 Lp& Ki$ -|0L0@S h ? R00S L00  ad,0T, @00 0 0 00\ -\1LKMp@DK Q~f0W@0 < /fP RoK`F!UAP /f000@pD K$0K@P  0J$0 R  B d0S 00S Q  R ("(04"40$\ KdP] 4-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,ռ0SR00ӑR00Hӑü@ 4 R @0 S0SXTST -@RLP 0S 0  TC 1@0S<p `(<㎼0C3@ R 0S,x ,}0So|t@ l R @0 S0S400S(>hT>hYDLXTT p-0LxMPK`@ Kbe00 @PPKeP1 K0400  @T0S DB @K< T00 (ВPb KpTi@p 0-LHM\@KPH +eD T T(0 孒P? K0iH| 0-LHM\@KPH  eD cT _T(0 匒P K0iH p-LM*@KxPx` dh @rpP  d0 01Kdp Kp8i i  -L M K0, @$0 x\p  006@K|P`x  `dd @/pL  @rK&p0 K8i i  -LM"@K }dTT0 L@p [Q"0[S "0[ S 小K8i  -LM0@KQ Wd!Sd  P S0 ؑP - 0减`p@P0S |0  w 0S-|-0lS  PPU@Ki (XT4HT -81LM@8Kq`P  cV@! V/P  0}sp@ 'PK 0`cP !d400`႘PW8@P 0 a  5P ᇌ 㬤$KxX4 -2ML M`K`K@KH c@ cH RK0C 0 Pn` K0 Q( K18 P導WK10S 2 70S ^KPE`@pH`4@K"FP<l 2W[H[w[ᴇ[ᰧ[F[[f[ 0 `{ {Ws$ 0S  @HP0T00S x屎@`PKh@S8T WLL(KPiHi@lxXTT4Pd p-L M.@K `bP0 @np'  4R00SA[T0K 0SK X嶣T001K,0H Fp4Kp8i 6|i  -L M K@,0 $`\p  0偣 &0@0P0S puhbP\0@Px`h@lP @bP,0@Pp@tP|` K@B -LPp`@P0 SP 0S@ 0-@PL0 p:0 $0t -L`d00XTp@Pp 4  00 0  2 , 0-@PL0 p0 0D p-PPL@0S00pd00X L΢<8@P`RPPPpd -@pL`@1PP@T p-L$M@`P x <@K$ dPa` PT #P@ 4` P$Kpi$i$ -Lp`PP hd po0 @Y80 0P(@PU  -L@D008 ,7$00(T -L@D008 ,$00  p-L$MPP& C`@ C0P  `5@TB{KD@K$pG@pG B[j_ f_ 0P ,p N P "4QBKK$@D`@@DP 0 ꎊ0xS  \P@40LUZ@$Ki ti XTt/T - GL{M  W_0K0 mN 囌Kp8 _ _N 卌BOK`4 ^ QN t@K  ^T CN TqF@K  ^ 5N c\@K ^ 'N U@K ^ N G@K  $ ^x  N 9pwp3`v`3  2"RS XZ 2SP@00>W @[8 T KZ[Q 4Qȉ.@K {^X:LPK P3 4 4KKAOK屉 e^}K 4 M 4 TP[P Q[ U@, @ I@ @ IIJi冉VZ 01SW]K-K0  0S X3 X嵋ph>,AT 1S1S1S(Q$!000C S0:S Q $ kPF`T 0S,,δQ;V@P T"R0S x@0S,P|K "2S*0S' ,o0  h0 `0 Y0QhL"Rd0S` 2S |[`1P|!A tӈ0l P01S H10S N S|0[ 10S ? xD00S 00S `p@Y(K8i i8i4iiiii$TiB  ,4@L\pi XT -ML MPHHpe@5@ <54%A05Q(X$5QS5QN 50S  ٳU 0S 0SS03@3L@Kbd7( \P ;Lx iPW P|,P<tuSP   ( LP <0 <0R$ 30S | 偳30St(q(`v0 lD30S8)b)$g30S  W \V20S@p `Q00S Wp嫇 7 @,0T `V@pPZh20S`B`R 4T0@$0$@SFNKP@D/LRKLQK4\ K1 ẉPYK4[S` SoKL[ <PPx?P,sKK[1K[!Q``P?K@ P@OK@@_KL[K <V?P,QK0 S/K7T$10@ rPQ%t0 gP0Q g$K謪x(h,tXTT6i(x8Kigi i  0-L$M8@KP$ [ J0S L\0P00C SX8@K JP8z00 ( p K0Li$p 0-L$M8@KP$ h[ J0S \0P00C Sh8@K JPHE@0 8؈pd0SfK0i$ -LMpK@P4 .[tH A ` &[A0K0 }J1 媈@PC[BP 00S0xS 0K`# rP 0 S 80A7S$A0[S K Ό@ KdP00@KP 0 8J fPh@K$ Z\ &Jt TP`0X X0 JP@K8i H`i4i$i$ -LM`pK@8 P`KZ@ Z0tP0 L0 0P0 b P1 P0 0 L H @ 8 T Px1PP0 00 C R0:S@L P$pK@` 80$ PD $0@@T0P0S+0(0  [P000S00S  (Kp(P`K $0K$ @({NT $0D` H0 `@KX IL0 D屇p< K 0i8 0-0LM0Q  PKPP  @0Sl^ZP 0S 00StPU<Ϛ 0805$ 0-TPL0@S s<0 ㋑ 0P@0000 -LMpp0S0+S DP`IOK`` <(<P,Ḧ́307 OK.|Y HK P 01S@K bY032K4BKOKI_K4[ <<P ,H呄_K.DY HK2 ĆPP01S KvnOK.!Y` zHK,2L ᡆP-01S ,v42M42I42E42A42=42@9425Z 110ST OK.X\ 9HK(1 p`P01S: T57,"(2 4"02 / \@ PK0 UTPK0 UTPۃ؃ &$KlL"i Xl%i tIi hQi 0P]4<D 0-LMrJ@K .00YP. S q .0#YP. F qq 04 $#$("(Rtplhd`q\20 m 0@S d :S["RJ`K .0XP"OVL ]KPEqPEK@  0P9 @R5J`K .0XP- 1 kq0hq4fq 04 $#$("(RDLT\dJq00  QAq09qKp`0\,$<Lp9lZ08LXdpĄt -LMMŸK2(H(`KJK 0(@D"|R)E*Fdb0`"E*F0@"E* F$20S " E*EP% `V!D(@P( 0T, 1- 0, 0!D KK(@(A*EK(J* TE,1 R7 @10S3 1K(H(P0@ [,p` 0T, @P0^- 0,-T 000 @PD *EJK(@DE |YT  (Kh ||x,ıY@@DTT -L@6 *&WT  p3…p3| -@L T3 00R . 0)S$0,S!,R @P R x00S R d00  Ho P:00^\TLp -L p3 -L M4 o1p0 Z0xxo04 Pg\!0ES HoIUGE 0K)B3[ $#$("0U8:"[Q04"48#71S.p@ B,,<4("4 < ,0  Ta,K@:  18# "[04"4858#p40W:(Kp -L4M 0@1Uo8pPNoKoHoPJ`K7P .0X("(-[ x2 t00\x00``Y>8#8 Ġ#Č( O>2 p`Lh t0 0PP=>&(04"401pP51& ("(04"4! 8# !̠R#8! 0 0KF0(̠,<Č4("Č!4 ̌.<$K $ 0 u00p@0@PK000 /@00 @0 0 0PܞD D D D D @@E0@2S$$h$$$$$$$$$X$$$$$$$$$$$D $$$0L$d$x0P:;M;0/SS" CS AS%!GS LS gS aS cSlS sS 0<0;0 0;0:0:091P0SSF000K 00 [s@8 <0S 00S 00 80SR; #1 4KN4 =R* 0P 0@0050064tP 0 000 0+  08 0K< 0S 000S 0 S0 :$ 0K* p0S 000S $ ; PsP `> fK`P`x 0y% :&f'Vx: P:Pʄ +*; 00sP 0X00K 5P00S 000S  9  X 08^07[0 00v00Q@K D> Y   70 P h` *00  ;<9 On09* 0K)P00S 000S 8 8P4 0:;7 0< 04K>4 < R 0h~T(<0K4p <30:;:0:;8(dp27$@dXX HP 00 4!A$7D 0 0P 0PP @K = $g   70 P'0S00Q  N;d60  D66 PQ/ @K s=   7@0K P $\0q@00S 50 4@%0)0 坈P@rm`50  @U@`K@)p' 0@@ p刈P)0( p~P~4 0Sx9  hʀ4`%0 R0HS004 0 5.$ 0 %00;0>4 44P N ,40l$0 0B0 S)$8#80b:3@0,@ @ 3 ,0K'4 @0R,0 x3) ,0Kp DQ,0K ), * p )+ , p BK0  < d30S:00  <B:  0KۇP0`20  )@& @0K@@ ʇP30Q sZ P 32Pz 1P$Rp p X< 00 00!000, 0R PP4S P$ : 8"0s 0000000 ! 00 0RPPX`Ӟ@H8 00)00 00 0 `PP@K@Kh% 0~P << |@00S PP@g l(px8tT?.A('D'h0 l!S,hH4\ $$@Tt4 Hh'ut<TlLTlDHp |@ U@kUxD00)`0@0 Rs@P0    0W  )0. 嶆P880s 0 )姆Ppt!0s 0) 嘆PV )03 剆P@ srP@ K⾥Pycp8 $R 0S(~A8PK8`P"0`bPdbd0h"`XPX 0 Sū~d"(0K) #"E(@K0b0$P)$ 0P:PT0)% P1P Kf(@d @$ f,4f<nfAq `߅p܅d30@Յ3pKdK 30S 3#cXpKPU 00@T P0S @0  TP0HKH0 TKaP0 0 0K0 r:M>K0C0 40 5@K X0 T p P }P|0S 7{ rP0  $e <5 R @E0SX5X \50 c0BQ x50S}lp3MЍ 0-8P8@L4 k:  0d U(t - L}h -BMLMpP4C0e0,@00 ,0 4rP dP jP4@+ aP( uP zP! tP!ڄP, @j4 >p 000C S0 L$Ip00S84@,0S 0KgSP X>pq 1 dR 0+S 3L4  L$ H@TPp00F S.VWprP`V@W0P 0p `&:Pa 0RR!>C 2#=S0X:@ PR0T TTT\T4@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S !00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0x1@PQ0GT1pW*@10S HKpLJ 1HPK`<K0S@<0 8@ 4p dp( <K<@ 8P 40 RP/  P %ZHQ 0+SL HXä Y ` 1P P|yMK@D0L$'Mddx8SP4,LTdxMЍG-@ =c?0Π $0 c`BΌ!Pq \ 0@BAA1BS0㰀-\0`PE 0V>0@-b=D 00APPQ=-C0D 0 L0@R 0 -0L  U -H0LM<0@K*00$5$0 ep LW -L@0@ 0s0 000eP 10hGm$W  -Lx p-LM@ K``"ep[ @ 0P0NKT@pL /<0P0*5KpLW -L`M0P@plv 0 0\ X XdT`  ͠\0Πx *a(K%W A$W pVV?@{Gz?~@MЍC0 S S  -`0@P@@T0 LQ <00S 000S.6:W0| -Lq,@PD/ p-L@?6P `$p -2 B 0LP@0`P 0S00d2M $ -2942@60P/S @P5P 2 B 30S ),',%,#, 1R]P @5PPE ,U 0+S-S0Sf*Pc*Pp+]@P@`%p`T)UPE00S3PZPP700S 00St0Q. /'p9v8P6PP ( Th  $ 000 00@` 0-L@PU0 0 A -|@L0p0h A0\0L A0D00 A0,0 A00x -L@`0X AP0@ zA<0( tA(0 nA0@|t -L@$000P h 0 0S00JAXpl 0 AAl0 09Ah<00S 0 -A< 0 %A` 0 A\ -D0L0S (0@ThVh{0 0@X< 0 @T -h@L0S X00SL0L H0@@00S40$ 0@00< - 0 @L0 0@<|  p-0PSL`0S <0 S @Tp00Sg, 0-0L0S0 0@|00Sp0` \0@\00SDP@v,0 T@J$0 0< - 0 L@ h]@d p-LM``P& 0S0@ 3P& @T P3@0\ 2H 00P (@K 0l" 3,KpPdl -L@P h}00Sh|"  `p  @100 0 P"^H2 K@)1 `P0`S@ 2  BX>!  `M  @100 0 Q :1 @K1 P  `PPPp0P0ASP `100ST1  K^w|x\XhdhP4H`ltLPR8<8:lp#h<[dtx89"@ |$:,9T̂<\\D7`X -2L,M0P t2pPpLPK `2`b0S HB00rP2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L K0 KDP$P8T@ -PRLp@q*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ@U  ip i()(@,+\0@-T0P?0" 0@0S0S0 R0@0P 400S4Cp@-@00Sp($$,F6PI`pP<0 5-=?0S> 06S000,0 0@S200 @-0 4D044D 0P 0- L0S( 4 @ 0   05#@0Q@ DLP 4d 0T4#0@0h0t -0L yp0q 0 -0LPU5 40 0@044D 0S"040P`0$44p Td$T(d,t$0@044D $ 0<pqh1(p -0Lp`PP#F%0 4@0$($,T044Dt T$= P 404(0$00 4sit8 p-L@ 00s'0@ -4LpMP0 Q $$0R($0R,0Q00:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S$P3 3@ 40 400@000  83   0 0 0 $4(D0@0 00 2P$($6F`IpIpq QʡP4S4S 4?  0=p@Pq@1'M20dtŸ q 00010*b%pl P'-1 4D0O4D0P0030d4t|10S) 0SN+K X&nL10S@1mK/P(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PN*0(K 4tL 0-0LPU ,4S0C$(QP40@[P $4(D 0@$4(D0,40h0 -l@L0S~p D0,$R0,4$4(D 0@$4(D0,4 -1LpPW`Z 7VYp q  V0U00I0O(?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AT0Q$(080@00,00L -LP l0 P 0R 0R Q0$4(D0,4 -p0L@T 4 x 04pq hW0 @/pLp$ 0 010#PTQ0S4:Ss0p 0 00 PT p-L 000 x 0Pd `P @ r 0 04 (0$ + PTT<040 0 ,0(0 00$00 00 -LMp@P `@_00C0 S%"0 .S0K0 $ K K p-RL@Pq0` +TUp -LM`p$ @PD0 `p -L|@||PM$pK(`K  [(0S0C(0 0$ 0b0 0R 0 000 K -LMP@p`+   e0` p-L@LMPK@%+`@@00S x -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S'@0 S$Kp -T0L0S<0@@Y0 0@(0 00 -P1LMH!0SK$@K0$p,`K0PK%,0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4 80@00l?T 40S4 h0 c\0@d0 YH,0 ( c,0 0 b00S C$Kp 0-P0@LT0 0S0 P0D@ (<00 0P0s300 -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kp p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PKy 0S ʈ"000 0SKpp - 0L00S H p-PL`@)0 Rpx00 AP@*P0P0A0Q:$0 \p p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyJ{}yFB00S S=A00 S njQA0S0S S _QA0S\0S SXx1@@`1pDA00SG?#=!p1 1R0R S P@0S00S S ,P@0S%0S S!( 00 S@ h@00 S 00 SS 00pPphp -LMP(|||p`,K  ,P i@TI!,0PT@:0S0 0 0 0S0PP -0LMK0 ! K|  -LZ#P x0pq  T0 hH00S <@ -0L0 07   000@90 |Y0 pU0 dQ0XM0 LI0 @88A40h'ؠ9@ p-`,L@Pp%ph  -L@f0P0+p  ~pP$ p0;0` +* @P00    ^OPp T( W i[i- -L\)&h -L!3XPp0帐@@P ` 0X 0S0Sz 0S @ 004 0S 0X28eL 0-L1P0#S5  S S S;/S 7S $S4,00h] 0<#00h~&P0 S+S @P0S *0l0l@h0 0000400 00 0h0p -@L @000  0-LP6'@@DT*0 p-`L0S 00P !P t00S S Sgp pDP Rph*0@000s030p -?LM ? /> e nD ^00.@0S0> G*.0Sed.0S:  _P  P d> PM T>0S P (> P> N0S $@$P T 0S:n B-0SD0eS`p]`p-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx Q@H,0SP0!W@  +W W R0R00@0#0<0WT t<0WP h<0WuK* ,PN@ 4 @K0@0SP +aGQ0+V0;/P%WQ W W W !WG W*W @W07S,; 07S+607S 1*. W W !P 0#0CSXP;0S P LP )0K*pK*K 0K0 @0PT 0DcSPNMOQLTTDWDUhTPM(MOtQP4PTFRhP WHSXQ(PtTDU$QNNLQDUM|MPUPUDUSR$OhUVQQ$RHR@TDWDWxOPSDUDUQODWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWDWF 0RQ80S0SX80S88;  2RQH80S0S; +0S0S0@,70S 0S0Sh7  0S0S0@ 0S0S0@$70S'0S!#0S 0S0S0@0S0SD60S86 D RQ5,60S5 5RQ55  # 0S0S0@!0S0@D50S0dSd0@55U xyQP o mn0S0@4 b_`!8 8K@XYnU00SN0S00S00 0S0@440[0S 0R<00S0@("d3P0  0S@3P0   ,S3 0S0@{2P&0S0S0@=P kP P ^ 0S0S220S0S0@P 0S0ST202P8K80 b0S0S0@PT1@P P ` !001 8 0;C01p0P 10P} 10 PPx Pv !t0( #+0p0Pi 00Pe 00 PP` P^ _Z 0sR/Q-03<L0tTD@ 4 LTdx4 pu 00S(00գ?0O<0 R0S0p  0c0RQ000S00գ?0O0 000 0S  0p9 !0S,00"00S -LMS0 0`p"(K00p  80 @0P4 < @0 H4 80P00S T @DT70 3 R0S -<Q PP,00,0  ,0 P ,0S:@ R r 000 R00 ӑ0Q0 f 0g1@UP1,Z:U00! 0U SPE0Y00f0(KPTS -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0 0 -0LM0@P3 00P/ 00P`+ P=pK,KUڏ@@ PP`  0@Sd`0dV0S0E@WU@DPE,P ``(KTD@ 0-LM@PK ^P8#!P  0S NP 88 -LM@R,  P @- R P`Pp W!Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00 - LPh - LPh -Lq h -LQph- 0-L MP0S& @K 0s0s alP&@T T0SP0 ca000 0@$0 0 K0tdPI -@LPAt -L|MB0PP 0S U P0,K0 K00 pYP@@00S`R`> PX2`0 H6 P`0,0 AP8  8Kg8X 0 8 Z g -MP, 8 8K10SP ,P X8K8p yPYP ,T`Z,1 o 10 @1 P0 , KYP 0K 0 0P@ P@0 0R0 O{0Up00S,8K8p (Kt`4 xd,p|D0 0-LP@(@P NP0h0 -`LP`pW`V@ZP PT 0 L 0 t 0  t 0 t 0  t p-L@P`P U  P V  P php -L@uh P-L 0ht -00LP L h`8Th -L@A 0r/S@ R -LlM|K@iP8K 0&K -L0Pd -L@%P 0@sS @ 0-D@L0PS0kP(000P0t -L M`, @pP@0S 0S P W @P RX Y"@rXP@ d \00T @ P  d,U @000S0(K -LM@pP 0S `PKh@@@1L0H P`G  Έ@K PTh -0LM0Sp(Ry`P" ?PڄiQT@Q@N@@P 0@T iR( -2LM0pS d2@T+PP0`|S -S` P} Pu@@@ P0T`V_ X$ 10S@ Ị@)K P X00P0SF 04000)[ `@p9dvp@d0S 00CS00PӤ0ᆤiP U g0H u RS @G 2p@P00ᯇ0Sp(XT -LAMPP2  0zpq) NK,PKp@%`@ 0S PP   0S*P P` 0S:VK  -HHaLp@P#R %RT0TS 0S %R #RP +PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P  d @ P R xt -L@ 0 pS` R0S000S`PUP@000S 00 0-LlMKPP@0: S@@;K0 p-LlM0`0SP @@ P4  KɁPPl00S0: S x*@! P , /PKph<00S,0P 00S00C<'00Sn 0S00\ -Lp@P`WV 000CW`K@tPuZ UX`yoXpWZVX (00S@ md < -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000 -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW yUV UV P@ 1P @1@T@ ZZP`!hpP`qXUp4q2P P AP!XT 0 0S0uv 0 0S 0S0x  \p 00pWZYT+00 oi 00Su< x -LMp`P P 0@IP9  Kiop@P(q&V 0ATP 00S dP@P 0p@Pq Kif 0 K<0PP0PP< P000S SP000S00P0000000   -0L`Pp@P `VV'(` W  00P`p0@ 0 @ `000pW 000 0-@PL tP 0T T00 00C0 R( 00C0 0h 0t p-L@Pq P`pp P P@P40`0ps@Pp P P00 -L$MpXxWv`#0S PHC0S <#0 QPW 0L@ P08 40 TP ~B0S ('@ T T "06 P P p/ PB0* P 000 ,0 py0 , 0KP0K0PK`p@ !00<0  2\ P P=tA0S9h!0S5@H 00D @0  @P!0S !0S<@0@X P ` 0P`@DTʵ0@0Y@XW<0KPp2D00S 0K8 K PP*(KL -LMpwx 0S P#0S t3tC 00S@_ 0drP0p , @P0p PA0 K  00 ,0 80K0KS0@K00* x @0P`Pɯ`V* @T PXW5p@q P P`pR0gt T"@tTP`80S4!P00PUo-c  8 TPPx1@Tl0ST!0; Pp@@G41P`@ @ P?P`@&0K3@PpA00S ( 000K@P*00SZ 0 P` D@ P P pc(Ko(KL -L MP`, EP,0@cT D dq~@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko&@00CT h00SeD0@@x$0 0@@(K < p-L`@PP  P p #@P$00S ph -L`ppq|Dp@PqTh 0AUT0 h8 T  -L MKy*K  K p-LP ph P`pqP0  Bph4@  B@PQ phpp < -LM`pp@Pq KP |00Sh0 W V @P,0 $K!uK  P\0 0TSP0 H0 D0 @0 <0 80 40 00 00( pt$,000 @00hld00S X00S P~0 @P 00 000000$lh0 0 $ -p堀0L@ PP  `P Pk `A `<P`@hl Q-L?P=0@P60 `Cp3 PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@PhL p-Lpq0 @PP-p@) 崠`t T 0 @P00CV]P z@P@P0@`@40W 00 X`@PhL -L0<0  000 $00 00 `4tP -L0<0  000 $00 00 lHLh Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@pl P-L0P8 P-L@ P0{P< M-LMp020 ` @0,K]P W @"st VU`@p20S52 0@ ,PK, PP P% ,0 S P0P,!0 xA0,0 ,0 SPP b@1 F(10SXX 11 0,K,  &PPp00S 0@0@0@Tʔ0Z 0$K0 0CjRh`0 0\0L0p0 0 0P  $Kp hpl -LM0@`p P@D\0@@0@T (P \ 0  p -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ !@ p,0 0l0 0`  u0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `S `` 0 B\AQL!01`l  @0J$!00 0S10! GP`F(V(00S TP 00S STT0  0 P(K$(lh p`dpu  -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP PpP3V!p0x!0S0Wp!0d!ӷ0 P#D! 0P(!0*!P0W!0P P  P0W P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (K( hl -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3,0$ph0 -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 @`d  Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@tPE(`@0 0`p9pq7  0@P Y0$X!QP"`@0 0`ppq 0@P U0T 0/`p@L$$0S0  00e  0-T@L0S0dS0 PP(000P6000h l ,  -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0_0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z @l h L -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@<0 50S , -50 S  R a0@ S-00LA0@S0?pH  0-L MPP @K0 000K0t 'Pp-L7 $P'.P ^P"L1L!@00 0%VP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 #P phptp p <t \   -L M@KV0s0s ?00@3K t -,0L R000|<@B -,0L R000p@B 0P 00<P Pk 0 l  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 8 K   -PLM@) T TV\Q@p ` "00C0 S10R!@œ0,STT901 0b 00@0PK  0Sp` T  1` @0|T @K aT @K ,0`04 0$K$@ Kd` x  4 -@PL Thd0 \.X,T*P(L&H$D"@ <8h2| |    ( h   P6 P P0 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@808 0K10 SK0@DHH L P 4 P-L800S (0 0 hpxؠ -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp   @P0t @0S  K0 4 CK,0K0 K  $  < X `  -PL M0 " P P>00K.S K 000 }0S0-0S $0 0 00S00K,@Kp t  @P0t @0S  K0 4 CK,0K0 K |   X  Q PPP0SP 0 9 0P $0$0S0S -Q0LM00SK0 M K  -Lp@P000C0 S @ h,,@0`0 C0 ST m@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LMK  K  -LM 0R0*, , 0* 8  @  -0Lh  -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i e fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KD$0S0R90S V0V 0= @00SSS 0010,K0,0 -V 0 \0   000CSP KL \ x    -@LT`p" |0pP@W \S0 S@$S X P 000S00, -Lk@0    -PLM8 B Rp,Kz 00S S 0 8K@|2 @9P8@ 0P `!80 %5*$P  P P+P -PnP! `$0+SX080 u!000 o0Pn ,80 0+S6!;,\!0Sn`z`@^PPh4K4@ `P,p 000CS;$ؽؽؽؽXX@ 00s03X@ 00&aFQ 800S8 80 S  0P 8 800S\0P8K @0S,,P 80Pd(K xp < S 0 Q $ 0S C  -dL`P 0SL0  D@  R000 $@$0TS -p@!`PL{PQ s 0n 0i -LM d 0 K p-LMP`d@002 0@?Kp'@B -LMpT`@@@/0 P`G  -LMKY K -锠PLp` 0@SP0000STT0ST0#S   -L P P Pp h -0LMo@p@`!0K!PK N 000ec@PV-00e  K -QLM@Pp@tPp0%0K%`K 0ڐ00 f0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0㰐00 f0@PW-00f l$K -\0\0L@S L0 P>P p> 0 0 @  | 0-L L0PS000@00 R+0 P00 04@ 8 -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  U 06L`P K 0-0L0PS@ t00Sz P0@0S @00S b$00S0 Z0|p 0-L@PUD 0 0 4 p-0L0 S P` 00S 00S /0@@ct0P0S h00S ph1XJP0 @@@ 400T,0 ph|0h, Pp -0LM0  l0 `0Pp `K  0T0EPZ@PCL<p3 -LM@ ` `\Q  0R QZY!X11: \` 80K@P8@ 4P 0` ,p (p3Q 8 00 0 00 00S0!P(K -@LP:F00 -0LM0@Sp S00S $f 0PcP@`0 ` r 3D@P 4@PE`Up p p @00C000C 000C?001<D 0@-<0  0h0@P4 p 0q-  + Q 0%P#4p@q 0Q 0r S 000 )P LP808 PHZ0P:j t,</(0$0 0b0c0AVphPP  -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 L @phP,0&H  -XL'P@L#D <80400,(0@4HH L P @-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3h  0-L@P5<0  0S0S0 R0T  -0L @p30S -L h-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0T h  -@LP00h$00S0 0   -LM@QPp@  PP0T0 `Kp@&0P@ p 000  0S : `0R  T00S S@00S 00 0 0 PT 0-@LPT 0S$  0 0 -L M 0R\4 0 ,0 T  A8 0@i{ @ip4K0PO8 a# U  S R 0 O4K0@ 0@ U S4Kp0OP` U 0S, X D0,@ 0h @ @P(Kh  -L@MP`X T0 *@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00KJ p 0@P`wx R@0K0S @ 0bS0c S  0PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H-@L H@D ,LD 00K@%P  AP 8K00L 4@K @2P m` p\XPB H008KL 4@K@ P3 PQ 4H@8D00L  @"AQʸ00S 4H@800DL  @LD QP 0 `LD@@(KL$ T  -L4MP43@(3$H D @ < nPzP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K -LLMvwJ 010 @0R0 , (Ko00S )np@Pq f, R00Sp q Q0P 00 V58 00CXZ (Kon(K8< -0L0@SBPTpW"0000S `3p@tPq G`00CV80p8< 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d ZP\B0S vH2 00S 3P `@P1p@Pq}@P$10S S  1 ````%vV@P 0@PLa0Z c@Pt u Z JX@Ptu t,@ (P u(8$,K  0pP h00S00X0S  D0,K * $0P$K< -L 0 0S0 h -<LP(h 00s030h 0       000L 000L 000L -LM0 $ KK0 0 TP$ K -@PL \TL h, -1LX@ @@ _> Q60  @`Pp0S0S 0` 0?0080  000S iLp< -LMLp`KP p@P0[SPKT[P - L( P00贪PMЍ -0L 嬟 U -LMp@ኰP= 0S<0S S5 ┱1 bP) 0B?S%⇱P (KTP P`$KMP  $0SP(0V`U S0S P00 K -L 0KM#+ -L@M0pD[ ,0 OZP,;@T@PP :N@PP> 00/P b@P{>0 #3 RD K∣L P T t3 hh0o,PH 0  0S004P !PH 0' r0 S@ 080 4@ 0 0S ,0K{ 40K,K80 $PP0L僇Ir@P 0`D0 @@ `0L"<0 T@ 0 "@P" TPP 10S L  0%@P t(= lR/P/N/d000<: 0SLʘP 00@ 㳧 d%Hd0,4"40 0  000D0(KT@T    ,\ 4pؠ -H7LGM@ǟM pK,X , 0 gbP] LP 3P2 2P4DP| IPnTP5 PPt RP~UPl aPy-oPx gPF cP= dPn=iPg lPigtP rP sPawP) xP\90S00I0S t0 < 4K0 婁40S t0X :t0 *000&t00t0;4K0 勁40@S <1:\pt0\@ 04K1 u40S t0h 8t0@0t080TD00 ~0K8K$,0K7 PK P1 P' P( Pm@P;  Pg&P00b P@  P9  P$  PY/PE PS;PE PNH000It00t0;t0 Bt0@00S 90060St0 < t08t0000 00##[L t0 7t0 < H D @ t07t0 80H0 t07t0 80D0 t06t0 80@0 t06t0 80<0 00S}i4K1 Ԁ40S I82W4K1 €40S @7t0l 0t00"0000 ;4K1 妀40S t0d 04K1 哀40S t0p 04K1 倀40S Dt0` 01 !hpn 1 0bS mK1`F@`FP6P  @K P 0, /P E0-S x8 t 뮥'  x8  4  L hS(<4 -LM@pPg j`P 0S nS0oS` =$PP00 @P @Q  0U0P P00 00 X 0000X  8U 0 D00 ,KC, ?R0S@pD0"S4 0`8@P -LMp`یP@( P(K,Kr  0mP(0S$KMЍ -0L 凛 U46 -LJMlTM@`p,K  弄 帄 崄 射 嬄 娄 ec0@S`XdD HFD D $ A 77, R5 p <(, R & 87 ?0, R  "@ 0@ , R  072@w"Cgp2 @K@ 0dS$1@0 dX" 0,R00S HA:X@K$ 0  YR $R 4< 8 00 4 $R "3<0 080 ?040 0 00S <0S 80S 40S 10S|V7$ 00S@K[4S #p@5,嶍$9 K, }+InK@P@pK`F `F0 K0`$ $pIX IK@PA A 0@K0_ =Kp(Kx87 8(8|D8`8Sp88#848 99 -GMLM\K@PJ/KJ`p$  ?Kfp 0 K h! @P 1SS1 @P`p4$P  *(K,9 -LMr #^K 0 )@*tf mK`F `F 00`0V1!!x1|Q * h兮,K0Kc,p0S`PP `,!@ PTP` 0 R I.K0  B4P P P 00 P|00l 0S P I.K  B0P y*<  00C0(K<9\9T"9l99 0-RLM@P 80P  0V899 -LCMß@lD 8D T @ BKLLL4 @S0!P 04 H 4 T H0$2 P#|Px5 PP @(0K 4R S@DB,4[S *S+4[SL0  @@(K0$SR00 ӑb0BS     x      P       P 1( K@T0c@DC*(K8T0b(K0PsD4 S4T DP(K0kCD(KP0m $CDu(K0PCg,[-X+XTP , A ,KD`pAU<  0@P e 0o@P`p+X 0 0?@P -X0 0"@P`p<$"R L 0P  0 P 0PHd 0,00S HD 0WO0 0(K#l<\T4Sx<< p-1L0S p<00S 00CS00@Ӥ0k{@@`P0S 00CS00Ӥ0W{@ Ppp  t00 (4YTyTp<TXT\T4 -PLhM@oPK$Kp 0d {P4 QP 0@ Kh0P S0h0@0[?S $P N$0 S@@R D@T,T K<<\T4<= -QL|MP p`Q`` ? 0 吠Kȟ 0` d :{P?4 P 0@(@Kh0P Sh@0[S@,0  K,@K0 @y{, @R, 0q,0S(K,=\T4@= -@Lpd {P|4 P @0 S00H@P:JP@y@`@`$P.J@@\T4x^ -`PL @8pPNP @0S P@# -LM@`p 0C)@0S$ @P 0@P 0TZ00 W0S0( >(K#===== 0-LlM 0@pP  K=p ,奖0: S S o3K04= -LM0 p, 5 P p̉(4000000, <0  Z0 \ 0㌈0 p50 0 8F$5 0( (0 ,(Koq'(KrdA>># -L@_d"0p @ЈPQ   )p00PP %?00# -0L0@_ d"p PᨈPQP @ Hp00P0S %@# -oLHM`PdK@ p`0[00SHP0[00SC@0[00S>00[00S9 @P3  $Kr$ 0R  0R  0p @P  $KU$ H0R  <0R  0SKEFI PART 0-LPq@P0,10 -LM ?KP@&t h@KK@ P`p$ Ό P 0U@(K -LPM p`l @` p1!o$h@K&> @ P@$ Ό @l 0TP(K -L`p@PP,0  =sd -&>LP`@/ @$p@ T@> -PLM@x U01U01`$0pK0pPo` xV K p-n@PL 010100C1ph} -01L`\@ h!&> .>C\2&0]280S0<2<0S0S00@20D200CL200CH2 0P2 x0TR(0Ġ  0SR 0X2e0`TX2h-|U8 0 S00 _QD#0S0?S< 0S 0S0?S0S -!0LS PU $ m  p0@P@c@@cPE@@PcPPcP@ -P!LQp$ h0 @ A0C2. 0 $&Ts300d0@T> -LHMpD WVT(KoP! 08 @  `0 @P0p4p  V< 8 `*`, pN040(@00@P 0@<P 0, D 80$(Kx>>>#D? M-LM@0Z P`VV`Z!0SSp P 00 ,?0"1000 00 0,?0"1000 38 00!0000g00 0`$K? 0-LM P @0?000 1<000!00! 00RR?000 1<00 000 000 8 -L M`Hp SY.DDwD B 1P @@ ^W 8 gEp`W`$K?D?@ 0-LM 9PP | p0R dKKvp PY@P D0D 0;mY 98~~~XG06# -LM$, ,Ka(PK0 @Pv(`\p  ,P( 0 PvP(@Q , t Tᔬ#@T$ X$0㖣#A 8 @$$Kx^@0@H@h@ -(@L |0S @"@ -@L  &> U@ -L4MD( (K8a(0@S$$pK0 pJv$P\`  @10 (p8v@$0Q( S`  $㓌.LPKp薌$0N0`0LK000 Kx^@@@ -Lr -LM1@"S92RS]2SPpL1P00 "^K`/0~p :@":0@h00S   B0 @001"0 KALA`A|A 0-PL@d0A -L M KP`p0 @u 0S  !$0c#!aRR pxh@0S`VT Hk@h@_ ?0_K@A$AA B -L M$K0 pJu$@PT`  \@ 0$0P (31P K@ -@LlP  ;Te <@_ ?0 ,Y 0 0$B00 -h1L0`SPp@DV@<10S T (10S x>@00S T 00Sc>@T 00Sp`Q>Wc80 400S h  h:>xTXTxln -LPr H -LPh H -LP^ x -LgPT  -L 30S:S0S6R) 20SQ b 0R20SR p2 2R T"p2HR 0R08 KPK:h D2b PKR8 K-_00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@% X`"`0P$ 0-d0L@PT 0P<00s300S @00S0$ -LM,Kp `P+ |Y Z [P Z N UP!Wt Q,00Y Z DPWt @,00?, ?CP@OD⍏H_E`VZ -GML MPPMK @D @Dy}PppKIJP`0: S, KpP  S`,@K P pP |Pp  upP'6`,@KLP0  @P@yPP @䘸@00 :n@P P匸:00`P T00SH :@0 P$T{K`IDII4 -LM K?`P?pOC 0PPZ P tP VPpOD`VZؠ -L`p"88P@!hP aPP fPtP vP0 P0 0S$0@< Tp0@d  P00S +\00S P00SXe UA oPP@Px8$ISMЍ\ -L \J U -LM0@00C0S0@0K 00#?00S  %$x8J -L@8P   00A SQh.  $J -L@ P   00A SQh- #J -L@OMpKx ,@ xRE `,@K6mP) gP! lP 9P,sP oP& uP xP! 00000 0000 e k  X !K<P/Pl -Pd P\ v/KP0C!0C 4? @: @T 7 p@ P :PxU+)Rp10!NK@DlQ@D0d!SL-0S Y 0 /x +x0S-0S KAYA xxdU R@,K ,SPx ,0#4 P ]   T6$(K $K,K0Kpcp$$DKPK'  -L(ML DK5KPlSP0AD0 @@ <0 8@ <0KD0 @@ DK⽄P(w $  t-0H +0K)Kl\: b\' N\ T\6d\ f\ t\U n\ p\} v\ y\x 00000w000+K *Kzm0KD gp48 0 l0V] +#XP0ST :hP 002`@  P H;@T \^3L"0S `  R4  0S<nS0oS040 0 0"0"<4KRP0H0 1 1 fL!K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAN M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(K O -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (K Q -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(Jp0P1 @RO V  eP00pS`` P ?X@pV Na{Vx8VVSMЍL 0@-<1PR P @ P \ l0B^ ^@51:^1@3:4SD 8#8S@@@  <,4$ !4 $X$,,<0  0ASP 00b00h$'-0000qS00l0 Q000S0 #h00S 0 00bR 00\ q00l\h$ P Ptp51PhP  (PT$P0P 8P40,($pW8\W47ThWxWW p-@L M0KP`  @U0S =VƠx 8 l, #44,< 0 8 , #444 ,<0!0000KpWh$t'' p-L,MK0 ^U@|0TP` d8 <K K$0K, (P $ < 4@ 0@ @@s|pKp'W -L@"000 0BP  0;0$Wh$ -0@LP p `  0B0 S` a0B0SW`BA0B0S7`BR^ جԬ †  PP2:0d0 -X1L M `R R p(} p @_0 K T \  0h 0`PU U'@ $ d 0f #<4!4"<00P0l0 P A PLT G Ri>i"XT -QL@B <84!010S  m"pP WP Pp0 CS   ^P` W UpZ t0  CS @` VP<00S$ W 0"mN,XT'XTpc p-LPL`@LD8 T0$ N phT8&0@00@P `@TP,(8<0 L L0 #00S (Ko 0    00S (Kot (Ko (Kt'XXX,YDY$XYlYYYYpW8\W47WThWxWYYT|&YYZ\$0Z'XT -T L0R S S0RS  P0 (V  p- 2L M0`S{ Q  u0A0S10 0CS7ppܺ(@KPxd\\!T@H!R >, {Q Qsp , j 0 c -|00S 0@00@P _@TP8 <0 L L(h0 BKp\$X%4 P0S: 1 `00 0PPyYR* `0S 0S 0 P s80S0C000t-p0@P0T:&(KT$|]d'$^T^'[H^\$^ _ h'8_P_d$h_t_ -PLM`'P4뤒2rR@ nP TP dPtP vP qPX2T2@ L2H2y@@~"#2p 2P2A341pPk p1`e0@SZPP P 1 eP> PQ`1tQ R d+H1p< 10SZ  0 pgeT T T T" T  TT 1T Fk0 >d0@@(?nx8'p'h'$d$\$`$|_S,$T$_d'_l<]$00S P"!P $0@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0 VP`hPXp b9bcc P-L   <4("4#6 / *ph" -LQ 0S 0S Shԣh=0  c" -LJM2CP8@K Ծ 啼08PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KT"SH <0 K'#T"!lc -L-KH $M0R 00S \:0-K0 KV p-L`!\P@+0R0S   p X0S\dLTl0,($  php,b9bcctc p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@phF800S (ph=0 ph74$,|cP P P !P($ ccccc-0 CR 0R0 S00 -PL$M !P   1f!1 R10S PA !P B P !P" !P6 P  S S0  00S00S Kh~ Kh&"P   Kccdc$c|d`ddlddxdd$dddd$dd\$pcdXTT -L ?L0SPKPP |2P t"0 S00`\1T`ɫ"0@LK P KP 0BP0 P R 00S S S R  LPP@c=PP0 ?L0!S V X LPPz2D @շP0 L@P #㕷d1PP0SH1 u[ \P ^QUf$feeeHfdfffff$gK0C0CLD `4 PD ,0X$:̵P P婩L姩,0X$JP|L x JP d JP T6@ D\$@@pLD  ( J@PH$R  \$/pLD PD $,0LD PD Wp/Ꮅ:`ኵ@@ᆵP00T00S4 T2*P0#03V0S+ H40@0nP@@iPTT* W 0S ,0X$,0 L$ P$ FP CpL 0L4 P4 0[S]@P P0#03V0S @T 0:S+0p0@T$ :'/P# U P00S P:R V  R0305P1 : :  ` pPP$ L$ PW 0S V @@V 0S /8bP@@@`@#0S}0#U0 @0 K  8K DK0 K40KpKܕ P 00Sd40Sa80S^  [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DH倕P 7Md00S40S80S  ᓬ[[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pOD屬@Po86D@ 00CS, Kq4L K1@P 05c-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,40$0S le@T <$ 00 t`C`'D  .PP0S((0K  # -PFC`K` |ğt\hğ\pD 8$P,'CV 0t0t0S `,0KPP4ȓ0S S ß,  ,0KP |, ) ,0KPB 0RS 0S Q00-S ? tN R>dN\>0S D0S   80> 04 S< 0@ D00S0H0 PN0SpNPW00<0S<,80S8'`= `= *xp0<0 08 SLjPQ 00|SM P>0S 0 S  LA<8h= /W@P000T  T T/00P<0S0 SPP<0S 0 S ,<0S  0S DQ;0S  ;;0S q|;P @PHD0S ;0 P}Q  d X PjL 0 00S*  R'թP;,0 :)00|S m@ \, ,0S  H*0S00@:: fQ, ,0S:< @40 d:0S,0,K=P0S;0 (j0 SJaIP0P0 y@P0: S L)0S00H9  90S ?9P90S S@9 00 L90S,0,k90?Q0hDy0E,@0S,0,S p X@`T;(0/S' 0S 80S0S#'T@K00/@0T0 P@ 0TKS#0S*a0S0007 MPPX``u000  70S3 60S 60S+6R&Q$60OTS 70SD7#K07#,60S7 >6 6=aU Q&0@VD X>>4F  , `RPP@",p60S,00#30#,F-p3P '00 P@T@, :RP0S H`?840 S4 4 40,; TL00L0 Q N0S#`T0K 0OT0 P@ $0S D0S H$0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,,PP)0S, , nT t T 0S,|,^0@(S吃̣ `p0Rp@h30S000@0,P 430S,00@,,P s L0S (CL K^20S. @20S D20S&,TK0S0S *p20S2#"2#<20Sl2 X2 H2`10S000#3 0C,PP 0 SD!0@10S,00#3 ,,,PP (40S0 0 40,<8@0S@ 0Q6NNQ11P @0SP@Cf^_ 0 00''Pooooc('(}LWp$V(LhL'd[V0T@(0RtD0Sq RQSp00Sf 4 0Rbv p\ X qY <0l h lK\0Kd0 `@ pK0\K@P呅뷒 0J?@0S,1 41 @ LIP10SX1<  #tQ01@P@Y@40S ,0S40,00S0sM!0S0S<8(K -\4LWMPpP` X@K8 $4X  00KT P LP Op!xPKIP DP#xK 0:P#xK P0Bx0[S xKX K00K+P pd  PUH3 004`Q,,#30P ^K E000S  <P,ޔ0S2 IJ`P( P0S* 0S 0S  <㹈P(, <q@m@`PUV<1 0 j\xq 0040 @^4 K0@ P<B0S (0K  # mPL<HU@A@P00QS P 00S 00 RI~PP_LP [L 80K8 ,9T0<0 !(K,W\ (rHpxPpXp d[P?P^LWglgtp4[kP\XGcpp -0L  IoR Up 0-LP\10S 0P 00S(@L00@P000 (t00S h0P \00SD@K00$0 (0  P0VcXT'[ -LD0@0<S0( p@ XTLWk,V -&6LAM x&x60 pᓤh&P 0SP60L6+ D6<6PP464vP060fP,6,P(6($6P6PPm@P 0S 僤PP |P uPP oPPP5eP`5  BP|5|%@U00S 0@TT@L0@P 0S 4FP $AP <@p@3@50SG]4P4  40S447]P TPH4   D4`,pKH40@BS񟗭(RS8RSSSSSSSSSS@RSSXRdRSSSSSSSRSS\SSSSSSSSSSSSSSSSSLRSSSSSpRS|RSRSRRRHSShSSSSS \3 g 00A@3 432 2 2 1 p~+, 2R7C T242 `RQ|"|2` 0勣X2p3X P0D"0#00000!1 pF+,0"S  !000X!0(0 !xpF1 P04R0e04 1 011 118P ݄P 7P BNK@D@D +H1@804S 1@P 0 PaP(Krl[PpP|qPHpt >Pd!?"P T\ (0KP@x0[SPG0x@KU @p PVG`PT=@pP 0w03T0S P X0 SpP h00S`0  (K(V!vvvw\TDLWww(w0wt2 ph2 R`2`2PR L2P 0S0P} 20S MPt10S 11 >1@ @1 @1 @1 @1 10S1@1 (!0`h0PV P @P< ۙ@PP 0T.S@D0P00 !=TP P00S00  V 80 = R00  00`pVLWXwPd[lLPl[0WwwPwwPPw=L V/P8Wx[ VG[PP|Pw _x_x@Wp[dLs 0- LM0P@0P tP K!0 R r X0000 T 8@,P 0P8P0x_PTLW -2LTM!0p`0iP^1A0 @0s 0 @0s 0 P |1|aP000 0000,K0K4K(0Kd@K@$ K$8K z, ៘80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 wpP@uV00S 0| <@0@_ V `@TP ;@P(0tpu0 Kd[P8xPT_@xLWDxxxMЍ -000,0P L 0 0<E,d Ux -4LDMppT0@-S@X塘P00 P. p. + p. p@. T\@KQX0 0X0 d!T1P_;0K 10S 00#40Sj@(K@! xどPb0S .X @ npO0S @ TC;Yt0p@,dxS4Txyy ypu$y4yK 0C 0C8 SDSx8|8yL!(z!!! -LM@pPg  `P 0S nS0oS` =ٖPP00 @+P @Q  0U0P P00 00 X 0000X  4U 0 T00 ,K@, ?R0S@pD0"S4 0@P -LMp`+P@( P(K,K':  0mP(0SA$KMЍ 0$@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -L MPa0KG,00K!PU`V\2P`@R0 @(K](,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K2@0(,<4("4!< 0S 0R@P0 R 0b 0O? š 1>A\0@ (K@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# `P ,,P`@PP Q QP 808PS <<UP`@ Upp -\LMP` #p 00P  0]" 0@T K -LM0 ̠K" K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,K@0pW,00,0  40 R, (,0 " R:(K -LM@   @ K@ KdU00P' 0!K -LM`P @ppM o p@ܓ tP 10151m;p-ɓ0 T`  9p廓  0Qo5<Tx̄ -L M@T<Khb@D0 .@K< -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0#0`@TPT -L M0@SHKh  P @L0i/BKTt -`0 MLȠ ,Ƞ0p# KhB  -`0 MLȠ ,Ƞ0ɘph Kh#  -LAMJ_K, ,KOK3Xp`P#0S @ r(P @T T m R 0SR( K0ACp <.`V440 JKp, ⾐(KlZ<|@ p-40L@P(3,10/`@<`* V@ph$p -\LP㭉pP`N 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  1(P(# ,P *(P, 0P #(P08Q 8pP< <8 TPU@ @P40040`8 -LM, pP BR00S ,嶆0',0tR0S (嫆0'(0P<8S 00`<S$0 00S`A<呆8< 0V 0V^18SY꼗Pa@<w01800Aa@<m, 0188P<@ 0!׏0<8 <.ꅁ`<Q,0@188وP<$ <8 彏< 8 0!a@80S1S 800羈P< 0!砏PU `W40040$np@\`( -LM@P4K 㺑0S  7 KOp0 0 -' 0SD 0S  !4@K$ $`K PP 0S -pt* @T `P;4pK@0PS 4@ UT $1 1P (@ᶅ`40(K  p (P5`P ( Α(囅  ȑ 啅@4pK0S  犅@ T<0 80Q KDPul|@X0І -L$M@ᓑPPT ppd @@K$ D i8 ᗾp #0S 庐0`҇P,   ~p 妐,P@QPUT@D0 2P匐`m,@0 P,_Ki$ 0HT0x p-0L0S00@T,``0@p> Pp 00\PD8, php(t(d(h( -L Mp@፻p P 84p, (2(勇@P –Q0Ka( 000 0 2K᧷p _0S [ P 2[ pLl`P q#0S @AZ0S  㤻p/ˏ @0S0(K0(0 2 PU00@0 Ǻr@ 0u0@ 奏 tH0s 孺TX=$K贇ؠ0̇(؇$ <l8<Hd -L M`*式24 PB2 @*rP0"0-p P*J`P$*0"!pP*,0``Sp! `"pP0*,@P``A0 pPv*@`P"pPm*``p(0Sj !pP0`*(@P``0 pPQ*@`Pl!׎pP``0p0H:E1=U80 80S ,1 A0 !弎pPp``+*P Ujn0 e~P @`P_n0 Z~P @`PTn0 O~P @`h 収pP 5:L P(K0d0p|̈<|܈0P@ p-0LM0@S`* ZKPE*P *S Px%*pNhP  K@*C PD%*<>JK@Dv>Kp<T\ 0-LMA0SI GY7KA%0P0040 0R  0RP 5F00@Tl@Gt00S0@ @,A  80P& 808Q 1 0S{S0000S ? 0S  0#S ,K x00P 0@T 0 ᫆8zp` \, KHp(`048,$Ѝ<$4d -P7L|M@7P P(W G w `FiPC cP dP LP;#qP2 uP&`5 lP2 0&0.0S 000'0&K0p 0: S t6t+d\Kp 0: S 440S `` &p5@ 0dSDA|eP 8@3S d@<0<+p0<@f d\ 40KzpX8044o b|EP 0嗋{DP 4PP$]=00{DP 0P 000P 0 0 㑲4p峄h hdgP\ 0S0D0@$ p8 Y (opp 0SH 厄Kp億e70\K@0@T-s*Tc@{S00SgdH0\ *pZ4; P( \0SX0S .˹dR2.p`@< ,2P@,  q᧹@F880S  -HBpt,(0K* #P Ppc0<0 PpT p p  Rp|  oph  ᦓpP kd@<去408Q 000[(K<x8(d(l(\(`(L<hS0t( Ўd@PT 8_h(  (<D\hXЏ DdXG4p(Ԑؠ 4 -LM␀pP(K` P  z@PdH (0`0 000@0@7,Pa,P @T8 -LMp 0 儃,KJ;PXP; 0P P0pP ,`@0P @T T00X U R 0SR@  ,PP ,PP P;Uc(K<|Xp -LMP$@Kp A?@0CS@P@ T ;P% :P0P $` R@X ƀ  @4 ;T $ @脑 -BMLM`,KL  D4@P P0pP,Pp1@@P p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K] 3@P Y,PB@0 S P4 E D$ {4KsP 4K @ TP42j  RPl  JP HR {  =P    3P  ,K !@P P1pP+ ;T] ,P|P wP0 00KpmP `hP  0KD9KP7 9 [9K00B1 } H$ H$ H4Q? H$0AS,P H$0AS,P- 2P D4Q`yL$P@|{ CKAA L4p(K<|4HdВ ;( 0X p-LM@PK} <@0C`SZ(8888888888888H8888H40040BKU 1`P40P3 40-r * oP(x$iP"x,x(xxx x8fx0H ;V oxx0 -PL` {P@ . ;Tp hTx@P  0s }S ` "`1R0 Q R$"BP " =Z h 1 p400S U 0  0 040040Q 0PR40 0 V4 t  000@0@ 00S0@0 @0@0008@08 p-LM@} <@0CP&S(,lllllllh<(D\@lllll|l|tl3Sp 0 1Rp 0 1(Ryp 0 1Rop 0 1`2F_K,p (,2 , F_K,px 1 , }mF_K,pe 1 , t1$\1rO@1,(141<0]09.*+' P@0`|P@0`!t0`X0D0P 4 ;U Kp@0 \`d p-LM@`Kv 0PP 0P g {PP l ;U xP* 0s4 x}S K x0| 0-l@L\'@P PP6 0s S ( 0h&0`(P  p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 '@P  p $phB&p\(@LP0 D0   D -LM$KP^ $@崀`p00SP%P `0S0S  R0d| @00@0@TV02 $P̔0Lv p-L M` UpP9~T 8@K u~ m (p@(@Kpi -L M@0PSD0 p``,KP ,@!P~P 00SP0 0 00 40  Z R4 @T,T(K0̔ -LHM` pP <@K  ~ em 哫p} 2[A0ASp0@0d@K( } Gm `up @00@0 L0  K(i <06i( p-L M` 㖵p@` 8PK } m Bpj}2[0 2K3p[}\ 2[ 0@2K$pL}$ʲKp(i \i ȕ p-@LP`0@P0`pD 0-LM@K,Kp|P@!}@ \ 0000000S 4 0P00 [(K00 -L444r MHKj0<@T  10]0S! 0K00KR Q0@0`GPQ1Px/2A$d0 \0@ P!H0 0K80 KK B0 S0 3KVp0#S 0S |_ 4[j3[3[3[ 10`PV 0S |00 唧d?0s 劧@5p*(K$0DL p(  ht8d -LMPap@K" 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T % @ @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K   0(K!x0K`t0x@tpxPpKP0 @K {P0K 0 0|0 xp tP  p@L{ (K80 p-LM0 0 Op@3{` 0K`p${TPP0<0@ `px{ 0@Kp蠖0!Ԗ -LTMPnpK02 z Ш`PP W0S SztlP<@K j L峨P @>z@0 K0lB  p-LM(R0 0 @0 K⏨Pz1[S1[SQ @K0 xPz0 kPzpt0h$ K^PzDg $0$0@$q 0S$Z 0@(@0!,@0D0D0,`K, (  7P_z@0< 0, Q0( <00  PHzx)0 hP`!Kp0qB@8TpByBfB@x((gB8(L)?wB`vB  -H1LM@Po., N/, , xj0S9 1 "860 006. 05WS P6s0 P% 0` ,U@@p@  wPd0` ,U  @pWNY, 0 @ 0·p@80{7 -L$M`Pp@K2@00B1S^3\ c+, w,  KiX  0Kw0t Wp00d @^ypp 0H`p P*P`SU ,KC(KlZ -LMpZ@`P & 7yp. P!P`0`01:(@T zP0  0-Kt -0Kyp`p P *P` W@:Z  yp(Kd4 -LDM0h PD)oyU,EhQ ,yU`  U 5%1 @ pX`Kd@ \ ` 0>p P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3ho 0 ST(38 0T00w0S 2 0WqpWڔR 20C Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0Kbv0 "0  4KWv4,<4("4!!< x@5 8KFv8,<4("4!!< *K7v"[04"48#8T!w@@!8!00$!$S!0w'pP$d0`:\Z`P` wpP`P`dZxY `0wpP`P`Y)#x(K8<|PTܘ<`4xph̙` ЙuT - LM, [W0W , S *P0S :\1 ToD1HjJ,!100tS  RPa 0 BS a0S00 n@P m  u000@Pn@Pt Z  {u vu0 00 k@0p,0WX:(K<|0X -MLM2@F pR~2`8Px$ H0Rt1 10Wl Q^KPE+tw 8PMM.\P x6S 6S 0  MP 60p@ Dx6S 0S S SP``P`P`P PP` D0 S0PP0``&@nZ 0$Kp VKA$ $akNK@D[@[kT K80@Pl0|`dM  -0L0 S 00CS00Ӥ0r \00! P 0 000p0 T0 p LPQ(0  B000XTT`: -PQ@`Lp v v v0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P:`X\hPdT -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#Dv@8@`"U00ST P@`\U@@ V 0pP0$T2 00d "ާu 2P"2堂 \00A S-Q5T"d2PP"@tH@ @00S (%u  / + K4d(D --LM 0 dd@ tXL 0S 8u0  ( 0S<-!d(4D U0p@-@P` 0S400 0 CS @ Tp p-P@L`{P00#S p 0S10'0 S #0S s 0phv00Sp $< -00|0L0t3@00 0 ᤫp 0S s(0Phk0Tl -LM@P!  }tpP 1 pp`P@PV p0S K茜 0-L" @Ps00Pʶ 0T  sp@s40P0 0蘜 -LM <p s@q귯K&. Zsa0( K`p2K1p2 ڂKp1  1@8PK(K Lp Ђ P >s( K0(K 00 0PK 70K@P <@ 8@KHP D@ p I0S7 Er'] P@ &.p6rP2[S2[S2S2SP r\u|KKT,P@ @ ,(KL0T0Ll -LMP 00 X0  K0IxprA K  -LpMh0 K 0 %xpĿ`r K4 ̝ -d0ML K .0xp?r` K ؝ -LlM@d0K@ .0wpr=K, 4 -L$M0  h0  $ $K  0wpXq K D` -LM K00.T0 0wp7q K l -L@M pR0 0!5  ϩpq`@K@ q0 `010P ,` h00KPKjp  @q 0K  0 Kl$0i@ p-L@M` ㋩pPӾoqPX@K@ q0 e0 @0000\H0K)p 01S @ᮾJq ǦKp蜞0i О p-L M8@K` xq0 `0 (0 >pP"qL @P@yq ᒦKp0i  p-LM K P bpl @d`00S  P0SqP00  @T Kp0 -LM` p3p`@E_K  q20 1KKK0N! P @ 1KAN p @0PK pK1^ 01N, P @ 0@K/Kp0 @@PK p0"St T@ŕK0 -LM@,KLT BTe ST lT` A  @ A @0KP0, 0p0PA<0@L$ @@80L#D< @@40D#L40 0@@#4<$D0 0L@#<4$L H@$4D@P`$<p80Kj@P 8@ 4P gk(K 0-LMPL K@~P<8,<4("4!<@8` p-L@`PB _P. PU4 2.P UtZp/P XR{pB <P 0 SpAjp茯 -LM@0PP +;U$ !P:`&pKP PU :P`UcP &K j:V  / Kԯ -LM@P.`(KB pP PU .P`U(00.V ( p-LMPK`0@P T;T` E`P0] @Pa`x4 -LMhhqP8@K`_@P`0 @0Oȱ1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00#bpP00CS04@030, )0@0CSp0@0 0@p00 PP \, 0O00tp))t))G-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@Y^0@0CS0 @@00 ph!p)) -1q00SL.@`0\0 0| P+00CS0#@0g0 0P0CS 0`@0U0(000   )) -LMP@0 2jPB ,K A@P ;hhhrhb`"PYm 0 P40S0`00DP, 000S SPp PiP aP iPTAZ,KPPU 1 ,0Q.0 Q@L00` PRH00CS0<0A004 U100CS@ 0@00C,  f@p0P@ 6 Pn P \0uP 00S Pp(KD\\T|))dXTx)) -LMP0@ T T.YpP- 弐0帠S0@0*@P`P 0S  0~  0p3PPP0T@(-0 CR 0R0 S䉿00 -@0LP`rPeǓ`Z !`0Vh `c0SUJ L0SF I0S\\<@U`T xhP 0`!Sb/*0S@,0@00US80800US00`zUPX*\00S` lP  U 0@0^S00\P0SXTTA-DTH -LLrLLL`~@0S 00CS00PӤ0iPuG  Q/0 Q@L00D_ P00CS0^A0T0V S0`0CS@ 0 L!0A800 S0!00 U`!00000 +0S0#3 PP 0S0`00F` 0S0`00<V @V00 00 0 <0 `XT\T))hl` -3LM, 0 0 S@`TA3P, `3@, P00T$00 R0 Ch"000S 00CS00Ӥ0Ꮂx0S0  P 0S0@ P X R/ڈa刡0 RP\00\ Pld00CS0J@A00B o?0P0CS 0P00^ X00p 00S0#3 dPP 5sW d0 00l0 pD0 00@00S <00SWpGpXT)) -L M4 pRŸP2 0A`00 p30!00P PXP1 dP00CS0W|A0^0O L00CS0  00CS@ 0 "005"0 0Pp0L0| 0P:Ad"0S\ PP_$2 , Q#0 Q@L00]V P100CS0A00CS@ 0!0e0 0P0p,00Cs,0 @00p 0 SD R/ Qa0 R@L00V P00CS0+@0*0# V0@0CS 0x@00P0T@ >\H0 p000%S!S-)-))T` -"LM00 S2 100 r 0 R R$K!P\ 0!S 00ZPT`1$ ΉL1$0 S8u, Q. Q q0K00U`P#a00CS0.@00& &0@0CS`0@00h0H0$0 $ 00$  Q000PTh|-)-) -0LMP@( pX 0@T@@T@ET P`P ` 0S  0i  0pP  0T@d -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S  1@s^T-T`Pt 0^T-T00PS@  1@s 9S6 .TPP00S. /TBPP) 0T00S 0000XPPS 0;T0 0 0\ P00wPP U(00S(8PPTd` -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 pd -Lϟ @ t 000 Tpo iT  &WT HT ET !T =Tb TGTbQTt VT^ PT@eT cTI |aT gTP rT mT kT9 dpT UnTvT< tT *xT P:zTPD0 nR pR lR 0P0P00PP =  Q Z,>0S t>0d>PuP0 nR pR lR 0P0P00PP 8=  Q /=0S ==PK==]PAP0 nR pR lR 0P0P00PP h<  Q <0Sj <<VP,0 0SS0|<0S <0S* t<0S r ;000 <@P P0 nR pR lR 0P0P00PP 8;  Q ;P RPPP0S!SL +J0S0 0S @P ; ::;0S0 re X:000_ P 0!S8 ! P0 nR pR lR 0P0P00P\ 9  Q P0S+ tJ W9`V :PcGTPPgTPZVTP P0 nR pR lR 0P0P00P\ 8  Q  P(000)90SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP x7  Q x'00cS0 d'0S XX'P0S000 nR pR lR 0P0P00PP 6  Q 60S @7@b(7PP\0 nR pR lR 0P0P00PP 5  Q `D60S 66P~ %0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q .5SK5ePI 0 nR pR lR 0000P 4  Q $5 55:PT`pP40Sc @Ti40SeV`pT P0 nR pR lR 0P0P00PP x3  Q 30S. s3P( 0 nR pR lR 0000P 2  Q d3 \3H3P 0 nR pR lR 0000P 2  Q h2 220SP0 nR pR lR 0P0P00PP x1  Q ?10S |1 Rt1 d110S 0 nR pR lR00P 0  Q L10S d10SqT] P7q 0000 10S1  1 j@P# P0 nR pR lR:0P0P020PPT22 )- U@Xx8-T(-))---(`ȳPTܳ)TXGtp-n)t>dP 40  Q 00S 0S0!S+G0S0S @0P 00P 0 @(q0Q`0gS  S &:00C S#pS rS`0`0`0`0 1@s|P000`00V SV 00 S20S< p,2  1 0 S 0 Sl lRV000x2@  z@P00CS0PB00H ERT P ,L3 @ #00CS0(C0h0VLL0P"P3d#0 S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP T4  Q 40S 444 oj4PD|P40S$8pW40SD/P0 nR pR lR 0P0P00PP x5  Q \50S &50SPhr0 nR pR lR 0P0P00PP ,6  Q /PTRpqW QWPl6 P|60 r 6000`P8 60S6 R6 6  6BP&0 nR pR lR 0P0P00PP d7  Q 0S0!S+F0S0S`7WT7 70~P8(0P00 0S 80SqWP@80S^0 nR pR lR00P 8  Q I 8 8 P010C0S  I1@s P00$ 0 nR pR lR 0000P 9  Q Y9)00Q0 mP0 nR pR lR 0P0P00PQ 0:  Q .L:X 0S<:d:;Mp:0SPEP0 nR pR lR 0P0P00PQ :  Q  \;e;$;0S0 [8; @; &P X; PPx P -LtM d U\e\5\\\\u\U@sP xP pP00 @ , 0 3$ p0 10 00b0 0S 000-S 0@S@ʜ000 00C0 qxTP@KhP0: S  0  01TP 5OLIF|@P  q2b#000S 000S 0PT30S 000!S 0+H^D0S 4 000SC 20SsRbT0S 6࢟"P   PB-"0S& 4"0S"ls 420S  l2Rhd2 0 L20SD"0`004w"0@0v"000 S 10S!@0`00[@00@P @P  @Pt t t$ GGPpp(2$--( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00J P{ 00CP|S 0l#0X0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00<P <@d`,00S_"(Kx4(2 UXT\TMЍ -0LM`0p 0gSR :R'P 0P 0@ @tJ 0|| PX\ T0P 0\P 4P 0 0(,W b`; UX M-LM00, 0S  (Ko*00SP W* 01@PO* 00, 0dld0 0 S0@ `p0  ,` p(Ko  U Y@  -D2L$M04 SP$20St!40S0L 0S0(K@ (0 S0 00000 ^t P` 0Pp\&G T4 P( I< 0 00(00 >%P;0075\+4 P 3H( 5.:0E,p 00.S.0@0K`8,0 , g bt40,0 0x 0 0E000 ?H%000!P P D(5P|p@P5@X;P 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 !P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;D   <  tl30S|2 g0S.*P,  @KDP @KX$#0C P *XHbPH00: S D JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+3!0S  +P10SPɇ @pK !0pC P: ệV`<H!0S t0S<10S Q H0t\0l10  P8 P P`0S00S 0S ֪P |0S?V`PPX00S }   xu x8    S , lP lx U, 0-D0LS@ 0PUPHP)PP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T cO0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 H@L@ -鈁LMPpH,  F@T @ )3PD p` pߏ 00;P'  gIp:0P ̏ 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2Wwpw6T@H@P@L@ -`QL MH p0rSwS ?R@@T WB00}8Pw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P C6TH0090` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < |B 08 0X  DK╎p  05P  KP  0(P(KX@H@P@T@PL@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DD:00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Pl :d@:V}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  9@9P[ -PpL 0Z눀H`$H9%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S,6(6 -0L0S(6 -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #(6 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p -<LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4 <4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b ; (0,00 0e0`U`1`!  ;PU 4e ;(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub;(0,0e };,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗 xThP|< y< !  ;< 0S  0  Z  0RJv`V0'!6P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S08 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  Hf:@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KpʸJ$G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝ HP 0`,/MЍs -0LP00S x0xP pp00l h0hH0P DT00P<00S0  4!!( U(!D -L M0@S :P  K0d R0 yKx 0-L M0@SP P K0F R U0 x K0 -L@Mp` 36@8P@`L P H W0p&oS0000\&gS0000H&mS00004&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- P@ L@ h50S ``V1@A8@0TS0F0H@ ` %pP5` 0bSP0SH00 HQ`xYX00HD D0 4PU5 080 000C0Sn004K 8k@f0S@8 ;400S  < X @ 0@ o8K0K, KP 8 ;0<0 ,00X @ ,0 \3@T/ @000C0S54KP LkPP-"00*0S T *400S 0< TP X0 @ 4iP\ < XP + w20S P:O7`P@.H7@P <  p0@ <0  `< @ < @   $`P  p d mt40C S*hhh0<hh<hPPP0S  0SN 1p 0S  l(?HQd R:Z <0S00D0 0S X0PSTH0\rh D0c} 0S D0c0@ <09P LQ X RH00 X0c0,  D0P hp႘@Pc0S @d! !!!SJ4MЍp@-`0@S8 <0S9\6 00S0C;ౣ;0 `\'P <3 ß0#@P0"0 PY@0,0K2D0 T` Pp /&lKA&&0TŸ0D2&0S \{F~KpGL2pG0tp@P 0FKH`GH @ PG k0 0f[@PV 0Q# 0$@P`\ %p$0R0C0= `A   x4st| @00000%0 00 "x$rt4s xt$\xt%000400S R(Kt ̷,+-Tط-06' 46 Llx{-ȸDH -ML Mp`@P AK @@ 0%WV 0S:0S:B@;&P 0A.K: SD0P B< B4AK AA K(- t( -LM0  -424 0`40L  8 ;;S0 0S,0S) R'PP!<0Si & @b80 TPp<00PPPlA 080P<  80K 0SF0SC8 Z@0@0p0 8;;@TPS@ P1 \.U+T) P$80 < R B+ౢ+ \b 00SOQ8 0 @ H& @0Tp0000 0p-0 -LM@pQv 0 t0 @0 P `0O?  4D;$+4 0A40 4P 00SO0 @/8/늟KP 2-,(  80@ e  -X0  P 0S0S(KD- 0 0 0`- 0-h0L0S XX 0 0CAPu# T@D*@n#l#0000x++- -@LP^#00! M0-LM0@0P0b 㙅#00CS######0#00# K0| 0-\0L @?P%D000S0S P 0-x+ -LR,M00Q P 02ZY 0L Q OTS2p8\0@/  0@ /0@D @ /TS P20S 0@@ _ 0 , Y0 Po 0   ?< 80 <0,  ,@8< 1! 5 @0O TL H 40 0@ 9 S70DPK` P `LKpÏV@NUL@10SF 0@40  (@~Y1Y(K--,,Lh 0-P,L@T 0R.PT 4 0S0S: $ 00- -, 0LR$0S  0 }+ -1!0@S00 0L 01085H :`0 `\0X3&400@P&0ppf&x0| Xx034P0`0T0PP0  `$0P4A !!------T---й -42L(2\`Pp0 0B? PX4 1,y$PPe 1 ?1V 0 P00W0 0@0@0@`p 0$@<1 @41\%pR00 X1 # ` 0( \5 S(0 ?p  , 00` V: X \5 SX0 ?  Q 0pt0t@0Q dpd` |P`@,000 Q -T-x+--+ -,2L$M0P Q!0S:0S* 0|qTH0 D@ _S\!1P@PP0HKȟ 0@ < t1k%HPK`dP0 x080 4141`@  (1(14@ 0,0 0O 0Op  / S "0@Q@pΏ`p@ K HK8`@ ?4 0 0, % d0 <0X0\%L0R0<0(K----------!+!T -QLM P@"0 S:0 S*  20 R  Q 10x0Po VZ UWa ` ,` 0@Po 0K `vp0CXh Tx 0Cp`0( P8 zB0\œ\00 S 0 0 R \00O008(LRLHL8 0C 0PLH@0S00ZY 03 LP@0, 00YP{X P#L00\%0R0 0S @0 @0 0S @0@U00 0  XT(0(p 0( `08DHS000(K -QT,4,л-`- -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JKQ'K,JKJ'FK0 J?K45 0B?FoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T V408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0dL`DcP/0\%00RP%O0 @PEO0@TŸ0 P0%(0/p@0S ( D050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2R< (8 pt20\%2R(00s03t0p  0S p00<00820\%@2Rrpo 20\%2R5t210K0\%1R00d0X0J10\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0+F60p(K,--,U ,T-`- -L MW @RSDq 60S 0Sop P60SqFp L[00Fp E[000 ST6@P6 H6H=QP4Q0Q1(60S 50S 60S ?~QJE0SxQ 0SsQ b 0SnQ , 0SiQ  O080B R OT dR b \ 0#K`P``0H`"d0B !} 0/R0O?0@l&@@c0 0 0B K2@P<40S 0;0 @d4 Q PLP30ST 30,OPso/1"p@0@_004@?p8/3`"<KP@  huP$C0S ToPlP@@T {0C0S $`P]P@T {2@@2@2@20S lR@坻004 020S- <" 0S&P`PY`/1"@ 0Od A 0ZPap ,0 X1倁0qSl1  `1@01@0 ,0TQ@@0@Lp1P10S+ 00SL9P 410S00S(/P-P K1P " (0K R\P $00SP Y(K,ij,̼ؼ+,6|+-  ,+DdȽ,-Hl--P*d-|-+-,p-+ؠ p-L@M P`K0S 0S  x -L`pYD"DDDRD0@0[dS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 00" 0 1P(xt!00!000X >0SD1 80O 000000001 Np00PnP@en00SnnTQ  0e@DTPl0PJl-- -x8,,Lh+,(46HSL0- -L M`4 pP,  0l"`Ud"0@0@Q P 0,20SM N0 }4 0 u,0S  ~P0 a!0 0S1 0 @010M0x!`p1l0 @R Q @e 10S N 0 : <P c@P000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(K !,4p-,(!Xh@4d-, -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@q͟p 1>0 2 P0 `XWD lK`",>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0O0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  AP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 P!Xl P0S 0 $ R(p4` P   P0S 00   P   4,)0\5S , 6009I000PO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@4P  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?QpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1pK ^ @@|`@t7P1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S /P XV T3PDD <$00  RDDc0\5S 00   0S 0 00  e 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S 'KP. Rb(r0\5S\0h0\0K0@ `  O00P@  E @ 1 Ÿ0\5S ,0@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 0\0MT UJ  `P1 _ p-dQ,0!-,T,+U tT +P+(,,|*+t-,ؿ@@4*(! !ȿT,-60U pT唠! i L00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`PKp-0!( -LDMl@KD 0 0p 0 0,0K0D0 $ U0TD`P T@ PP M0lKS  0@P0 g0Rp0,0Z@P0 (K,-8!6tffK0C0Cx5 $5A| %5 0,0K5D0 [oK000p00 0S S$< 0-;;S< @00 x0k0S <0ttx% 0 <0\Tx% 0p LD0SDH 0?0?0 00SLP0 \5 S0@0 @0@0@,0\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XT: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  O00C0P ?00090@!0C0@0 @$P0PFtX:0 P00a0 @ 0S0S P0@0PU:F(Kl@4 +-gD!xo6H!p-T@+``,ķoH -,0LM 0 0yPD!H! -<0LM000 0@fPhD!H! -MLM 0 ,|@T( <P#0@ST (m00P 8)  089 0S_ (\00lP88 RP(O0JK01 0*1K$0,)1K 0)Q[S @ P 8 400P`U)UK7(K P77(K` 000 @0@PfB00C0 XP$P089  8) 0S0Se0,01 0pJK)1K*K )1[` 00`"0 00 0RV0`(K00 0@0@00C0(0K (KPP@T) P|P0@ 0$@0SW %5P8) 8) JcP ş MB 0 S \ş ?P50@ 0$@0 $ş /5(K KP8) 8) 0 0@0@P 00C0890S   R*0.S'0S#0S R@$B00P88 8) 0.S #000P89089 0 0@0@0 @PR0Sß5 10128:scP;00CS񟗱Hvxxtwtwvv0S0S $ß0{P0S0S0S  0S"0SŸ 0ZPP @0: S00S000  0 - 0S)0S&~KpG pG@0 00RnK!@`FP `F 000!*x10S rE<X PP7 0S0S00@@0S 000P89089 00C0 0hU8008 (K\{H Ld- -T,+,8l| -1 0 B!1L S|!000PPQG  0  40S?.0S9 `00p !0S  0V`SP P 0@ 0$@00C0=00P @ 00-J 0Z*0 +--{6L!- -,0LM 0 0vP-L! -LM4, `: P , -1 >p0S:  0S 0S @00 T RX  0:0D 0@, 0@P`HX,,p-, -LHMl@KD 1! 0,0K1pD0 j0!Pop [VSUQTP P` ] 00CS?~}8~}D~~O Q  A 40S 0S00  R# @ 0\5S00  00S     0|0@P`d@p 00Xp40 ,0W 0 (K6L*{l-T|, 0-80 ML, (000PK0P!t- -ML__M>Kp0(HCHHK \1X>0S`XKPayX0S$5S(N0S %0S P  K0P! $5 KPXQZ$UUȭUTURʴQQ$PE``0P3  BaB00B $"11000 0S 8 $U.M0S P& 0S  $QPEP`0\3  BQ@5 B0$   B110L 000< K P!Lq QV0hK  B0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S(K L0XKL!OL8<KHS."KL` `XKTa`P`KLV` U8K=CHK\AhK0 0ta `,00CVNKD!Xa$5S8]p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  '0S\08Kl!L5XKsGCLQ0aXKtO a3 Po 00CS 000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*8bl  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%P MK P0 0KPP K\ (K\p!P K P HKp!\|2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KLL/1 KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKag+,0LddlTp-X!\!|,T|,+ 0TU ,6-K\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KLL/1 KH!"@(K-B0@ @0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl!P K P HK\AQ0SK\\00S\08Kl! 2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% P MKb P 2 @@ (K -,0LM 0 0P\!X!p00 0 6660606 -LܨPy  R-L@ PTh P-L o P[ 0-/LP@P000+0/00$++0`!  p-LlM/`@P KyP0: S 0PrS@ Kp p-`PL@P00S 0 R +>'>;V \00S liH0H R 8>,>(0( >{p666$0 --LM0 0 f --LM0 0 K --LM0 0 K -L@_H h갚 -41LQM pK  txP@`K>8`fxP10: S 0R 000(YK@SxPd1: Sp l=VPP S00S )@P U@ K6ؠ\l| --LM0 0 ܿ U -T L@H?P4T 1_``%edA -L M`Pe@P 0Ta0C0S0T00C SdMT00@ Sa>A, , , R R3#!5 ", P 00C    4,  Q0 0C#0 0 004800000,0 0 B4 0(P T| ,(P0@@T0p`?!ܧ8<0040(0, 40(08 40 ?i 400e 000 000R ʤ |`0B000@\ 8@0DW Pp0P ,0 @@0 ?ᓧ0E ?፧ ,d d00d0V`$@QPU`0P3  BB00B %"11000 0S Rڬ0 0 0(K^d P-L@ ,00S J<h],( -5LM Rppp= h5huPoʠ 0 @PD0(\%$5RR1 T04Poğ4ʠ 0 P(4 \5 S S ST  S 3S3S |ğ @p?t0 T4*` ,P@ڴQ0\%4R  S0@Sh` VŴ0 0B RR40AQR00QT30S0 @ O0TS¯0  y 0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S ;`!1@h00p`P   \0PaA;@T4:010\%R& 0O044D $0O84 KdZP ,@g\ :D0: S t,lt@PqD@>0S ,<q:,+P$i:> R0C=P = 0S= l S:=0S e -0@}崍=P` ` ` ' $0 S P\ = P(0@-<0P @a$]0S<@T{<_.K B B,Pr Pn |l00P 54 S0 5S6 @Tlp@5O,505 ï @% p P5PW5U ˟˟+˟; 9&; @;0S|; 09h;00 T(+ ;R  0Sp  h+848@00@ S2,@ @P @ P 00S>@ P,0H0PwD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S1 0  p?ŏP0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\Y8K@ K 8 4 40W8@V (K,-p--U ,, -0Lp@P` d 0S0S @ T @ 0 @Tpw 0X L000 0 0000 @  @-<--G-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80P6p@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P  00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P  00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ6 -LP`  PT  P P@  P8  P( $ 0 6$0 000, R-0 - -@LP  P $h~ 0-L@0PP HP[vP@@fPOvP0 -\0LM@(0K( 0 @ K$ K0 P K$K- -0L@ P  h --40LM K 0  N K -`0LM00 0@0 K P @Px K- -t0LM $0K 0  $  K K0P $0@PU K- -0LM0S P P=X@0 @00P P*- ( -LM  K K0K Ͳp@mP  dKD 0-LM 0PS    KK0娲p @IP0 >K0l -L@-3CC 0S006 -p-LM@0`P0 RPP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ * 00 0SK0 --LM0 0 -" K p-PLP`  0PpѦ uP@@p0S PP@ PpXP@$0  @pp`\ - 0LP`p, 0S) 0S& 0CP 00p@xt 0pd{PP@ V0,0,0(`@,@(`@x&\- -T1L000,Q,p5@p 0`P0 ,@T"0 0R0 0Dp 0 0S 000EP 20005 {MPPM@000" ,@T - 0-|0L@0S,@TH0@;PP 40LP@MP P`M0-$ --LM0 0  B K -LM@,p`PK! 9tP4$0Rm$0 dB<h -LM@0pP0KDpt P,p`lP Uh ,60!K æP 06`\06!0[ 1S000SU% 06@!.pPbN0S ^N0S ZN0S ,8,r62 ,8,k6i6BX W WQPHA 0S fA0 (K(0 60l0 ,EA` KP]hX  p-`L0S+ @P(  k 0P00 (0, S , , R(0(0phJp0 00 pc ph p-6 -LA0@000,@T p`PpM0S P^ &sp0SM0 SM0 S @ T - ypu-4$ 0-0L 0R P( 0 @0 PU0st d0  0 ,@Trp [@0S 06- -L@|KA-p$ psAdx -X2L$M0  D2$ ,0 (@  $K,K0勯p-M0-S<1@0000;,@TA! mp/ +p`+ P#8@K P 4` 0` 8P 1 -P <0!$14`l,$!1@ KUr 0 @p`P#40S 0:0pL0S Pm 5rp0SL0 SL0@ S TP0岣@K6- ypu4y?D0 @ Kl`U 0 QJ00 ,K, ?R0S@pAJ0"S4 0>@P -LMp`ፒP@( P(K,K$  0mP(0S>$K -000 0LS    6㚪/x U --LM00 @%P 80 / 0%x@x p-\0L0`SP@8 ,;*Pphp/gd 0 0-t L@h&*P\PP P 000:@P 4,$@0-edA//h' '0' -MLM0@<0 8@ =P = = = % P |ˬ =t* P-] p4`Kh* dz -N0@&S:LLL\LLLLLLLLLLLLLLHHLLLLLPL`< +0 `^40S<0t:  .t L"p RQ`<@0@0 L  @< 8 `04 <R 1 ` 4 ;R  1 `4 ;R 8 `4 d;RX 1 `4 ,;R 1 `ރ4 :R o1 `΃4 :R _c0 `徃4 :Rx O0S \\*TF@PP@ @000:,P*:1  o-xɟ00)<Kbp 80S<0S [ 0s 0d  0SpxP 0d h*kp0S89P ( 0e 0bS t80S \@KePT0K\0 X@ ^ 4(1 R0`: -W pP& ]P! ^KPEeNKPE@D@Dh(0_\(\8PpXf4(88pOf \70S- 2PP(OKe/r?K: 7x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00KPp G?  ,K0pP#G2  ,@ P-PPP P,  |,0?,0 d  P ``rpWZt50S EP P| ` |  x l* c  0ZPx JG  Ix K:EP>G  x=40S 0: Sh 3 0: ST =`:@nPl  P`P`0P00@ Sx Sl| 00A Sa>@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0@ 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  K R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10s<00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp 1. x /.㧦 /7/Ppx87|//77/7H7`7|/767t77P4 PTS,8l h D^n< T&&h'&h$/h80@S@ \\\\000 10B 0# 0 100<80@S000 10B 0# 0 10< -L80LS$p\0S01S 00  00 #A10 #1 0S ; -0LPA@`|  `   0BOpcP VB?㖃! p    t/ -LMp`Q pD4K iP00SDDT[0 P'/P 0$//// -LMp|`Q D@X4 iTP8D0 PP 0"қ/// -LMxe@D lUd ۱ 0 L5QD60S 0@p4 00 0;@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 Rl; 4 0 @4@84 `R`0_P 4K$ ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d ጰ0 0G4K(K//U <T|/7 - L0R  P%7 -2LM00 S8 4 p0ll0 P2R@ d S 0= 2P)7 00C 08P4`\\0`"1>\\0?0 80(R0! @ d *2 0; 0@4D1 00C04P ,0OT8`S8 K 60O,0 (@ 8K 00 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Kx `?ߋ` ׯd ӯ0 0@P0 0S 08Kx ?ҋ00 08Kx ?Nj00,8$000 (00$Kkh7//U </t/ -LMK@P,V0 K`0@ P A P @ P g n 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d a004 0 KA7/t/ -LM@PpGK,`$1@ 0 A SA  9 K00` 0  0K g jn ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK/A7/97t/ -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@pl@`x0W0HOH DpP,0 /0Od R00 0 080P0x `RU(K/x////U 7t/T -LM  p@<P ,;P4Kz;0S ;RQ:> 00d: @P0):p   jd;:Qp: `: Sr\ mQ (:  S4Z@ ,02ttJ @P@PPjɟ 00T 0L59 0$ : 049 0B90A  _2`0UT T0PD R@: R08R0A2Y00 8 04 000cH0 400cL0 H00O85<P7dxTTH0 /ht@x/t//4T7//7// ؐY }2400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000_`1Pm P=LV>00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 400@0PP40@:0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<#4P` 4  4d U0O?`@P$+4 K ФTp @p4P`Y 5P`8, 0D @ , DK< K,0KPTK8XP LK<0KQ  P0 @ 5K< 8 p6, 08dP A0`@ @c0 0@` R pQ 0ȐĠ J)F#Z **0P070S@P'  *0\%$8R48\5*0%H*0P<8(8Q0\5h80Sb |8PզP 78ppD K?p [P P 7PP8 0(Y0 ,i R01:0PT&~ 0I *Y`p㸐K:4K`0S- 0O ,00 /0Od ᤦ*P0d PcP@c@t 0 S BL  T J@P`pPZpJ0P,0V0S B :0S :P :4K0S P  ?>0 ?0 ;0 4 D0P , -0K*0`PTH4LDVKd 600 f0 R P000`P pV`0 008P40  @@A@p< 008#80(K 0-LM8X0@K P0,L 0P< P=p z#8PK0///MЍ7 -0L X U, -LP`p' @@P0/S /3P@0.S0S .S 0S `V4/ p 0S0 PP/L -1LMXp tt媏'l10SR 0: SN YPJ g80 SF3`K* [1 RA@RPR 0P偏+00S 00CS00@Ӥ0r8@`P0S 00CS00Ӥ0r 8 PpYTyT$K/l U/uxXT\T -LM0@P, U`pT` pX,  "P @TPU T -L1M@QPK@UPpPQ@0: SI0S HZ.M< =pP; K5P7 0S  0S 0S0: S 7p00#K*p $3 S`!k3P  pD0`P \P p4Ӂ(0   K4/ -LqlM`KP4TP$0: S0S-#0S P 0: Sp 0S\QP 0S =70S ,允P@T(K////4 -@2L0S 020S$20S [MPPv g40C S0@8 8 8 8 8 |8 7 8 8 8 0!Z( 0S 0SO @ l{-A0SDH aP> H p8 0S0SH OP, $0BS8 9 8 9 8 9 9 8 A 0S R HPP 0S 60S \pX<`pK@P60S ,㡍ovH///4 // -L`p 0!P@0dP PP RPiP@ rP fP P0@0@ Yp0 0bSAX00S 0S FD0U $0ږ////S//MЍ -000 0LS    Y㽖</ U -0 CR 0R0 S?00 -@RLP 0S D% 4 TH UF 0@SB 10S<p `(<?0C3@ R 0S, ,?0S|?@ l R @0 S0S400S(>h>hk?DLXTT 0-PL@0S(0hBQP xt d\00SP e <?? 0 (0h<4TTBpXTTt - L Pjm @/ me -LM@/"P0002Pp2 lR dr`XrT2T"PPPfP tP  Xp2 10 bSP PP P 0@SX :XP10S Ya@a,@ pQl 4  PP `@a0<S 00K@P 40S 1 0S0%+0S% 3KP ,K u 04 P,00S (040 8K[P @00S d 0X峋=C/X<Hx8xS<;p<<4 MЍR -0L 忋# UX -LlM`p@/>@gm r3X0 @qP0W)P]4KP4MP V4 P0: S N40 0X  (Kؠ -LMp`c[[h0,0 mP pP,  @P (' $PE!Wp001 @R Ԁ@`p)qL @P0/S ,0S  j P00U00S )P8+~`@Pqx8JS4MЍ -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @ -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4R0gPV@ @OPT -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp 1P 0  @T0S04  ` V20 p-L`@S5P @P 0S0 (T X0 R $P +4 0$ 0S5p22 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K@@88 -LBKCM@\M @ 50KP T L$ X4 Lt 447P@, LPwP>@,~PLt ,0S , ,0 r T000,0 R#R ;R Pp0p000Pt 00,0WPPL ,tP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 000Q,BP, , ,0 rP 000,00S ,0L00,R @0 S0U,  P0 SKN TO M 4N N J hR R R (Q S X ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r 8 000L ,0P$ 0S0L0P0` L0pL4 ,00S,0  , ,0 r 000,0 ;R  R  a,00S,0  , ,0 r  000,00\St E,00S,0  , ,0 r 000,00S  *0P`0K00 ) 0eS * e 0`S01:6`   \S0S S@000S0lQP 4K@P000M,00S,0  , ,0 r D 000,00S , J PU00B,||(p;,@0! 0T1,00S,0  , ,0 r l000,  ,00S,0  , ,0 r 000,0S 0 , K {,00S,0  , ,0 r 000,, K 0S_ `  0b0 S&01@ 0S 0 P eP B @T0 @, 6, 0,0 0\SSH. r,0P,  # ,0@,0 P< Q<H l 00  `84 @4 D4 o8$ 0hS * h 0`S8 01:@!@ @4 P<D$\SQ# RD `@T`FD + ,P \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sxxj`P0i`H$0, P4 ` 0p40S 4 40 r 00040 gR 9R1R*Rn R;RcipR wR^Vt`YpWV`k44K ٌ0@s@<a`@0S40 4 40 rTD 000 S XT#%A+40  40 400ST$0T02 T^w$2@TT"dp .0T$40 40040 sS,0  , ,0 r 000, 0;Sy0,0@,@ 0\SS R4` @P\jC%D PP40 P0s 0)@&T F 000 S 4200T0t= H|2  28D` 00$8`PTL22220 0QnligPU,P  , ,0 r 000,0 ;R0,0 R T@ 0`S0 I ;@TP U 1 r01 81jH1(K -"LM0S>̂r`P y @R"2 0  PP@-q 0ld"0S 00CS00 Ӥ0)h- r@ z00010S 00A,KD1P0S00#3 ePP h1@-0S -( 0H 0 , c4! 0qa00!彇0P 0 0S 0pPP@[- 0| 0S 00CS00 Ӥ0g'- r@ z2@22\TlP XT22 -@L 000@l> 0-PL @ 0P@000h> -LM0S`p00S; :SiP 000S S,"PP 0@, 0l0 00T2 0DD"8P<< $"0 00001,Kb@P# Q000 ,0S:, -, Q,0  RO0#SL0nSt1 G0H00ކ@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00Cd><2422P82 22$w,2`2 -霁圑圡L`Pp@,fP aP eP EPrP uP nP @1 @@p 1@  0u唖1 wOp0 00@pQ @0S@Pd0@'P +w< nx82222Th US2 --LM0@``0 H0DSL0@ D0D0  w ["TCK U22 -L@P+6 4 -L @P+& 4 -L@Pz+ 4 -P@Lp`8 0G P 0> D2 -LP`p/0wS {S& sS'0 p eP 0@?+ 0pp0 pp RP @-+ 0(^pPU  -P` PLpK i@ W000  0 0 -LM`0PPp@0S! T 00S S@D 0@0V l0 l00 T000P S  0P$ h222-0 CR 0R0 S|400 -L`zK((MP$pG!0 0R R0 啅@P *0b P0ῄ` P0V00S06#3 dbPP b*0S ]*<  00$ 0$K22TPXT\T2 -l/LHM<K0l 0D00d /.00d0Q0Sm d@PT 0" R 00$P RΟ 0S40SPL d 000> D R000P R(N 0S͟0SP) d0QM 0Sd͟%!%*dd000 R000 R͟lM 0Sd0 p3Pd  i d@0=0C>S񟗣{ { { { { { { o { { to o { { { { { |r { r { { { { { { { { { { { { { { { { 8n n n 8o { { do o o { { o { ,r { r Hs s t y { { `z { x{ { y [k 0S K00 000Pl 0 0 0d0 0 @d @ Md  d @00d@000S4 ʟ0S1 /0S3 R  BFP00'0` c ** J0S 0 ʟ 0 0 d  J`0s 9P & P Kh P4[S 0yЙЉPD9< 0U dPVp )000 \P 0S2P" P 0St\ \`~2@V P 0iS,m2PP`0VS80S$$X2l80S  M2@80SL86#3 t`PPt ~(0S y( g$80S0S 8 jP 00S aPM70S0S7 0S>0S: R  B SP  ` <7@@& 7 70S|0S 6 |dƟdf 0STF0 0~P0 0 0 0d@0 0 @d @ PP6d 0h0 @T\@ X 50S  0S0d 00  \X0P< E0d0  @` `PX0 DX0T0   00 `Q{d D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ l0@` T$P0001 ht@XTDPT \T22(p22  DH222TPUWd0sH L dp @T& 0xd  0P: d0 @B& 0s/@0S 0 l @l 0,  00SP d@0Q 00APtt4dd dQ10S0S 1x V P(KMЍVc00 0-PLP0@@T 0S <0"H0 S   R000h0, 0-@LP@T@0 0-LP@P$G 0R0 @@0P 0P-LphC`@PG U@@V@P -p`L@P lP mP ?PP%p gp01@PP0 "'P P` 0'PP`0=Sgl -TRLML"@g?P 01p@W G`PV 0S 㠄0S G100TPpG0S0P 0 1S0S@T 1T\PA ppygPPP? P  0+00KKpKU?0K0KR 000@ ;0 , 0m0Q ᗆK h0@0S  0RU} t3Kg>phhg 0-PPL $0$@QHePP0gh -LM`P4 0-S1l#00@q( P3000" ~PP P P plP sP ?Pp }PPFP㴢p "fp @ W U 0SWddp`FRU S Hr@(PKiP4~ ( 0BS B( (0"0CS0SF@0S`h1 R Aa[$ R @|FTwFA000 , PpBnP,0P,  @UPT,D 0!00K7e`3\ppP(K`&0%SLP  iPQF(p` P #b t=F`P@T`$KhPT gLf>jng>>xfl |  -tpLM@\`P 0@  `—0  `qKj p-L@0`0SEP e?P 0PvP31 @R J 0S@@J U00S pgg> -`䀟L@pPnP ?P lP  pP p zPP `p`l ep01@PP HPPPHPP0S @g 0-LM0S@PK HrE >P 0s3 \0@8 -PaPQPPLM@pdP ?P aP tPp;` ` 5ep0pQ9y y@Pp 000 000P@TY 0@K+yP 000 <000"y@P(KhggDhhg -$L M 08 , xxx0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #dp00  P +\-\0S0 X3@QX Y 0S 8D < b(Ko80S ,0<0 H @x, Rp`=00S40S l l0+Q H0S C l@0H @0 cdRD@T=/`P <2e  i`Pv3p)Vx0 ,Q- @x@P! 0 4 Rkk00+S H R=kt B@0H =  @0 Uc\DDT D < >0V0 @D0 xDY00@0  8 R000 Y 0 0/P00 f0 000000+QH ,000D RT0wPUw<(KghhgDhHfxf@>hHgf -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 |Ɵ{< p& 0 0 P8 4 0DiP/ UP' LP RP ?P#hZPP() fPrP+# lP( pPuP' xP  tP P)P) '  @,8@ 0 40  X0p+p-0E P LcpP@U,@  ,K+fP 8 0@ R 0K"fP 0 1S +R-R0S00Z 070S d$CT400S w y9S,4y0S4 0Z`.SZ  w@ g/ P ` Y0D000  3# 0~ 0,0PtBP@T P3D08s@ vPV 0 -Y0    y~B\T@T20 H L vx 0 R pV 0j 0P a H R24zB0 (vB0rB0 nB0jB0 eB0 `B0\B0XB0TB0PBMB0 * .40S L0!S?B06 h 8B\5B-Y0 P8+B0< S$Bda BW @T@TTX|``<0*{'9P0 `@0 D 6 00Spq(K\gpxfh ( 4l> -L M00X#wSPPL3 UH@pp `0 pP ?P VP vP0`  ap0U0,0 00 S0?0,0 00PS,00,0 4P 00p#40SP u Hu0p03P u uPP 0 S ,.PV 0BRSiA00CSUИ p X ,  V'MV 0|1|PA40ShKA `<V: PDA0D@A08DPdpx> -L$M0`0eS U,pKd4p0S Px Pps pnS eS ESf 0Sp R\ 0-SY0SV pP eP ?P RP/ nP, sP uP rP%0  ?P,@@P  ?P, @ x`p@0 PP <MP0000C020q2 0 40 0 40P0<0 8 a<0  cR<K}^P\V00 S =  fR) aR 0R \R1 R@\ - *bR cR&rRD $ nRtRH  vRL     @@  00C0S! P\00 @ 0@0 0D0 0H0 0L0 0`V0S 00@T 00 @ 00008880t,08@0S Sru``8p@dPP@`p U[uE0SvU Zu`T  Iu(Kgg (h$hg -,1,aPL@p LP PP ?P-PP _p0aV ?0@0S U e@T =PP ]@PPTb?DG?U00gg4ddh8h -3L,M0CPp`P0 LP PP ?PP` Pp x#(_p`30S\%XAn~H Lk~D Z4d~U,3P$ I`V PADE2P PL :?0S2P0S  @P  ` @e|2pTŸP  ,"0 @ P0L0 PLP 2 ; 80 4 80 0@0 < ~0K0 @K,pK0 pcP `R< ,0@<mc<@9P00SV P> 4>U4 1.*00SD )<0/SP0S d@P<@T dH hd<@L K>U \0(Kgg4\x|>ddh`ht 0fP p-PLUhd0 0S 9`s@sT Q@NT >pVGpdg| -p@QL@ mP@pP@ f!]p001 PR@'@1ST00pS@` T`W  V  *[ ;[W@ 00 , =$=@gVg - L0 0S p`@0P 0@PH00s03T0S 0 00S @ T0 0 0hg -LMD@KP[0D0 ?P pP :P  000<= _]pD0S pp`@@D0T!0S00S 000P(K4h -LMQp@ 0V`  0 gl0V< 0 `< 0W ,q  0f(K'8H -L^MPp@K`YhK?OK?Pp` #0@@@@ B+p0S0LK``7hK?cK?@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0lbKff?B`fDhpx -LXM@tPK`ሀ>  0lp 0> 0 0$KxfuD -pPL@` fP vP ?Ppp [p0aW zP0 [ D;aPMy(`@Tg -LM 0 S@p K^P 0S  D1 `@ P^PU0fC10C0 0S000S0hgh 0-4ALM,!P2[?PB 0AT00  K^P7 Q';00 SQ" 000 R 08SQ 0S p0:P000  a0<:0bPTK0g>4h 0-@LM PZ?P0 0AT K]P000 0:00rS0  00C8S@  RPP0Sw>P0@0@aSS8g>gh|h -DSL M@p`?PM SPp#Zp0aV.@W# R:K@=p,` 0  <0 0RL@D`tP@p@N:KS:\N:0H"00P `0 A0SQy O:wx@v(3D0 1I@ H0 `gW aW oW uWI@`pW |PlZIPC `@rU@ gU oU XU wU@ xU uU D0H0@0@Y @`PU P0-W =W +W00,U` \P 0S0S@(Kgh  p-@L PY?P. 0A`P@] 0S 9 X9 @TpP @@`T 0-S 0S pP<9po0S`pg>jH$ -`L| @nY?P@ dp:G01 0D0P0S80 40 R@g>hghg -L e p-aLM!@W?P 0QUx0 0Kp#P P 7x00 R  x0000000S0QP 7xg>fPv h p-0LM`0 P@qW?P 0AT K00\Xh70 S@a7x 00  0l xhg>< R4 5:0QhX- -0PL| Q@@\p`0S P000CS@0S - LR@:Q0AS Q$0p3P000  -LM0@`  P PpP3t0p P 0Pc `P^t!PW0 0S* zP PP  pP%   pP P+ PP  P P 0` 00 D ` PP 4H` p-L@`i0PP`  P PP PUPp p-LP@0`PP  P P``V`p 0-L@0P  P( 0 0u30| p-LlM`PI4@PP00S Kd,P@ : S I@@Kpg -LM`pP@P 0A#S񟗕 l |  h < D , ` P ` ( h x 4 0Su0s3q0!SPPU@VP05U 0p03 0 KWK+KOPE0: S@KDP:0: S5K9P/0: S*K.P$0: SK#P0: SKB0P0: S K P0: SKP05 KP0#5 KP040#0#KPL0SP0SR  KWP 0 00 KP3 0PKP|@>T0  W0  xWp3PlPÉ$K 0i-P (K 0b-P000v0GS( L 4 | d $ (0Rf$ (0Ra$ (0R[$ (0RU$ (0RO$ (0RIK*PCK*Pd 0R8h 0 7K*P1K*P  d0R&( h0R$ !K*PK*P 0R 0R 0R 0  KggL-0S70#0Q0 54 14 4 -1L M40 1 00 1@,0 1P(0 @ P1SPPEP  4+U180 < @`KNR4@POU! 0p4@P  0 0  ,@0 /<00C<0 U 00p0SP P 0, p3p3 4P PUZ< @Kx$K| Xg 0-LM@P$K.$K Kpq$t3 ?1Z m3K0 -@LM 08`KT<  KT,`[~ [~KT`@@<@TU kThhbkTANTV: QT9QT9`֐eANTNTNTahANTW%STHi+STHi+bBTANTskTN:kTN:cVҞANTsNTsNTsd<ANTB~NTB~NTB~eYCNTB~NTB~NT\ fIJ`kT9zT36zT36    EꨵZ5I&+*OOAEogj!]?wƱbq²)Ό4% _?VTO=HEO>yi˨*ݫlY]!/ncBf&[ORV>`ht) 4>:01Y+G6H.{}e^D">]d0&Q]"m@ecJ(D+t0i<vԜcll :Uk1sx)GN،L &$e@4h~ո4OgsC$- { -L@@T+l.bCyḺס?\QMl4&Hxl7/[pfN+vZD@Yiѵo5~'.[qT/ܟf3oaL:opB~P|:#4VI76p,c#)i0͍q^xRWa1,T10s$C& \gB֥{@fg 1sj/oRr:MSOEx9V/bc6%XeH \ yF9+0# . ..arch; catdate;chmod;chgrp; cp dd df edhostname- ksh sh ln ls mtsha256sha512mkdir;eject; mv pax tar rmsleep;stty;sync; ... . ..chown;dhclient- disklabel-dmesg;fdisk;fsck; fsck_ext2fsfsck_ffs-ifconfig-init;mknod;mount; mount_cd9660 mount_ext2fs mount_ffs- mount_msdos mount_nfs-newfs; newfs_msdosping;ping6;reboothalt;route;sysctlumountbioctl . .. dbƥemptyƦ tmpF runtzlist ... ... ...`NP@Q $K 0,P0 $Q 0 00]3"0C4pK.4@ 0P ,@ (P hP@ PT@B3^ 93 Kh -0"L0@S rP`"H00 000#00PA0A 0R SP ?Pc HPaPPPl!Rp01S X2MDQ8a@q SR ?RB HRaR0S 0S20Q  QP (( Rp Z@ 2@0tSQ@T  8-P$2g0$ LX0 ,f0@-@ R00#SP 0 S 0#S 0 00 S00Q00 SP\\࠱# 00Q SL 0qL 0^Z#000000 -L@`=qtpP@P P Pl 0`pcPPW40W0P0S -LM@S00ä?P`@W@D@TP00 'Q "Q `Q =Q :QTʌpP 0P\S \Q0SPPU00 'Q "Q `Q =Q :Q1 D0 BR 0QAs 0P`  0/S @TT``Pgp0`UV Vlh  ,0K P 0S`,0 00 00hPT\  Q-L@TA@P 0/S @P0/S0/S0S1d -`PLP@pt  0RQ\ -HpL`P@1@ST0hh -pQL`00  U0`P0\T0 SP[T*T ?T $T 0(STP/TP@T0~SX  *00@h -RLxMaApP>0ppx0@ P dP0@OP@1,K0!$ ( , ,@$0T :( @`DA A0@$@ ( ,0 ,0@@( ` ,0 PaVP@ K+P00SM@P<0$TPU >@ Kh$hh  0-@ 0PLHP 0c0 -LM,@KpPqd똀RP @0T : @`DA 'A0@@0@1S@ VdP` $Kh -L,M`L P PJB 0 40 0 H 40`0T` <0 8 n:P8@/ YD  <0  cR <K4N@0S000 P:/00D  D H0 <0 cR<KN@LH P 80@ @cP0DAp0hC1a@0 0,0 [P,0ST PRQp D0@ G` P`@0Z, KP 100S PU80=(Kh -RLM p<0 8 f @S`$M4@K0"00 40 , "" 0PTPU 20 /lnqd2P0 %0`400fC180 < 0 2|@; 18 0 p@00Z 0P YP P @80Y d1J$ 0 1 80R1 !8P8 쐟pBP @ۿPAp P X 140 8 4@,0T :p00 @`DA A0@,@ 0 40 400,00 ` 4 <08(Kh,hhghhf8> d! -/L`lHPDp`@P繿P@  iQ T -d1LHM Rp O P@AF <@K lKX0[l0`0 Y@[WP[T`[Sp[\[b?`0 l K0l K0KLK0 `pNKMK(0 S0S 0S0 S0S0S@K P $0 'p(K2o0f? 0-LPL@ x0S C0Ux  Tp0 p0@TP0Hff(x R`Up0 Bx p0Hf -@RLM`PJX `P@TT8`FV000S/SAP pR :@e DA A P1p00WR :x0@e DA P!0@0@ T T 0oTh*Tf p-Ld`MPK0S bd %L@P$ 0S T[xXh -L M0S, 0@ 0@0R$0 KxP1[S S|ࠁ ࠓl 0@pP[n1[S < 0zpP[nK,fhg?ht@> 0-L@PX 0S0S : 0S@ |@0gd0 -L ! 44bP, 303 0 h 0f Lnj,f Pp 0 00 PT 0-L@PP0@S0 0 C<0 40 ,0(0$0 000BCBBBB0@-p 0P@0^R0>S@?S00 0 @ R0:0 0 B4C -p0L R`0PpX0`T0@TPT *U@(0  000CBCBB -00 LP`p@?  r 0  ^000@S 0@00 @PᅽU:PT2D2p -p  L2 20R291@1P៵10S 1 19a威P@Uድ0c00D0c!S000p1HA jG41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t0T0 CBBxhC CCCCCBBB -\0\ X0LP0/0A00808 Q005 FhCCBBCBC - P P0  0L 0@0R_0DS X 00CH 000@00S (0 R000CRh CCC p-40LP@`0@S 0U pC -L - L 0   B -LMP@p-0`d K"d@P P00<0P 40 T BBBBB,00$0 00 c0BA$hh,C0C P-L@Lhp < 0 00  ^JT?@hC$PT -$0L 0f -D@LP`4p0S 0UP*0V CB -L@@T* -0L0\ 0@ 0 @ @\ q 0_Q $Q\@ q 0_Q $Q ^*0BBPTC 0-0L @P:000P:t0@0hd 0PP1: S0T C:0P(P00Q0T0BCB -1L1`PQ p1p@llqKPQE r 0_R $RLVr0$r" 0 R00 ӑ UV r 000 R0 r 000 R00Q r 000_R $R @T0%"*0@nBBCPTSSCLU -0 LP.000R4CB -0@ LR 00R 00S 0aS!R0S0S0S0 SS CCR00S0S  CBBBg -0L B -0LB -D0L <00S$0SBBC -D0L <00R$0S`BBC -0L0P 0@ 0 @!@@P Pq 0_Q $Q@P@ Pq 0_Q $Q \*0BBPTC -L -0L@JB -LD0 <0@ 40,0(0$0@BCBBBB -Ls -0L0`P:00Ph$P0@t0 p dz@X0@йL0 DPD0@@@TDh,ghB,CBBCBB -D0L0S8000,0 (00@Cg$hCh -0L 0,CC -0L 0B,CC -0Lh -0Lg8 P00$ 0S P0|>C -LMpP` ȀȠ04 <0 8 0 00 , {@@@@E4 0 b00e<08 040 00 ,0@ 0<0T T(0@(KBBBBB|> 0-0L@0ϠP|0x0 R  BR 00S H0F 0S@Q*0d0BBBC -|p|0L 0SP`:'L@  `Gy Cy0 0 0 BBB -L@ǸP嘀`@Pt0 pp 0 R 3 #P0 0V@ t0T0 BCCBC 0-1L0@Th10SP' ሸ0D@P R R "R 'R @P R R "R 'R R R "R 'R<P0S0  S S "S 'S P0S S S "S 'SP0S S S "S 'S  B0ST0 P@T T T "T 'T00Z@0hCC -d0d 0`S00L0L  B P4$0 0 9CC8C@B4C 0-PLM8 4@0PKK0K!00Cs08C p-L0L@ xK<@<`0PP N0QpBBC8C -tpPlp@LX`d@D0 <0 40,0p p*BBBBCB4C -pPLQ DP 81 P0S0g 0Q 1 `gP@UH@DtP f w0 0 ~0 0 0C0bSZ PP@@T *@@T*D0 D0 P@tr0T4CBBCC CC p-0L M @0 K0$KK a(K0a `P 0 P$0 `}0APX PU<BPMU'KpBBB( > 0-T0L@T8 800TPc@PdXH0@04CB p-0L 0R 0R`P0P0 x0 EKɶl0@d/ 0R  BP 0 p(C  C8CCTB -p0Lh0Q`0` \0 `0S 80 `0@SZ@dCBBCB -L -L -D0L <00 R$0S BBC00 ,00R00S RBBC -P0L H00R 0@0S`BBC -l1L M ``10 l0lp ,K0K(K4K `PY@W(4 50 ,0(PcVP00S@  0,gW(0  X (0000S/S d 0"W00S (4 R X(q$KBBB( > -L -L -L -L} -Lu -Lm -Le 0-0L^S@P @ድ ᑵP0hPe0 -0L0Q @a`pPPW vd0@d@0@^SD @DT* 0P 0 ,CgBh -@0 P00L0p|@`V U PPPPo00Cs0BBBC -L0`p 0 S 0809\- 0P@ 0U [uP @T0@TD#I 劣` 00000@@ @ <~W0@0 P t>$ClB --LMM@00  00 RK0N0 0  0 0Q K 0-PLM00 @R 00 |  Rd0 RH0 R80 R$0008$C( d 8   -d8LM X P8  @P 4P $ P8  ȟ@0 |0 w 0@q b0@k <0@e0 ` C0@Z c0t@T #0`@N 0L@H 08@B 0$@<0 7 =0@10 ,0 ' 0@! 0@ h0@ d0@0 l  B0X@ L0D@ l0,@ >0@0 0 0  0@ *0@0  C0@ f0@ g0p@0 (0 H ?08@ ?0$@ 0@0 0 0  .0@ _0@0  0@~0 xy0 ht 0X@n0 Di0 4d A0 @^ U0 @X u0@R0 M0 H0 C y0A@< [0B@4 [0C@, [0@%D [0@ O0@ O0@ O0@D O0H`@ [0`FP@ [0P@ O0`@ O0P@ 00,@ 10@ 20@ 30@ 40@ 50@ 60@ 70@ 80l@ 90T1P;`5p@ [0@ [0x@ [0@D [04@(K CB0Cgt> t p p d $ ( d D x L `  T  |  D | 0 !    # -0L0@c0 @h 0S X Sh  -0 S00@  0L0Pz h^t>B -MLMP`Qp| SpB_ Q 0P @TP82@ @TNK @D@D0"{U1`@dPP@T!f ^0S1`@S@TN BPP0V,A ,1`@ @T .P0q.K B B"0S @ P0^K PE@PE^ @T  P0 0.KH0 B B$`9V< K Ct>4  -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,KX-,04#0hP0(s(3(#P`@@30c0 B0E0b02 >-0S0 0C0 2BQ 2\"0 2 a00cCR@00>Kp0CllŸ48 00 4`A-(K4 CpPo0(K s`0xB"C00!00S1 @ PV 4 pPUX@T@Z@X00S 0l\ R T0S   XVnP P PT0 000@ t0 `00c+VY820 -8KR0``00(KBBBhBBxhBC>,CC4CC CCCCC0C$hgCC(CCt> CC -LJoK⒞K`F MIM,0Ip0) )1KX\/PPM@1@0)9K*K帯P00 @T 1U5 S* S W/ 00gW   S09W:0X0 @6P0f)![^R@/ ?40PX7(Kt>d ! ( B|> p-@L `P4$0 00@ S/@`@P 000$0 0 @ pCC|>C -PLp0`P& @eT(* წP(R @pP00 T@0gS4` R 0gS:00W  -LMp `PUW\@0 S<KPT U0U/S0: S SKhP1: S  0 SU0U/S 0: S SR  KJP1: S/0000@0T :2 @`DA A0@0p2 ` @B@0U/0 bR;P000/S /P 0 1 00@® @6=P0g   aR;P  e"ᩮ! 0 QI000U1 $1SP0 0 1 1:0.S 0S* .S0S% 0.S"?P }0@  cRڇ;P  |!00C0 X 00!PP X 10H(Kh\{ -0LM<`,0 ( p B@ ,T @@0 4K$K4 0 $ @0( PhcEQ@e Kh -LP`@pP0Q :x0 @`DA A0@0 @x@0dC1` Ach=hd! -L$M< 8 P`@㖭P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S" < <08 +(Ko@0T :1 @`DA eA0@08@ `@JQ 8Pj `p @ DP 0p , H 90S5 0{R,0GHl4 , ( }R,00S,0  ,,R\ @ 8@P`w0 s D o40D<0  c0 p W(Kh -pp`0@Lp)@@PP4, P0p0mh$hh -LMP HK hU   XP?0 /0S 0S0S @O0  00 , 00( 0 `Kpp P  80 4 L   80  cR 8K9 Rk,/ l> > > ? 8> l> 00 \ ]x/ / / / 2 / . $3 `: > ,> G d p 00 C   ; 0$  (00 80 cR8K§9ː0 00S0 p)0-P]/)0@00` Ot͟pW`R 0S*00S&0@T" 0S 00S 0 ,V  00PG`Pp tp3@ K 7G`v@|P  | 2l ! 0D` 0   ̫p p 5@ 0$     80 cR8K9ː0 0 0S0 )0p00,;0 ?C|0 d@K 0K>嗫PK]@ 80  cR 8K8000SPp0 P 0z`Vd #V Q@pTM 0SY[hP 0@S*S0]SWY: 0@S@0P@T*T)@00Y\9@P@pɟ00S0Q0S T`  n8|)00 F= p  Q0 0 0 0 :S  0  0S   ~ 0 00     @ 000 0S  00R   R 0SQ@V*V#0 #0CS #70S0 0SAY@Vp@@V0@V```  @0p D0 s[㲪P_ 0@S*S Y0]SV0#0CS # 70S8'P WY@p`0 V :6@e DA A`P@[pWe0S Ɵ0@S@@3 %V:\6AA  hPap DP 0@@S000 0=S%00 5Xp[@ 0ş 00@ 00s03ş P00S -R=R ?R+R@  0S 0\ş SQP+R QPHQ @0P@ $TP 0  SC0S   00\0 40 0c0ᴐp 0 0 %S #S=S ?S 00?0 0 pA.0 (hhPhx|Dhg> 0 0 0 | m$ 40AZ  0 0 P   A  00S0   zQ 0 S  D0\ D0  @ T! R 0S, \      X0S S PH DD@T  * 0S  R0 B  0A Q Q Rq _A00C 0  |BP \"0t0300L  0  0   R 0S\00 S P$#000 0S L0 00#20#\00Sr Qo 004, ` P@ 40 0c0 6A0 + :@0T :@` DA A 0@00P0@0T :x@` DA A 0@00 @a@PP 0 ( 00 , pp00 0 80 4 0S8 \ `000   0S'\"40Z<PP` @0T :@` DA ^A 0@00 P0 pR 0=SC ,S2 !S *S"-\ :\:]P ?P [P}Q ~Q0 {Q 0 0[R0 0    000 00@ {Q @ 00000 < pp > SpP(  0  x0 t x0`0 @ 0 | 0  cRڀK040`00S0/S T :S000SS@/|P0Sd +S0Sx -S0SUX I J0@ ?P@ 80 00 @(T@|tMT@  80  cR8K30TS00T@00TSV 0Z00 ` P 0 00 0 0S0000   ) 00 3  1(K 0-x0L M0@P- 0 K 0 0 Q 00`0S0@@K0h> 0-0L M0@P  0 K0 0  - 00`C1@@ S@ @0K0h> -L M0@Sp; P P$ ( :  $ ( (0  (`K(0 PU @(@ 0T :h0$ @`DA A0@ @ $ (0 (,0P$ ` ( @Kh p-PLM`@PT@^0 P3KpfK -@LMp`ե@V`1S0P P0 S ,$ (0K(p $` P f3KfK -@ L1 >@4 -LM@0 ,@K p-LlMPK@` P@@PU  : SI  S @PV 0SKp -SL0M@< /0 P < PRND1  000 , 00P080 4 ::pP4@6pW `e80  cR8K=2@ 20/  @80  cR8K,2@ !4< |P4 `,  PP PU4,x(Kh p-LM @KPlG`  U 00/S 00 (Z000G@PKphg p-L@`P0=S\ *SZ +SZ@G [H000 `0phh -0L0p@`GPT 0r03X0S  hgCgfh -`LpPF  @0`;000 JUFv3K0 00P;00G -x0t`00lL p@0PP=>0D00 @80000gxf 0-PLM0( 0 , mAF/$ 0 0 0S   0S$0 Ph1RdA@!0 D 0SF ==C(100 *@P  0  *0, R ( 0P( 0 0! P0 0P Q9p* =p ^$0@:֡ 04hK0hf\y$h h  -0LM  00  P,0 W 0P,K  0 00S  0.B*?0S2H00SF? PPx?  AA4 0 4K?#0S# 400S PS! O 4;o 404 0S00%;P400S7400S 400;0 0 0S00S 00S LN@P 0 @ y0 0S 0\ K 0 0 0pX` \>$Q `X(#0SX0 >h,   4 D f\yH \  >gg Tr T Pr S x  f` gg00 0&000S 0  Q 0S!CDt00S o&0   $(K -L$M< \@0 0,0 H ` p㘈 D j 0S 0S @\ >4  $ L | @hhhg  Lv kC -LM0@ R0Q-0P 0Ap3SP! KK0 0@0SP00 Kv Q P 00犛p3P000K -8@L b?0000 h -LM0@00Q4s \t lt |t t &0@St t t t 0 L 0K00K0 0Kt0 0 h0 X L @ 4,  r#    , D   -LR 00(R0S0S040 2"0  0 2" -42`0Lp `@t 0T`(0+ !00( @00[TFP`!H 0S O040 Q ` .@2I{&00J0 4>@R_T 00 00#T0S쀟PA f ~.@0<0 000 @ KP C`'0T  P㚕% ȚP0`  0S`)0PThh 0-L$M@8 0 0K, 4 $@ @ @ "0w@P  R050" T40S* "0PK?(0(S'0(0  j(0(S 8 0   [_KK4 8I!K0h> -0LS@P 00S  `@KP0u @050VK0 050p@ -`Lp@T @P00D 00    K JX @ - QL MP4 O@T``!0DS00ST4!T 00 "T 00s03V$ 00c 0 #T  0$S 0%T 0&0DS4  Q0 0s(40p0C00 `fY @  H@ I R,   5 YY Y 01`0IYSY  0S 0S0 0# 0IS ~ $~  } } @} l} |} } } 8~ H~ X~ } } } } } } h~ ~ } } @} l} |} 8~ H~ X~   0 P 0sq 凑 P 0sp cp 0p 0pc 0s 0Rs~ 0Rppx 0Rppr 0Rppl 0Rppf 0Rpp` 0pRp[ 0pW 0p"S 0pO 0S 00 00` P 0p^ 0pSp: 0S 00 00 0`S 0pI 0Spp$ 0SX 0 0 0X 0@0C 00%S zX 00 0 X`@ 0! p,  R 0 p   I H@Y p0IS < 0##4 0S 0C 0 (Kl x   -L0 M@0 00K, $00K0C-<0<80 0aC!P00? 10hCg - @L!00C -L SP> -LMP* 4 P0A0PUU  0$.!`p P' EP 0@0ŪpP8 d!0 R =/DA i0 0C0N 0w=1`@H̠H0-K HT-0K,K+K*PK)K44 0-0~0@P 01Q:HD00 010CQ:4 0 (KgCCChgh -LM@ `, E\ @ <   ( 0TS60Tl20Th.0Td*0T`,@ %TX"0P0U: 0FS 0aC1BVV0bqPP,D<)``, !J@Zhgg -GMLM3 0S 3 |3|uEfHpCP d)KJX JD3L-@PqP0 '-3PP  0@P0ũpp 0S0S 2<l2FP dXx `P@R긆 Ȇ І ؆  0S     0S @P1\NP PEU0SU8  RU2PEU.`<T!0 J1 @-`PbP@g@d P ) KP| ;0 =P0P0<,FX0 H\0;D@G0 p,(0(KgCC CgC Chh  -8@L0S (0}/ }0 @ ghgh p-0L0S `P P hPP X0@T@@媼D0@ <0 B40 @$0phpCCCCggCh -PPL\0U PpP`0`CAU!bqV@ 弼1P0hhgg 0-L0LPD0@8 P 0dCRB0R00hg -LMQP,0 ``pϕ @gDAU00?PAa,0S ɕPផP 0gC@T : Thg -<0L 400R:PR B| hg  p-LMPK`@2'P,  1R 1000c00PU QV0xP U xIxV P@x0hP?SX0 b@@0 @k P0$ &xxhCg    - @ 0LSp:P`0 S 0B00坻0 0C000吀`Pɔ@P  P0S@0P\T 0`0DV ,P@@ghC>g$h -d8LM$0 SP HxH`     CgP- 0P>9P2?P eP8nP 2 lP/rP ) sP'PwP ᷔ @ M( x p  000 `  </Z Y'o#p00 VaP 0^S   z0@T 0S =&pP |6P=&00c  㰀 ZZPY0SZ   P@r XU&hA > 0 00 , ܺ004 080 pP8  bR:!P@ . * 0 PpP`g 0  )8K ^00SY)80@  cR8K !P 4`, 娺Q 0 dZZPYYP0S ,Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C O,@L,@ 1PP0 d >,0S00`V@3@#V@T(H2F/PU@\ L7z^@@ ,Q00@T`3`#T`Vh-p<A B ARP>PPL 0i.PPx@K uP`0,10 0(08`K,0 尹00@080 4 8 @0dS 400c0bS  @8d ,P $@ -  -004`` 4(Kg gh  ( P d d A89hCxf    $h   0     g$PQ00g$  -0L`0V`Ppᕒ@@8P,@ p0PP -T P x-$00000(h؀4 h -@@L c-0 _- [-0 xfHfC P-L h 0S0S L@P00P00@P00g -$@L0SP00g -4@ LP0SR00g -,@L0SP00g -@Lh p-L`00L S@$ R!PPTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0PpD X p   -LlMxKPx0: S K --80LM0S 0 0 e( & KCf -@PL 0P P 0CP l0l0h -R  D*T <@Q R 0$S0 5* 00$h@hf  --LM4@0 0 ( '&Kf --LM@DD *0 00 ($ '&T>K f --80LM0S$ 0 0 ' K\h xf --0L M 0@0S u0 R)0 h0 ' X|'PO&P0  D00S   0  K\hggftDt|>>-0  0\0\^S  0008 0 Rp00  ` 0 ST 00C0H0H P4 000P00D0DhD,DD D 0-LM KN0P@0S 0@|  00CS0<0@TH0@0P 8@T $ K&8gDgf -1@LP 0= Sw 0mG Ԡ@<0̀ p0`P#@ Q 0  T  0R@QT 0  P L00@4A0P DDDDD -X"00L0p <2 <0S 0S R0S Sx PWs n%^ Q0ij0`9S 0S*+S S %S;-S8?S5`1T1PI PMER,1 0SC P81P`8@ ܍P V` W-@TPUV 0@P 8PU W 0 P@T U W 00hD -LM`Pp4$ K'V`U (KN@P  $K( 0!20@Wp Wpp,40#00 V  @ o 00CS0<0U@TP0@0P <I@T$K ފ Kg\ Dxf 0-0 0P0 @L R 0S^ UPR 0SQ\ 0@@<00\, (0Dghg( 0 -LM`00002p0嬢SpPU0S @ 0020@00U 0P0@`00 8Q X Q  00[ 0010S+ 10S' 0S$ Q1P0p;0QP P@/ˋ 0|\ 0S0D 00-FH1P 0S0S0  F! 0S0;0 <0 R 0SPP 020d2,0 0P@ d00S 0S l dd! 0S $00S U DgThh$D?(DHojfff -LM0@K 4 p4lj4,KPP  ⾉, 34! R㲉@W`8@Ē S2 `R 0 @To!V @W g= 0S1H20S 0 42D z20S" 0 2pP0 1!f0K a0 1p@`@J0 0!0000U00 0S6oP10W`" 00 10S 1!100S @PqP @P宊 0?0K ᢊ4 }^W@ h00S0p >0i@0K (Kg\ p>>xf$D?o D(D -LM$PK@p ܈`T`00 0S 0S# P $K  KP 0 S  㷈 㲈 RX0!P@ @ $K@ 㡈T0d0KgDh\  -LM K⍈x0P 00 XLK z}@, K@ pgD,D p-8@L`P P iPP@Tp -LM$pK` PK Kx@P  B 0!@ R 0SUUX UP@屉 (@$K Kg\ -08 00\ $< 0S0 Dh -LM@K 400 R000 gD -LMp0  @7, Kԇ$`V00@`0 0000 D0S4  $P0``:x$PU00tHݰPT4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`0#004눣@0@S 눀[PV0#ST ,,K Wb23 0S 0S 00 .20SX 2 Y0$'33 @TR  Y,K &T20S  HBHHb -@DT 20S   10S - -O ]`P  R1@p!@l1 @@@4. 0dl5+  \opd -H1H@DaDqL P+0Q& 0S S!0 0S 0S0QP ᳲ 0SP㧲 @TR&h0 X00R TPQH0尾,$ 0S 00iDhgg>? p-|1LM0S hAhQ`!GQ勾P.ʆ4 ,P"徆 Q$@K 0PK @ @ $@ `A' :0S 00SP,P商d  D0IP分, @2Kp$D?>og p- 1 ALP P܄0Ǡ) +U 0S00 N"0 R @`P 0S …0 00y+@DT @ 0S ph, 0S ph[2pDhgLm g Dxhj -LM4 4 0S04   R|@KlpK,K @P0P8` 0S `VPU04 , 0K3R,04 0@=9B,0 =C40t04 , c|0KPR,04 0@=9,0 =400(  0K(3R $( 0@=9B $ =C(0h0(  cp0KPR $( 0@=9 $ =(0P ᘃ,00, 0S0 0SS000 8 8'p0Sm R Q<0  R R0#400000 00CSA0S00 @ R 0R00CS0 0@  0S, * 0S 0S# 00S (1  0S 0SA R@  o0 0S0S   0S 0U  , 0p 0000X\(K P DhDg?Bgh D DD -!MLMPd h( l8  `}K!-KpG B B0pG` p( \ X8 0 S ``d \Q d(P P P  0`8 T8  P XQX8T8 `T( 00`8 d(P\80#\8 T  T( \P}PU D7@TTdUL (HU} 7U0U/*!U #UF AU DUD @U?WU TU VU7]UX PDK6 [U* \U,#aU)pUk jUU eUE hUDlUQ nUVtUl rU_ sU`vU 15^:wU 0P4K0K$0Kc%0Z`}@{@T@P@T+psp}քP@0K0Kc0p(s}Ȅ0.㾄]0P lP ` 0P4KODKODK0S#0$0 0`H 4+s0K0Kvc$0_s0K0Klch$00K0KccH$00K0KZc($0 mP  hP +Vs _P@u25@25렄PXP/25NP~0P4KOKW X25 ᐄP0/S$25$#00A25P25*P~0r ~"0002 0 00b"00A0S @00B0S11P" PTK0O4K0X8 P4K$"03X@` X'@hlQ!-\(X0"Q TQ`( `( K!P(0!S%  0x!0PK0PK X@PK Xd4PK@hl(R,!\X0 & T(R`80`8  XH`X00SHlQ 0x R\ Bp0x p0\(0" T8S`` P lQ`h(R`(Kgf4g@h$@LxؠP$hxTfHf 0 0 0-0LMPP P/)@14b0 0 | jPPp@ x0 t0 @aP'0D<0 ,140K0ghX\dgxh` 0-00P0@L @= 00h p-@L@`0DSl0P $<(` <408`B۩400,, tp> p- P0@S0C0 p0LPT`` 0P0@0 (0@`000<0 00p4D$h> --TLM<00 00CS,@@W0 0 $h>f -0@=C0 0 L O]h -4L@p R l x x p p , ` D p4h0P 0S R$00` ` `, ; bR,P0V0PP 3P 3 0S0S 0PP03Z0003,, e P   0  $0S0S '0R S 0 ,0 b cRjPLP0S  V@ 20S2  O0000c0 U0S K 0Z0vZt X0S  0S 400S 0S  oX 0   0P 00S!000  C$0 <00$ $ $@F 0 0S  Pr P000 <@@$00$01<00$ $ $P@ $0 0$000 0<0 0R  8<@@P`0 0$0 ph0Q0 0S $h>gf>xhXhgh>>PThf 0-0LQ 0 0P0@0- 0SP 0000P0@00h0 0R@0@\T 0 0R0 P ,0 08D$h4D -0LM p 0(00 , 00̐0ȠP80 4 `8K @T\T 0S00 @80  cR5P[T@` ]T`FTV T004, `˧v3(Kh$h4D -LMCK K   ?@ 02 A0 <0 2KH4 00 8 B 哧<00 D0 $?@@ p@ ; 00 |" 2"< 02 > P\P Ο0S00 1 P P #Pp000. P\P TΟ0S00 P P00C0x,> $0 0$0=0S     K D0  cRDK p" R d   4  @  P=0S \=!Z  $01x P\P ͟0S0@0 @ TTc Ta !TPG00D-T S tV x,0 00Nt L,0 00CKR AK`h, P\P 4̟0S0@0 @T T T T@UYCKC/K0)P;0QU 00!S 0(000 0 0< 9[Z9"`6 @+P ,KP  0 ,@pP D0  cRDK p0P  p0S:,: ʟ0(i,00 000<0@Z*Z ?Z+Z !ZH* P\P ʟ0S00 (P@ 00 j'Z \ZG "Z' 50 Q0S009 00xɟ X 4K0p2 0000 X4K0\Z `Z $Zz>  P\P ȟ0S0@0 @$T "T  \T `T0  @p   0@0p~D0 cRDK@ pTt  \00p@j$( P\P ǟ0S0P0 P(U3 P\P ǟ0S00 n(P @00T4K0 @00c0000T4K0 000 00" ${U0  `PPp @T\T Ɵ0S00 /@VK| #T`R D00 `L `I900A[T2,KQP @,@ D0  cRDK P000S%,5 @T\T ş0S00 @L00V 00AP%p P\P D0  cRDKm P@ğ0S00 :P@00 P\P ğ0S00 p%P#P  00 X4K 0 @ PP00T4K 0T4K0000@. 0  Q  @D0  cRDK @#P P\P hß0S0P0 ]P0$00 0   P p   D0 cRDK p 000XPp@00$0000p00 X4KT000000D20S4  0S0 0 BR CC'Z40 HX4K  R" u 000p0C00  <"Z40 HX4K0 0S6 < D < h (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0d 000C0@T40 HX4KG02 @pPTgdph8Dh|gg4D,h hg g$hhh(Z000 )Z00CS0D P\P x0S00 f)P 40 HX4K 0 @`P@ dM=00%000 0p00 " g}Z!40 HX4K  }Z40 HX4K0 2 00p|Z (Z 0@00000 X4KC 0p,`Z 0040 HX4K \Z" P\P P0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 '(Z000d\Z< P\P p0S00 P 0  'Z00 X4K 0 00" 00i"Z 0 0p" _00pZ"Z0 0" R\Z D$ P\P x0S00 e$Z "Z\Z `Z Z 0  [  p0  p))Z  0040 HX4K p|Z 00(Z 0@00000 X4KZp 00 % P\P 0S00 Z P P0 00 D0  cRDKp =KX `"<Z>Z R " @@i Rg`W Vc0S`0&00Z 6V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$L7 P\P 70S00 -P0 0 &PY000 |P00X  S @0000 0@8咡7EP[WP008兡(Z  Z &Z;Z |ZGh8 P\P 80S00 ] P ;ZȠ1 |Zㆠ. 8&ZK)|Z&PF% "p F, 0 4,0! 000B01 o1 0 1 P0,` 1cX T 0T 1  cRCKP@`9 P\P 0S0@0 @T0S TT 0`!E0. 1Y T, } 1  cRCKP@  P\P 0S0@0 @ T 1  cRCKmP@( 00C0<+ 0\m:T;0 Gd;0SX; P\P ;0S00 (P㨫w u0@8 `K0ASb  @00P  PU LA  `XyU000SI " F 2P l  6@P  <R }R<<f 1&  @P 0 ,  0S < 0S ( 0  @000 <08 8= ;`Y0S (K0\D -\1LlMP`@T< 0PUAPh `9:AypP0T\Sy 9%2y@PPD 0S?(y@P xK@`PP0: Sh0K 0@  `00PV(K>gXh,f 0-00P0@L@PP0hh 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1ⓝ@P) P0 =0S < 00 0 0 T4E  1;  40S 00S2 60Q 000, 0 P% 0$( @= 0@ 0S 0 0 0 0 K0hg -/L@D#P@PvP @vP 0uP  up3 -LM0S8 8  OK嗜G/du8(K K⍜x8xX@d))R\H P8 D( 4@ #PP X@PTg7 0P @ᅜP P$ b%`'7@   |uP luP uP0 DDvuP(7  ,',7  7 @6T! P 0P'@PƟƟ@0 @'<#`&0@/SKP|KP 0R 0R 0R 4V 0S 0S6T  $4U@#e%# $P0S0S8El#0 0S V& t5P\U `cX5QT% P5P Q#0@ 0S;&#tP40S1&tP4 $딩40P@T0 0@Dp  0pb`P!0S 31PS00P `!RI  2V @T3P  00P  3p @+s 3` $ 30s@@b3P 0  .P .P @$@$0 0$00000 0KP1: S|2 0ShBP 0S&2 I1@0tP "0Fpc0 000Q 01@ 0f0@ 1 0`p00P 0ShA 0S  0g@T 0]1@T 0  0S T"E%0S  0FPDD"5%PV (0  Wx0  l 0S00 C(K?@hg hhhgDhhhPgxgla>1 gh|x\{dh>g$4b9f,dgX\0g HP|  -@LVP@r   -LM0@0cSz bSz+ PK  0`R R    0R PU  40$Ă,40S,((0 "4S \W  P@οjr EUUUU  T 000  R0000000S h -L4<0<Q808 R` `;0;LD<4 ,@$hh6$08<DHP 0-0@pL@`Pk00e*k@PD\ 0 0     p-0`@R0 000 LP☙0Pf 00 p p-`PL@l0lq@M VPP8` r  phs.ph - L@ٚ P   њP -LPpZ 0#S@P@ *`P -@QL  +Pp``V 0S  f+@P@Pf 2p`V:00@j -LM\p8 < @0 @,14 8 yjPPPHsjTX` UU0PP``ї `cjPUp0 ,p W4 80<@ |0,  0S `0 \0 @pT Z p@04(Konh>px> -L 0  P`@p!0 Sm'S ePUpPH0S CTTCH  T@0 @0@0TSU mhHf}4xf -L@p`P0S)QPU:|Q00V0S U ?qPP@T: -pLMP`, G0SC@*T< ?T: [TV:0S 0!RP0S.0 ]S `P) ']TV% X/`! qP Vp|T0V0X0S )T V X*WpG  `P,0U:V P w3 -LM@Q` 010PU40!0R-P00-S Q  0 0, 0 R -P 000#0+P0SPU , e0 -P0 0:U?Upp ,U;U #U ,P pP0:S0?, 0Pz 01  1PT 0k h:P ;P- 00 0R0! R0 0;P :P,000, H 0,1  $1,P& 0= i?, :007,P0100+#P- 00`pV 0 0P"pPPpPU 0h 00TpP0`P000? , ,(Kw>ho p-<`LP@1S oP @%T@p0 0 -PLM8 pR  R< l8< 0Q858 5#4 %4 5 S8 \0S8 ?S *SR[S SMSJ:S0CSE4QM 0SM0!SI , 000 0S0[S0 D[SB0:S?0:S@@`|oP 0S *Tf oP  0S4P P@T  0S  r R0  r 0S0[S0:S 0S0]S= 0S Q  Q Q4[\1 (0S0-S R0]S R  R Q 40Q 400\00S 0 0Sw0]St0 ,0R pW4\ W 8@A< 0P< T@*  P 0W8S`L< 0PGP@   r@p@P < 0P<@  0qV Pl@< T 0WP_   K`PX 0W8SA< 0PNP  8<@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (K? -pP00`Q0L@MS@%nP|nT@P0f@@T\PKT0P ܾnp3 05Kh 0-LM@P K^0S  P00 R0Sp008 0-L@PP 0 p-`PPLP 'n@ʔ P\p -\L(MT2K R 0S %Q$02K00 Kgh p-LMD`@4 P0^0 ~Kpg;(  -PLM`U0p`QR: UU UR0000` USQ R<@K$ /Ol0 |U00R0S80   U 0GS 0 00R0$`gghg -LMhT0Sp! P( )\mK=0S QP%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  DK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S l0S x!R D  0Sb ]t1S D  !lD0 D0!0RD(KDL!dDgxf`* >d! 0-@QLP0 00h0@-0PSH /S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S k 0 bRP@  h 00S@/S/00,0YQ 0c0` , 0 bR@, h, 00S@/S/00`k P0 bR@ hY00(K> -LM00lSp@ upPUP@/T TQ /kP `eQk`V.T@V .T 0.S  0w/S4 W1@/000 0 bRB@ 7h  BKA| ;P@0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@j0 0 0  0 嚑00 K 0  yP 0Q/0000 `Kh -pPLP0PPPjp`0V`@X `}D0 gU 0U $0h+>gdhgh 0-0L @ 0  # 0SK0[ $0 0 :Q0a/0 0 0 P  0h 0x -0L Pp 0S0+ ζ$00j  d0:00  X = SU, @0  d0d0 0 8 @0`d!. =P0S0 0;0制 0T$000  *000``@ V 0 90 0 0 090 -P Ll X`  R 0PXX@@ f0 0 d@d0 @T8Np4 T$Qp ap`` ǠP0S0 0;0 00$ `` V @gT  f 0 0d0  0-@PLP i 0h0 p-LM @P% u8 0& 0PKS0 `K ˵$0P0&Pĵ0S0 0P;0幵0$0 ZP0SpP 0 0C0P x -QL0MP T H H D P %PP0pL0 q  R 0 B 0H@PP @H@ .X *X  X #X7 +X -X2 hX- lX# 0X+pGpEpCpA p>|;TT0  D T 2D@TDpaT L@ T L (0lSP @p  pP  pDF00! 0H 00L 0 RF00 <SL0  AD L P @PPPP XP cA0H0S 0c0HT|ΟS񟗦hB L@ B B B B L@ B B B B B L@ H@ B B  `0 @P l 0R0l# (K%2> &B P0` l P Lx0X00@0L@BB(K l YрpL T 43\ X T gX T@0@|?KT@ ?0K?K?K'40#0 P0SL Q`qL `i l= S`fH-P+P P0S X PX0C0 0 0H00IH0 20P00S X :X0C0 0 0H@I@YH@  0xS0S X !X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUH@@H@ PP0H   H H(Kh\  --LM0 0 K 0- L@P u  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0 -0L @; 0S0   3 =$00/  Tp' 0 :0  'P %0S0 0S0:0 ;00 00$ 00 - L@LG 0Sp 0S 0 0C 0 D -P L@( T0pD ` 0S p' 0S V0`!  P0 00c0S@@ ccpW0 X0 dP0 ``\ -P Lp W`  0S?p 0S @V@@ )c0 `d0 dV0 W0;fp 0-0L@P  Pw0  00 ,g0 0- 0LS@P 6P f 0P 0P 0 0- 0LS@PP OPP0 ,  ,60 -L^\Pp`@ZT00\I@|0W0,B0BSV@`;[p0 F 00p $0(`pp ```h --L4MD@K0B 0 0 7dK -p-`P00PQ0 L4MSP 0 L@K0 0 0 PCKp -l`L@pP  iPP@ P P@@ U 0S (0S`0< `0``0$ p   9 -l`LPp@  'PPP P PPP T V` 0[⃋00\{00@0d00 0,0$ (` p ` P h -@`lL0pM00 0,0< (`0P t@P T00ӧ2  㿌`V@,0 Q00 o0h -<0@L   @     h p-LP`@@P`p p- @0`SL0@0? P p 00P@0T:h0 @`DA  A000 000 0 00 pDDhh> -H"p0LS82@Q00@A2 P 20 S T1 T1P``BTR5 1c6T(P``2T)P``,0DSTEP`100LS P1\H1H5 `R`>  b`P0  R`0rc`p`3V( 0 T # X00 P@0T:t0 @`DA Q A000 000 00DD ghh -1LM0 PPP0@  Q EQ Q P0PZ0 0 0 0K 0R S P0AS@KKK0@  05D0DD$h<HhXhl -0Q0L0 80 00  0 0bC1!0 DDh 0-< <@0PS0L0P0DD p- L0@S 0ES00EPPP `0P@ @T@@T000 0H 0D00S000 ,0RP4 5 %+pDDhh gg -L(@P) P㤀p` P/ U0B@0<PP 0`|S00|P00S 0 DD -LM`ءp, PP  P 1T0 PP1@Zl1@\1T 0T P<100H$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0  DD$h 0- LPsP @0S00,t0P 0P\@P dg@T0 @@0DD 0-l l@0LS00 D0P {P}P :^, @0DD -\0\@00Lp`0 P 0m,$hD -LPM@NP)t @$0@ @, 00 40 -0S@0h P0,^P=U0CUAU {U  U. (U=U 0UREU! \=U 0UD=U 0U) M= t⮇0⪇ ⦇x /\@@Xh`hjTh00S `h |0p-LBPሦ0`@ P0 L00  0S40(00So`pjXh`hTh -LM0!00Pap8 (KP6 (P3 P10b/@T( X yP% YP PjYP YP D YPzYP ` V`hj p-L8`P@TP000@Pp>`h -`PLP= P@T 0S@@T0S@ pWP PP@Ti -L0ML@K` B 0p`0P S~ x} x} } } 0} 0} ~ T~ h~ ~ } 7$(P0S$((P0S))${P @0TPS@}Py(|LKK `0-L@P^$d?@0S^$Y?0hU p-L`P0@ S*   d d        0P@S 0P@SPVU@ P@0TVU SPE TKp p-L`P@e3 phU -LM`Pp,`  %, 0,  S> ,R  0Sb@, @P0 SP@0 R,0  0Sb@~,@P0 SP@0 X/ @Th@~~ P000S z 0S t 0S @T @ , p, k,00, -L M`p, 9,%P, 0TP, RP# @;P NP"dP cPsP uP@=0S@@0P Să ̃ ؃  L   0 <  Z@ `T"T $T\P$ ( 0S<$((0S))""${P @l0TPS@}P (|) ?dPPPUb,U@-00d0S@PU} 8C80CS!, ̆ 0 H  p p \ ̉  D @T0\t%@`%@T0\0%@(%P%0%0$v4R0 0 $h$cP$]@Z00\x$@p$d$0K0 SL$0D 0S 0$=@:0\#@$1$0 f#0'p#!@\)|0\#0 #pW#nl#0@pP0S(#  00#@T" 0S"0" "0"= R20"""0 "& x"0p"d"X" 0D0R<20 0 "0 " @TL0 S@ P00S0S dS M!0v @PTR'  O#0  ;PH  C@@@DT 9T @D W+ p,0P(K,($ $,04DPT\hpx <4 -- LP4MD@KB  0 0 x]K -- LM 0  j K -pL@TTP` T TT  T30# 0R 0 P00DS0갍 0 !   !  @     T 0S d  \ 0H  <0  0i \( -@LP]00? -@pLPP00`P P囁@P@@!S PPPPP@xhC  |L0PSD 4W0 U h? oDdo0S0 00 R000QR0[S 0S0 [S ]SQh -L@P0s3 -L@P 0S0=S0 [P 0P]P Ra -@PL 0T 00  R0 0Q [RP@h -PL pT0W:0000`$`V 0S0P@  z@  B0 A?V0@0 p`P -[L@SP 0 d hbh -L@ $P 0 E -L@@P> @ Ĕ Ĕ Ĕ Ĕ Ĕ Ĕ Ĕ \ @P z0[h茮(0 x@P Xy00h!h@U ,P hWfgg8>(hE -0LPp y 0w03&@  0` yy@T@ $0W<0 0 h! -@`L 'SP $S0p0y @%P=00 0@@0c0  PZ  oy -L M`@R0P  0SP2y p A 1 00"@P0Ps 0d^0a@ 0t!00h!d!d0n@V@0s 0@00S  0 @? O7 r 000 R00ӑ R \t r 000 R00ӑ R KhPTh>SS -LM@ p0 0P`+ 0[S(P% PP @  @x g p0 ,Kⷹ,  R(R00 x(Kh -LM4Q0( K!Kp@`0 !00 0P02 WP 0T@T  5P\ 0 0 0 0000!0[S (P000P0<0 KhhD -LMHR0!K( Kp^`(2 00@Y!@[T Q 00 @ @ @0S0T0 -ې!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p =P  p=0p?08p100p 000p0M * 0p0%P pP !0[S (GpT R@ !0[pS (7p000P0<0 Khh`Dgg p-LlM`h@P񟗪 8 ԟ \ | ( L 8 \ x  4 hBP`w-P%@ $2 0<0xy wQP hw000@/SiPeK P`0: S\tW0<0볺M~LD0GݐC! P 0,;b730<0)0<0"0<0@P}T/@ 00  0d ?0 0<0iD00c<0@0<0Kpfg>(h`>(Efxg0E -"1L0#0,uP`@  4TG$x / @Q:SPV 0 v V0000   6@`@0  0 00 0|P @00 0T(0v>h -LP`@50pHU@P P0S -0L@  T0T ?@  h00 0 hhD -L@@P>ꈣ H H H У H H H H H H H  0<0 00c0<0 0<0l00<0X00<00<0,0 (00<0(Ehh0Exg -LM0@ `Pg   Ra 000p1U 00S0 S XSxS   00S  p p00 0@  ,0 *-R& #R \00S&$\$ pP00 00B S r ,P0W B 7 BR00?,, R^l>PTh 0-LM@ K|pP@ L00S00 iu 0S0P 00? 08 -L(M0P  0I    0D !1 `o oF@T @ T$T @0!0K!pKF00gF`P T #00G F 0G T CpC F00g0 0S-00g0   0[ K>h -L MA #u0pPA040 000 740`V0 0 0 S, M, T@P000T@T , 0  q0<0 U :0@g DA tAPp 0040040 000S00 ZTX U :H0@g DA tpQ 0 g (Koth -LMK @p-( -LM`p, 00 P@ 0[SP  ß @000  R@0=S3g  zPP`30S PMP @MP 0MP$  &0e k 0  , RZ0S ἼZ|2t,00u ,p 4@ ,0D0 )< @4 80 < ` ! 0T0Z0S 40S  <\80S   P 0 PP000P0,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0|0p0 s0p00pUs@TW= Z 0   \  ?S 0S<  (Khhgx 4 > p-LLH @P` 0`0@PTpEg p-0L @T0`0PP 0  0 `PUZ 0 40Ps0ph)shh 0-@LXLs0 0Ps00S0000L00@0 0L@P@u q 00T00P0hP0 0 .PP 0@-0P0 0@$ R& q 000  RJ0q00  R J\L00q 0  RP*0EhPTG-PW\@ B\D ,\ $\ \ \ %\0\ ;\F\ T\ E\h\ e\M ^\ b\f\t\ l\w\ |\77 0 BqR700S GzRt700S `7\70P: 0s 0 PJ0 Bs 0 P@T*R6 0 0S6f6 0pL'P$ r 000   P000  P  00r 0 @ P.@T*+R5 0 0Sj55 0`LP 0s 0  P0 s 0 @P@T*UI PG>$5 5 5 ^9 4a^  ,\ 4 "\` +R  P%P#J00S@T*F^f^ R@PU00S UD400S 04000dU4 0 0S30 P 00SR3 0 0S3s`30 P4 00  0 00 Pr0  00r 0P 0 s 0 PP@T*R2 0 0St2p20 P0 s 0P 0 s 0 PP|@Tz: Pt00sp 010 0PPe @10 |1 P00[S (S )S {S }SG ]S     P5 p`@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQUR EPTh@U (0 0S00PP0g P-L@0 p-@`L0@ PR aB  e 00b 0pE p-PQL`pR@ 0 Q" 0Q   0S0 a  00 08@ 0  000ppE p-p`pPL@ R  P pT8@D00 0S0C0 0 pMUEE 0000  E(^(V 0-4@4P0L  0 00 0 0E(V(^ `$0R 00 UEM 0P000 0xhVV -`L PP@ `0S@ ؉0p00Tω0@S00lj0S0C0 <000c@T幉0@S000PUV -PL3M8 0880 3`@Yt3@0P?0p40 ,@ 0@ T(30P4 S,P,p 0p@ W0h0P40j S P2 0b2!p20 @2 PG -< 708P00\0S00 S Q   U MQQ0SS0… Q^@0# 0´08P\<Q 0P0PQ 0 0S0a 0C ,a 0P00 0R 0S 000pP@T*000S00 ,@S<@Z @>@P0S x0`00ЈX @000D00 S  00c0(K$VE VVVVgU V -`0@ X0LP0  @GT 㦈 㤈$0 0 0 VVVVU V -0@L0S Rn hGUg -L|h 0- P@L:n0h6ng -H0L 0@S  ,H@TT^[@@$hWg 0-@P LD 0 00h p-X`@L0nP,n D0 0 pg -LM@Pq0S aQ 1P@@]QP 00hA 0K 0$0K0p(0K0 p0 `PwPB1 $W 0P0(0AP3G ἃP U VPUPP|00  $0c0u03Q0SP0 000H0 @0 <08040K @lEE >UUUUU -L M K0 KK K 寃@P 囇uK -L M@PPr0S 2P 00S hbQ \2@@UUUUU -`QL@(00V$ᚭ땭PUl屴TEPp@0 P0C 0 [ 000`UEU -L M`Pp0/00#30#`0/00  PK? 0P00P0S@Jd?0SPOT_0 0 0 0? ` 0@yS  $ $ $ $ $ h $ $ $ $ $ $ $  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  h $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ d $ \ $ $ $ $ $ $ $ $ $ $ \ $ t $ $ $ $ $ $ , $ $ $ $ $ h $ $ $ @ $ $ X $ $ $ $ $ D A0L0 LPP00U0S0 <@T S DP 0S DTL<` 0 bbPp@k  @A00Q  ASk0p;p@@@; ;< < 0S000;/; ;@ ;@D; 000;L @t 0{P0 S cRP cP:0 @80*0  UP 0cS0WSwSx:0  r: 0t:000 0R@s B 0:0@PP@0P%S@0cSU0yS h90P0cSn9 9I9 9 0S000  cP`FVL9 9Ly 9P@ 0 OP`FV@T 8 0S0C0V 8@8 99@ 8@qtH0 0 @0S0C0bVP8`V T8 4800fcpX@@P]00T87 @8 (8(8?7P88P7 @7P.GWP00 3GWfP+00f 07 P  7 T7 T70S00S 0 0 \0@ 006 6 6 mP6 Q \6@ 6 6@0S```6 0 V\6 Ɵ0S 0 `0000 05 60 c`bEV0%5` 5@7C DE \ P5 5 50 S ``08T0P4 85V@@ ,5d0d 00d0rx|4  kTPw DPr 0 $0\<$0 S00L$00D484 Q[ T4?Q@@NP@$04< 300CP00S43T PP@^\``00 جpP U00S jBP7p.X@72PcB@0 P0C 0  00Z  P V20@P90 R r 0 R  R r 0 R R r 0 R 0S `V@r 0 R Q@ R`1 T11 1 0`R00 R r 000 R DJ PEPV 0 0S0Cg1 w0 0S 0Аp0P@0D r8 h000 0( R|@00 ӑ (EUEUU@hggUFPTUM$h4M@U(V>SSgUEUUU R0@0 ӑ 0 0CR00PUT0@d0t@0 }P1 00-0 0!00"0S 0P 0 R 0R0B0 41 <1p@1p (K -d>LP MPD H DΟD>8> 0>P (>(N$>$n > > k.>Ο >HD0 ^#PP@ P PPP,K⌽= ,0 LP0b-Pմ]0 a0bM 0R 0LR |M0Lt-0g\-g@MD]  T@ P@ = =0  c= B = <唬<匜<̟Q  P 0 S<  pP Ro L 0P 0P  U0P  Rl ;0 0SP Rt p | X X X ˟^ P+000^PP``0^HKH; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  0P|J0Q `  a0 ` a |:`0P @0S 0 p a 0 g0b 00S0b`0pt0 S P00Sl9` P7 P/ P6 Pl 7 P.  P2*P P-|9R` `P800O T)a0Pɟ000<)0cSsS CS@9@<B8=8!0S 5H0 0CR,8` ^` 0  c< 00 0ȟ0 `0S 0P0 0 8 "P P pr0S7 00C0t'P P P@@ 10@'S7@@ǟ00@007`` P#7/U0 X P @@P}0 S56@0 @@o? &00xF  0y0 PX]0000@ Sl6hƟ 000C00D&00<6P>10@<&S0000@000?&0 0P0R %00( $00@ S 0 00C005 5R00tşp%000d% 0P0, Xş00 y0#P0%005 P P``s4@T0S  @ğ0 ( 0z-00h$0PP@T |4 D3 @ 00`0 0E@s0U3 4 0UxCp@0KS`0VVVVVg V V(^V$VU0f @UUgE$ R0 0 0r,@K1 01 01 0W00 S+  0ApP  K߄p@o0 ^dn@t0^K 1 90 1 0! Q A 1 ! A t0J^KPEh 1g@ K9tT -$K !8!\!t!! @p4@&B¤!!d x ! -VML MPp gp`  OK/m9 $P f@P t0Yz]K PE-KZ/Z9\0 KT0P ᳀ r fP4pEn K!PgB!pF$B! -LMM/NKp/`090 2 f@PK ^^KPEPE2~K`,90x 5 @C fP `1X y9P @00T(Kp@ B""B " -LM@/K8 0 d0C" SD < \ T \ \ \ \ \ \ \ \ \ 4 \ 4 L 0 0 000 dy0 \0\/KMfPHK0gS ,0R((cKp"@#B0"<" -LM;NKe /U80 3 !f@P 0S T`(K'KjKAJAJ ?I  I ) 9 =, r8ğe06 9(K4 0)P0K_Le@P  VQ >K8P)Rğ4$c09 (K02PK8C8sf@K2K T$7K?QSfK<$73S  d ddddccQs #3QppK2KKfK0K c >K2K fKK0K pcp/ 78"8Ÿ09 9  7 FePU' K@ 7S      a a aa$babbK "77 3CS '7 K@!171 K0GWS y;0@l!P6!(K1 0|!BK66[ SXRK&6[ S@K&BK0K RK KPb10S K 0b3Yt) ) 0\(Kp@ B","B ""|"T"l"t"""""""""""""p"#$#H#!Bl#x###### ####p# p-L\Ml@KP PW&:`7P) @@.`X7P @K< /\@K< @ \`p0S.S0 C.SP @0S0 C R000C 㓕)+ TP R0@S0 CX0W0Y0 4K4p 0 , ~P (K$ SMЍ 0-,@,PL(  u Up'' -LM  ZP A!1壟 K .p" 0$#4 'ZP @ 0償]s K p\d 0 DHv#4 ,$vK'' ''' (((4 -L M`P H _PH-_Pp= PD  Y0D0 0r ^0ST00`)2P@ @uiP  q1 z@P HzPtEg CgT@gD0S 0  H ᓜ0;0010S $  ]P Q00X kP ~0-SX0S ?( 0@0 <@ *,08 440 0@ *@K, ὗPp( fP ,H存P H(K4pp,(8(ph(|((( -rMLMpCKP 2Qb`P^20S  WP %20SL IPG KjPB3`K?^* [P2 RDB@PƘ 0Pp20S 00CS00@Ӥ0иI~@aQ0S 00CS00Ӥ0Ἰ4~ PpyTYTN fPI D~0S  @1 1: SsNK@D @D 6P t! KⳣPKz1PtK~P0: S\PP X 1: S C/K %$K4pp UpuxXT\T(((( -qLGM@`PfP`P iP`P!Gp10cQZ1pI aK⛖P 0: S ZJMK@D @D+ !P q>1p0W`/S/00p`.P/&P@ 0S @P :0/S @P:0/S@1l 0S\t  wIKAPZpphSp(MЍ! -0L  U )-0 CR 0R0 S00 -@pL8M`PpNPP sP p MP@$"嗠pp5W&R@K0KP< , K 00 @P g`P,00,0 &@Pp W0S< , 0 0 ``LP \XK -pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPe40[S  5[0Se|st Z`@L0VU D00S8 P $](Kx8H)P)h))XTT4MЍ -0L   U) -LMP`p@sPp p0@0dSAT 0AP\G_Kǧ@P <\W ./P@GKZS)) -@LM `P/ /00 Q03*,  0,, pW00P0 U 00 @ep 0 QP02@0P5 :0HP *0@@,0 PdW p0@ 0-LOM@P& @\@0P00 K.{D10@1P0  :#K0t6pp -LOM@&/\@0P00 SK~.{@10<1P0  :n"Kt6pp -Lp`-P*+@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 SKX( P- ( P- P- P- P- P- P- P- P- + - 0- 40S 0000 0 0;0S000S00 01 )p 0+  (00?0bS fS)0S00 R< 4<̠Č8#Č:K"̌,K$D4, -*K 0%880Sz0 0000 0 0:K P$ Z0`<`:KdK 2)pz0`06PZ@`G0  0KpP T d KP @T`P d p@ d0Kp @T ` y!`Kz*K@FzV@8aAz0SD h8,P 080(x0 0S$o $`@PO dK -dK<K./3[0C3K:K3[dKS3dK -/ R)0S S S"Z  wZ:Kp0S   p ,<4("4!< 03[0C3Ka3[S!@$!Ty0 0000*0S<0 00S 0S 0S8A 000 00 000 00S081 0-0 000 000 0(K)_ p-PPLy@00+`)@P L00040P0 ((@+p' -L@M` PH, D,0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 nP02@0P5 :*0 eP $*0 @@00 PdW p0@ TP3 : 0S 00@ 0@,0qU dP"(K4@ p-LOMP@`#0 >|P0P00 UK+xH10 D1P0 @@ :f@  T  00x@Kpt6Ā 0-LOMP@#uO Px@Kn+xD10@!\0P PP :1@T (0 x@00SK0t6Ā -L@y#000  Phx6G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ,G-M0@ P0@0@0@0@0@0@0@0@0@0@|0@t0x@l0p@408@,00@$0(@`@p@P `(p08!AQ aq$(\,00P 4!81@0  0p^P0Qp nt ^Q nt 'tP@ t ~ 'tPp t 't0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< &<P@ < u8 &<P8 < &<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(KoA 0-PL@ 0#<00#800#400 R00h<$ -pRLPw D@A1>0O `cWP: 4$@1@ T@D SH0 0@H0L@pf.$@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P#@1 0S@D RH0 0@H0L@ \00-PLP %@0@0D@H0L@0l, -RL`? D@A1>?0( @PcXPp: #@0!0@@0D@eh#@0!0@@0D@\@00 @@0D@@H@?X X  Pm#@0!0@@0D@ D00-PLP %@0@0D@0- -LOMP`@rp 0+Pr0 S 0r 0p WKI%H1 s000rP10H1 KQ`0 S0$00DS$0 0!$0D -MLM`p$!PP) 0V0 BNK@D@D 0 PP0 Z ᭺P4 W\  C %@0`p\0~!{!P$$KM  -L0M`PpP) K.0 PB 0S r0"S UD@K $00 KrMP(@Su("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KK*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 Su | w | | | | | | | | y | | 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V` 00FV08 K2+Py40p@P  Zp 8K p4Ah;g0 00lsp 0y (00?0bS fS0S4 0R  0 :K(45<*K 0F880S 0SP\:K P(n 0S<`:K(0 5Z`P0`0*K84pL*KpK pf0`0?P:K8S@p KP@pH K*P T pH K*PHK P|`P l p@p0Kp @ T HK -p `f*K@fV@4af0S 8>P 080(pw0 0S$ 0P04 $`:@P  pK_pKHKnK`F4[0C4K4[pKS:K"r_*KpK{:K8"`VR0S SL- S SG6Z:K <*KuP8*K$"z2Z0*KgP**K @p#:K ZY:K /*K Z Y :K !*K p 4[0C4K4[S* @$' Te0 000090S <L mp` e0 0+0S00S 0S4A 000 00 0P0S00 00S041 0 -0 000 000 0 `(K_ -L@`pP 0A@ -`PL@eP00pPP d0T04@0 T0L0P0 Pu   -LMB^KM`PE@p x0P 0 @@P <00宭PP<4p8@ K8 -L@'P 0@0B -LMBKMH@`H p 0 S񟗹  d d d d d d d d d (  <00S00D00 pS:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000վPU  ?K0CUUUXPxPPE ;-0 80#b=80#I@   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000YPX   _K@PEtpT-xePEP fxc;0 8@d0p@ 8[d0p8P;0p4# 4# 8S 0e4P4 4(KPT. -DpL0`S@P5K 0@S3KXT -L M0`ჀpX 0S 0@P0 'p Ҁ@ d0P0&p@  廹@  b~$K -Ll'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l @ PQ`P`  P 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw  28Wp\Dw  PD8WPaD P"P0L7 )0Kl' l' l7 l  @0S1 `B `>ll l  @0S1&*l'@ @0S 18#X `!0 8#X`l7@  PQ`P`  P 1P` 0 P` ZH l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l@  PQ`P`  P 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 0㴡0 0d夡P`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L Q Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKtPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKVP6pKpw @DT0p`@` \0 0R\0 ` xdK@P <'h1 R 0`R\0Sh  xdK.PK0p `0 \0S xdK!P0`0 x'0@0h7 NUp 00hw PY #@P 0KP DVh(KL@\@ -DpL0`S@P|? 0@Sz?XTQRP000S0 -LS`Pm @ 0S\00R001S @ 7 T0p@ 0\ T0Wp@d 000XJT00S <0@@ \ 0 0l<x6TXT -LMGPPX 00z`10>CNKTa@D @D 0P3KHH h p* T0S \PT3 4`K XpxHK0D@K0@3[<3K03K\ Ti  (0!"(80S yT00 @3[P3<8ӜP@<0X0P(K  0- L@ ?pP  0p  0p  j>p DT0$S @T@^<S-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (Kh0x0 -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S\0 0 0-< LP@ P0 -0L.S@P#P*QR00)uP00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5@ I$`VI"0I845@A$  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 eI00<110 0`pJ W  0Vd9#Zp `p X 04085# <0 @T'I00 (KPTS00 -?@p##pWL$MX< 0O?   BE!5;t l@H"0 01`V#U!42T100  8 4   0S8 4  0$T 18K1 8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ < 30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 ` (K000001 p-H<`LMP@1Px0Sx -LMP@ R@00 00a -LM@J0pMЍL- 800Ms00Ѝ p-(LM"X`  p@xx -LM   PG@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LM`PV@7 0pA("S*pG"0 0(Q% 00{P  000 `0 P*@` Q$0@0    ? - 2L F0S F0#S 50 !S0S0` 0C# @U  000PP P.@` T0L 00P00 R p LX0 Q dp  PpWU ,0 dS(K t@ 1 0-@LMP$0 (0P0CP<0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@h 0-LM R00 0P0@pm.00C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  `p@ E0S E07SE#00PE@ U p -00 0 SK 1 -LJKM@DM@D`*p  W@  0p000 0b0QZKPEPE EEp@ E0S E07S {E#0 0 PtE @3 K 0-LM 0PQ@^E"0 0P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 000x p-LM` 0PP P&P@6P0 `0`x -QLM@*P T@ -L$M`p@0 D 1! /< +P +L%@,ZP@& + =%p@ 8PK  00 000 Z00000 ,1080 4@ "%pP,D@Yt2D0S. a< 0p P*%@D?00tD0S<`l d0p P*8$@tD?00@ R00(KP\01wd @1&L1 -LpM`10@W,0   @KS@PK ὚"p@K@ % Zd`P060#0P@U@K5 ᠚  ᜚   4 WgPP8 $ P@ Lg@P8 00S4 KP 4 R ;;S 7g@P"0 孋<P 4l !gQ@  0 8K̜@PVR m$@(K1P8&11 .RMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@厜PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  @P<<@ Q 0 B00<@  pX00V00S< < R9 P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K2 -aMLM20$0 pP" !p` ]KPE[NK@D +h 0K 0 E 5 U\e !pT9)cKYPXGk06: S  S [NK@D+A K@@P[NK@Dp1l!T 0K@@X@9@UTSaD[NK@DP!`P@0S m K0UCB!`PX% !n/K2!PX[KA(( K2SPX [KhA77\00S $0 S4ޞ K01wd &t2|24edA222 2 -LM  K K0K עP K 0-LM@P PP0.S 0a C00C0  SRQ88 -LM  K K0K 埢P K -0LM0`p  $0 PPK&>PUOK ` SK`,KK`J✉.*P_KY52( $0 SM K22 -LM@Pp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`@T@DP82R8 -PLMb2 pP@0 %Sp{0BS| 2S- +SI .SI %Sm3S >S7iSb DSp dS nS rS 0 &`*`( UcU V*dOd0000P V* D0 V* #0000c00 0 RPE PC0 U0ppP;0PUU U00S!0S 00S Q0 PP U V{*PP Vs*0  BP>10CB>A#>A0BPE0Sj<@@f  KPW*(K3f\X8T8 p-L M`0`@K$ KKK`KMsPP$+(0$000Kp訠 - 0LM: rP訠 -(0LM KrP K訠 p-ML Mh20@0 \2`(PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+A.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S ksP+AKIK@A @`A d HvPPT00S +:ϞP 0S` T00S <0P[u 0 S(hKp3 383D3<3 -,"L$Ÿ M RP`@ 0 0 Q 10m Q 0 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP `* -LDM\p, 0 \0QD0XSxS@ P<r: 000D4 W @`  Q#00ӑ iPdd#d3e/0T02@0 pW: @Q q "000DTpG. v00A SsԢ` P@ lj Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SK/Q!D00A S00V0S< @ 7j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2<@0(^PK2 1P<@(0/@P00 }PT@ dK0 wd0S@ <@00</00@ ,0 S,(KPT3S3x3333h3 -L M 0噓[3 U -LM0 卓O U84 -0LMP`0pK00KP i 0 ##SVPU`0.T00S` U @ TU 0K (Kp4 -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >@PP19P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K 7;/00 ,0 Sę(K4|4d4 -QLM@< P@0 Rn;0 0~P8 < e yꕘ$*`@ P@&@0P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ P 800 R  0 R04 <00Q 4 8 (K%%?* M0ЍU --LM0 0 K..(* - LM0 K  p K -L M@P4K0`px $@ PPP00P0#S :00  $0 S̘ K44 -L`M\,  0  \ |K M! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ @|KPd!1[PPpW00P0#Sv 0S ,0KR*:00ZK .0R:90a @S@900 9/00 ,0 S(K`4 0-LM 0@0 @PK0 `8MЍMЍMЍ p-L M@P`꺁P0fC @\000C S 0 tKp -4L,M TK@KT0 P@ ]qPle/>d4@D0 D D R*0S0 |S :S00$m  $@m: @lP#X0@0X0H K%mpH0C<HPK (0@mH0 00@mH0 ,0@mH0@D K40smPDl  @PlpH0 8#(3 H K0@lp2B, 00H0 800H K7@lp8 40H 2ad.d>`.`>n@PL.L> 0b@P=l 0FP l 0?PlAl l R0h0 l=K1 -PlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ t7 t7 7 7 l7 `7 t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` JPH  t\00S2 l^+; NB1`p;K @@ P`tT p  0"l @bT ; 1 KDbP@p` @PV ph0S :  dtP00\00S@ P p^  P:lp A< 8 t0l80 <  0 :O8`^ p@ UA 9 0 0p`1P8 L p 1!Pd8Qd)1A 0 dI 0HD @b 00@ 0@`PDPD  0< l  0P 8 D8\S' p8 `p0 0  H@$ 0 0`Pe>8P 8 80@ Z 7@ 7K 0ᬶPlʄ K  0ᚷP 0x0S <l O`pꌀK4 l0?Q0Sl t R00Ӭ61 R 6 0!PlpL < @H P 0N 0 0S000 0@P=P ,6 t Y' 0R 0@P@P<l  0P HXl 00 l 00x9S 000`@Pd0S|PL0  X\00CN@6@cxPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R L嗹0PL0  T@P TԷT@ Tx剹PT  FpP \\ }pP d@^00S X 46S 40 S `P` \ R0 016 0`` 00 0cS0C` S`0` P`UTwPT ^ `QopPW h R T&PT  PT H T L  PL ? l0p0Cl0 t t^&ʐQQ" ߸pP- t R TPl0<0 L pHl P H100<00l0 T VLPL  ZLLH@ P L L ?@P L0  ! PTPT巶L`᣷@P 0SPT᪶P0@ \ U00S Y9T* V1@ V00S YT0S0SUTķPT ~P @:T @U9T0{900t'5 5P]?aCoc?`(?yPD?zlz?$@@@?@ t0@RC T  *PT w PL\  PL l P P  PP c L  PL \ @@ nHPTu0@T@T0  \0SP ,t UPPT = P TMPT 4 P  H X100l00l0 0x9S 000x0S >L\ P^ ^6L4T2 0lS00 H H(K -LMp3DD*MA Q00  A0S 00Ѝ -LM4 0 -[à`8  @4pKP4G G G dG G G G G G G G G G G G |G 0#2>;?C0C,  4K2 #4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LMp8 Q04 Q@0 0Aό  D0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  0<04 80 Z\0 04  @\0(KPT -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  ᢡP040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KPT -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KPT -L MP< @0 Q`40(@08 4  VI@ 000 0Aό@ @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0@ @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0@ @0@\00 08 00 帞< YP  4^0 8Y@ 40aO0(KPT -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  >R(00  p S$0 0    0 /Y:<`V Ph@ 0R0@ UxP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 T0AϠX0d  `Xl0l t P0tXpl|\ Vl d00 V`0d0 ],@P@ Wd00  W `0<U, d0P00@T d T 0  @Dp U  VD vd 00 000s03_V0S  W w$, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S `[A?E0CS 0d   6<>  X00S  0td  &`ZlRL  x\HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 D\ \0S  \02  d0D0RH0S `0 dKL 0>LQHP ׃H L0SH0S\ dKL 0>P`dPKL D T 0 2J@P 0 * L``%PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\P,HP      0    ^*<`V @Pi 0R0@ UɛP @PE Tp@ d ` Xp \@ H@ T P  5P@ P d0D0 < 0 0D 80 0 0D 40 0 0D0 0  T04Y80<@x0 d0|  |pYs00AϠ0 d@;d0 x'h P0d`Yx nhP  Wh 0 W`0,@UP@ Z0  Z `0``ş`%U00 P@T d T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xd |0 pNhL 0S y\H@Q H0S dKL 01@PL00L0  ^H0Sj \Pd0 D\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP H L0SH0S\@ adKL 0PPL D T0dK H@P0 dK@ LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\P>HP;@9 L0 SL0S(KeEPTR* M0-LM0 0 0@ P~K0 -LMp`@ P@D`@0c%T -L M K** 0-LM 0KK Ɯ0PS} } } } } } } } @  0$0%K@%"00@@ AK0A1 xB 02 #4xB 024=> 0&]@-1@d4xB 02d @-M+Ѝ@4=> 08M Ѝ5 -LM K> K -L MK  K6P K -L MK  K)P K -QLM@ 0K00#0  60p03T0S00#0K MЍT BBM*A 0-LM 0@P᪦P d0圦P8p8 (0EP88C -LM 0P`Pp h0(P X0ᶿ@ <0尿 0wpC= -LMp `P~P@P 0S@W P }P @TP ~@ -LM 0 0P@9P4M<P81#8181:P02410!0 < 8#" Ѝ*\\* -R00LM?@ D $R D R@00$0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0m 0m 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S #0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KPT -RQ3LM@`P :Q :P*n#W000@@00'@$ 0,` 0(p S,0K80 040 0p  0 R r 1S018K80`0S V 0` @ KXT p-0L$M0PQ`0 AEP P<@Kih 0#20000 Q0 0@0 0 SQKpH5 5 -LMT0@K`P$0 p> $ 0R 3 K,5 -MLM@lK, l p`PP@ VKA p ;$U eXW 0ZlQ )K ᱯV U PUo0 ONK@D@DV  U zpPʜ"@ "W@lKV ,0 S ΀(K85 0-@ MPL 00K0 -- LM 0  -PLM\ p` PP@yU  0(0$  y UwMЍP -LM@P4p h h h | | | h h h h h h | h h h | | | h h h h h h | | d R0 0D<4N  "0 0 5\5t5]*Y*AS*- 0-Y+ ̌!0M0@  0ЍWW9*QQ5* --LM0  0 KTZZ#* -PLM `h!00 0-LMPK@RlP@  R 0S0U Q@P P4l!PK0 -L M0 y K* -L M@0 0 S00@ (0 0$0 00K 0 00 , h d0 R r 1S018 K $0@0S T KXTDT\T||* -R00L MH /@ D H$Q D R@002! 0< 8 0(3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 0a]0   03`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w` !000Z W070cH0PS\O4@T# 8 V<U < 0R8@T00 P00S !"<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(KPT=*=*<<*UU*::*: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ 0-LM@Pp Pp6Ep Tl = U` p@ T888ؠ_66***0@-RM@P \4, 0L 0lRQ@PЍ0M3P3( 8 H X h h | | | | | | | ȗ З   A 10=009005001001,0010014#001001Hp0h00\00L00 <00 ,0(00L 0PЍS V(AM 0-LM@P87P(008/P0086N6NQM R P000SЍMЍ 0-PLMP@   01S S  R 0^0T0 0 ^  RR11:008-PM Ѝf.0S1 P P10:00Ѝ -PLM QoT0 0 PM 0s3Ѝ -LM0S U 0P ( 0 $ >0S@ !88S@ ::S : T00@ 0lA?0 B<R<00  -LM@\`0+Q`L RL \P %VP?0  P 0S 0S0 [ 0S0 X T00&0 P|3Rp1p!0S?0\:\0l) P6;@ S:0VP0 -LMPP`&RZ 0S00S)0 R  d 0ypD pB P@ @@pT:6SR 0S00Sp@"~T00#  00S d 0Fp00 p00 P @pT X1:00 -LM`P4 80  GP00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T P804 q ZU1e@:0 10(K 0-LM@PPU@8//@* -2LIM0TK(0 `@P:KPP50z WeV? j 0Pұ@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\I/3@P*1 0R& 0R" R]3"" ( Y5PP @1R <1R  81RD3 pFQK`-5P93 (0 Sz$K&,6 6 0-LM@HHA/0PP PA/c@P AP@8TPM ЍWM 0LS\\ 񟗕t  , L \Q0000aQ@ 7Q 0Q'*$QH -Q00 QK@MQ EQE7\Q =rQ fQ, nQ bQ8tQ" 3 03:vQ0G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000 Ѝ -LM0p`@(K(0  0DPD $ , D @@00 PU( K0-P@Pg K -0LR M p`C@-K4K4  C  0P , , T-0[505@ T-0[505@T00ĕPU-K4 K0PT-0[505@T00ĕg(K@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T l8@K04K 40 %`# /P 00 00C S`L  <` P`@ * 0K |00`0S>0S T "00hL0U@1:  u@PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y E 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  Su@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 *u@Pc @0f D0!PL `< H0X PH L0U:@  @ u@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  t@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ t@Pq [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -R00LM?`p$RW00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``n0 Z 00D S t 000 W070 cRQ00\00 R00S,, }"  @Q00 SlW QE (KPTG-1M0 `p00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R`VC  R Q;r9 06 0mC10S%@  س \)*0Š$\"*0S R<8\0SP R<84 Z ,< $8 #$,, ЍPT -LMKyP K:*6* -QLMP`pPp`p00 Բ략@ᴱW1A* -L M& K$$* *@-\QM@  @Q*Q?Q [Q#Q p 3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 \Q@S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00ЍPT p-LMP`@00 S  e0x -LM@pP`T0PEU0 @U 00g0 -LMp@` qPP@  @x`PPo` -LM8 `8#1!0#  "@0 1K @p<0 @ D V\Q  @Q*Q?Q [Q#Q q |000 <0 Q00S@0 Q00S&20# Q00S   0A QSq 000 \Q@ T4@D"p#*p01K gD0pcP U1K @ HX HQ T:8\000 SP1pK0Gg@0S i(KPT<*bb8*4* M0-LM0 0 0@ PnK0$MЍ -LM K&P Kwt@MЍMЍMЍ -LM K  Kvt -0-L MP0U0 @0 0 0Q a0)0 |P@T( ,K K$0K$ @, @wP 000(   K0X4X8N**==*aa**pM L0000 P40 P000ЍPTSS0 S0M00Ѝ\ -@LM $$ R*00 C R00T0SQ00T0S  @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ p-LM0@S`x  >pPP x` Px p-LM0@S`P 0S0?0 P  0 1 x -LM` R*P*0S0]SY`pPhP0Sp@T U?N 0-LM @R#3+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 8 8 -LM@ 0SP* P &  P ^000 `0 00Vp(@@ oP> 0A0 uoP00Q0 1#"0"Q00g 0Q P V001LB"A2A` B,0V 0000@0@00 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#L+00-S]SE R*q Ɵ000ujP0S p@ T #0 000000Pp 勽@P@ PW @  @  g`00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =X 0000 R!#+ R *0S*0=S0]S00/k pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  [0Sb 0 0h@Cp0 t 000 &P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o-}$<6D6PT{} - LM@0 8 R ?U pe +U*U`*$UM (U.U\^U7 [Ud \Ud{Uv |U|HR!#+0D  D 0DP U 1  Y R*0)S ) U 1H  H R*0)S T   : (00(0 ,00,0D , (00(0 000006 .00P '  "R!#+0<Q0 >Q&  R*000C S ~ R*P*0E0?US{U0S*000C S0Q0 a+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gm " B ad   `R*0,S00000C S\  VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0V 4 0   i04 aC0" 40 t4  a  i (Ko0 R (K -0LxMS` 倀0  PPa *).P㧷@P % 00 0 iP  ᪴ 0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P öP<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0KJ0S p(KEe -LM l0R @T T0R000P{PxPu<PrhoeE -PLM 0@ 0 @ K0,K0 T P0@,0 (@ ,K --LM0 0 -H0LM@`P4 0EcT Զ l U33_* -(LM"x H!X` P  h᩷ HU -LM,K>2 2R (0 Sa ,0S]n|2t" 890h2 \ (084"#H<208#Xe@ 2@K r X`iV@ T S XZ!A 0S1h1 " 㘵P"ۻ8K8Kd0@0   S9001Q1 0@ !0.00 !@Q0 \ ( <@ 30B320 0 R0#@$@T0@@KhQ/uxylnprtP;QvQ -L8M\$ p`<@ ^P @ PU@V@K 02R R @ RV@K 2 )` 2J}WP  $0 S i KQQP]xd;X;)*PP%*;;!**(MЍ -L M0 b K p-0LDM0PQ`0 㷴P P\@KUh 0#20000@Q0 00" 0 ShKp>= -LMT0@K`P$0 pM Ȗ$ 0R h K= -MLM@lK, l p`.P@ VKA?p c;$U eXW 0SQ Q)K ᇖV U PUo0 ONK@D@DV  U WbpP @ , W@lKV ,0 S @h(K> 0-@ MPL 00K0jjJ*F*A*=* -L MhpPA 0S> ,K wgP6,0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `P0P00(@$K$>p0>\H>d>> --LM00  K 0-@0LM@P ,,`T   8h U-p0M0S 0 CR 0R0 SЍЍ00ЍXT -@QL@Mp `żPP @xqP 0(K ;D(0S 0 0 0  K>>t -0LM0 Q0  0S0S $S02SP  K0 00 0 S g K>p@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :Ѝp? -BML,M$ğ@ PK,@ TK @<T0$S0@2SaY bY0*K0 HPH#K 0$S000C S000C S0$S@0J0S0ʠ*K0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10DK0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ r@TTKpP `0# #$# 0PUK 0!1:K0<@K K B K(@@TQNK00BMK(@D@DdK-??H> 0-LM@P 00彩$ =0 0P8  p-0LM0R`0 @Pc00,K㺷T0T00@ ᷹,K  0 SeKp@> -@LM Ӭ -L$M>PK`p  @P 0 @P㴷 0 S SeK> -0LM0K0 % K0K0  c0`t0ʲl 00PS?@08 PS 0 SeK @@B`? p-0LDMY`K =0P &PZ@WT @P  00=G 0 S dKp?:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM @H0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  P̲$H xh@HM Ѝ_@-@M0 0#@\LTЍ55b* 0-LMP@ $Kڴ E0R$@ 0 0 004003200 $K0 KP0K0\8889*[[5*QM  ;ЍKii**99&*RM 0S0S0  R00ЍEE*M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍԭ -LM(@P[00ح -LM0@P \k\Pح_dP -LMC0SP S <P  ㋴P0t00CS00 Ӥ0; R r  r 0R#R S3 k0@S0 d0@S0\@2b P  㣴P  r 000 00T 㓴P  r 000 00 0] ぴP  r 000 00 qP  r 000 00 aP  r 000 00\ QP  r 000 00  AP  r 000 0 0 1P =Q ѳP@pWyx00#S #W0 S SHP@0 S0P0  0 حPTԭ( ;pP8xPP6P 0-LMP塳P @P8yy*H0M0S 00CS0Ѝ:Ѝ00ЍXT0M0CS 0Ѝ:00Ѝ 0-\0LM0@Sb00CS00PӤ0q:P00SY8XTMЍ`8@-0@0@$0M00 00000Ѝ#EgvT2ܺ -LDM@ lKⅰ pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P%L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -LMP`1>?0@@N10@j@Rp0@P:Z @  `phP[@P@pG?W W   oۭ -L(M< 1>?0@0c@ S80 D ,T`p@P  @00#:k0cS:UV@ 0—`p -LpMoP0p U<0  }P3⭦P@ + ̞P$>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@y0S@ Ss SV x < R =PK{<~0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$zP( 800C 80 zP80080 H:D0 08@KzP 800(S P K0|PL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 j VH D 891H C 3@ P] 0H D X,ʁxP)X@T T8HK؄1 PhX0\ʤHHK1 X 0eA H D X0s`(X@0##HK X0f @TW  8HK1 H D 0 MSl p h d (8D0 0H0 lQ <}p}h}l~}d|}꘧CbpH@K0p` Õ@PV!H@ DP D056CD0 87HK1 豕H D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 联H D DbB V60␦j0p0 H@K0` @PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0/zPl Y d h l0}Pp S l@  ! ƪHK0 K40K-}P< D L~Ph ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ hL~Ph  <}PP <| 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!:(S-]M0P P0ЍM00P  R*Ѝ p-LM @R 0`Q0PSe`V*a000SP 01PSU0UP00x -LMPq0  |   x00  x%`pHAP P, 0  0S 0S0!@V`P 00P 0 0 \PP  pR 0S '0SpZ 0p =  DPP  `R 0S &0S`ZZ`0 0 0l 0  R:0 0F@0l@ഞAP<  0 0l : 001  0 0S00 c0@00ᗞ`P 0 #P ᣛ0 0a0 @0A 0  01Sc @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:5p/0@@0BNK@D@D+P 0K@A (}P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A , P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L++VP  0K@@@ $ P0Sm B^KPEPE+=Pb@0PY 0VW 0p@ ! ( = 0  d0S00sp0/ 00 10.S0.S%@ 8T*0 S0 T:p @0vP  D8` pP (P 0@   ppp ,0 SfQ(K\{w?P -LM:K M00 K~S4 G 0 D K@K@0^@`P.K0A@ Q p 0S /S000S P$P  9K@@ևP 0FV 0`SR*0S0>K0C0C K00nK`F`FKP8`?WPu [W *W0u@!TP0S ]HP!TpPEr!T#3@ 0p@[W:0:S7P:1P1 0]S.0e4c 0^^  R*0S `PU  Ÿ0l10 0p[W@0 0 ]W 000-S 0]S dŸ 00@0]Sp 08< 0P` 0< 0 *K 08 <V 0 V1R 10pWp1p(K0S KLL K.KK(@AK@A4 0 PO 0 P < SEK:K4 00 > P;Ipi - @൛`P0 AP 000000P  0  00 00@QP 0 D0m (K脴[!(S:-]?**PP -MLM0@{S0}S0Sv {>Pn >K0C0C@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIIB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -LMt`,KPp@ PN 0 000 <Q 0p> R;q9 r7 10aR3 K @ 0\`.KS   0R\S0@0Q09 B0LP*0 S L00K, K @ KPMЍMЍp 0 M00ЍPTp 0 M00ЍPT P PMЍp 0 M00 ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00ЍPTp 0 M00DЍPTMPЍMЍM @ЍM ЍM QA 0SbЍG- Mp,0`SPP0`00b@070 S:!^ ^5*.000S0*.\ \\00S$*\00Q*0`0SZ0Y0? 04030#Q0#S 0Z RYh ЍM  R P*0SPlЍ0M p 0 0 00 P000ӑЍPTS -SL,M D H0 8 <0 @0  H\H H @ < @ @00@0 @0S<  Dp BP \e H0J00 =0P04 / QN%0C0L0 .S+ \ST P@PTPL `0aS0S0S40l.SP0? 4`0 R0S4 l <0Y:Q8 PL*8!A4 =R#= B0,D",0 a = R @0PS 3p5 5@0 5 .X \XX 80R*X0gSXpB 0A>S\ < 00pXs80W:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ0M*S0.S S ЍЍ-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ0MЍ0 <8MЍ <M 0Ѝ <0 Ġ 8M0Ѝ -RLM$ 00 0 -LM@@OT p-LM PR @T@? <0S9$0``PP/-+vP RP@@x -LM$0`pPPᡗP@ 0(P004$0@L0000H0 Lw 0-LM @<Q *P00?0 0 PPP Pܔ P8 -LpM$s`Pc`LP0pKHp @  0 P  0 PP 0PC  0 P }00l Y 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP(R``PP K#PP4 0R, 0R0 0R P00lPW@/ @K -LM0@R`p ( wHPPPP PP0P0 0p 0^10 -L4M\ P"P \ Rt0400 0x\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  00404L ZH $000S/S$0L 0/  4 <0sD0 D 0 D Z0 P  pi0 8 T P $0  0.S0S 040. S  ]@P Q&: pvP BT`j0 04$0 :0 $02` W $0 04  80 8 0piD0<00000 S$0*D0  $$0 :0 $0 ?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 4_ 0 0%@0Sڰ$0B8RS@  B@ 00  ST00@ @P T@  P `PUfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 01PP  $$0 :0 $0P0SX R00 04 0P SR0(KoH000  #8 R 0(KH -pQ00 W@@LMTP 50 0:`/@$0 3D T 0 T-P W$0p:$0<0pS00/S $0` 9 X~@P.YP   \{ 0-LM@PꅞUP10@S8 -LM`pV $0*0Q40#Q4 0C8S 0P$0/P4֡ 04ơ0 $04SFQ $@ 4 0R 4 P n0004P   :$0a000S  0BP 4 04  000 R P$0  `00Q0`V] <0S($0@P$0`( L$  P^/JP P0S @؝P >^(P04 00 :4S S 0{P$0 P4֡ 04ơ0 $0040$  0R/S@/00(  L^ P*<0s%``60$ `<0S$0$B4 $0  9P @ @   L0P $0P:$00`S004P`\{H -0L M@p 04 0|(ePP4P v 4P p40$@4 0$0  P @P_ PW 0`<0(P00F @P@ L000<0$  0P $W``Vp00`@0` 0@  ATWY J` ]P `0 $$0dP$00$0Y e  `^\040 4(K\{ p-LMXP0@S$0` 0F0S$0S$<xh.XTMЍ -LpMKp`P'0: S P00( P P0K80@000P P 0@p$`0 @``0@PK 0-LM@pP  00R00S P 00PP 0K2  u8 0-LMp@P PP 8-SM " 0\0  0\0 Ѝ -LM`Pp@P PP@@ PP@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00  00@ @p@0TP< P40Z* @ p8 0R㖃' (R0B▃*8 1<0P  <0d{ d p<0 eu <0op00S 00  00L8 @0B▃*p P 00S 00  009p@T/< Pf 00S 00   00  fH  0TP<0P4 00  00Pf0hpgS08S㖉) c00 0j PefQ!Q 00 aWL <0$U B e8 (0 R (K -0LM`P0p R p  SP   @!R  000lRJ0 0  0  00@ 0-LM8P0@S$'K0S$#K0XT&&*LL|*oow*G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:ЍP -`LM@pPUq ("000L=QN P| UC|yyyPzT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-T{T{zz0000r 0  PR=R  r 0  PRTV*0SU `PTP * p-LM`PPp@0S@ PT  0RxxddX* 0-LM@P PU0. @ ꃙ@P0/S P /U l0@P  Q0r/S0Pa U:@?00@ j008$* * -?0$ LM0@S`0Slp0S3w00yxPZ 040 $@ ʇ84$ph -?0$ LM0@S`0Slp0Sx00yPZ 040 Ɨ$@ ♇LH8ph(MЍ))﫫*0 M!Ѝ -LM@R$  ,  `70A XK00C 1 儠K─K0 h!0!S @PpP P "  ! 00P RP L00L0 60[S0 60K Q Q , ՗L0 0, L0 Ηx00x0 00 0 \3 K0  K K ,K  K K K K KTV `A p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K <P  0[ S S00~L0   , kXP  }pi0ST!X0S K 㑩K ㍩K ㉩K ㅩK どK }K yK uK q1S Z1S QMT4P@!TU!R #10 qQ P@p ,0 S(TB(K~PTSSD8QM 0ЍLP0M00ӑЍSP0M00ӑЍS 0-0L0M0P0 @ DK<00<0 D KQ Q QT L;@00 0 SAK0t,t,t,LU* -LM`P @0S 3pP PUP =P -LM 0PTd8 0-LMPP =00@夊@@堊 @@8MЍd8 -L M0`SPPo>P 0K4K=@P 4 R 0#S S 00S# S0B40 4 P0d40 4◍PPk 4 40@P@@0 S SPP h@pPP  @00S ?R0Sp 0SȌP PW@Pp)+ S S@" 0@1U r>P@h @00000c0P@Lx@P p@T 0S0 0 (KX_x^ -LMV0Pd8` 0-LM0@SP$$=B> 00 08X_MЍd8 *((*****##*''* *$MЍ --LM0 0  K p-`0LM@`PL H9T  ,,, L xh9 Uwﰨ*MMﬨ* p-0LM0PS:0@0S @T00S-Qx0 d0 0SX!m< `K pP0S Bu KpXTSl -L M@ 0< rSwS 0 S8 eS0S 00 , ,P 4K㬕P 20SܕpP P A10Sӕ40,m1Q@0S01@T@ P0rS$0KAP p zp    qpb<0  ! }p0S@ $0K@wT@@aT@@$ K0,0,0P0Slqh, 000, S Dj8 0eS 2p  , $KXTSlTh` -0LM 1 -BML M20PP ,0 T$ 0S /㉔PP0 L4 04 J\oX2@P@˔00 c]0  ) 0| cBKJJLT `0SPa P ᰔ0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$BNK@D@D`PL$R 00S00 ,0 S,>(Kx\{YZ` Y 0M ЍA1 --0LM00  00  0  0S10 c]u 00 00 0  0S0 0 S > KY --0LM00  00  0  0S10 c]> 0000 0  0S0 00 d 0 S d> KY --0LM00  00  0  0S10 c] 0000 0  0S000 + 0 S+> K1Y! !S - PLMP@0$K;pP3  㖻`P- R $00R @00"@@P 8#$0 <0$0 v q 40P$0,0@,0$0(0 0 0@K< 0-LM,@0PS0@S@8XT -LMPQ`PPdp0S0 R r A0t03U0SQ0@S @XTRM 0S0 0A R RЍ!!殮*;*;""* -LaM ``0 pP@P@T iA \00 c 1   ^@P(K -L MDCDß`8 < 4 =@ D0 BPpfዒp0@P0H0 0 * ሒP"zP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sm <0:Si  4dzO @ X B R00S 10S <0:S 0|!S 00<00-0BS QP1 R408!,1 10S410S000S <0:S0 S 0000  B < 0:S:?0S 4p0 L d00S <0:S\H0? D R0 S(KSSSXZtZSx8ZZ -LMR0 4 80 m E0S5  0 s 50S GP -R d50S+RL-R+R0S858%00,% u0< 0S %00S`04V4$P4u0D @40 0@d0d0@t@0|$`0[40lA@-QPU+P'<44,$Q0 4 `@  Pu` @t  40[0 e0b#0000003pw #0s`U l-U0SL0S@H3 t0  4010 g0b00`0"8Q# 204 1R -Q 00:Q ᘐP48 08p`N\rP@`:V@ -V0S{P-V0Sw 0S!00010S 0:S1`?`e8 0R0WV0S" 0;S0Sh!000S4010d1 X1R0248 0`$!1 ;0:S 0S4 000/000S@0:S 000S04 100 0S0  0:SMp0`0:S:`?`(D 80  `(KSS|8Lx8SSSSZS4Z -L Mm K -L Mb K -L M 0W K -LM@P 600p p-LpM`@T 7 lK>PP D @0  0: S WO0 0 _7 P KppL_ -AMLMt3B~KpG0`c,0 pGIJP3P @P <9PPC, P 0#S    P@ iP  @c2PŸ P 1 (0DT` P 1 04S|0 P 0#S    P @ @@P 1 0DT| P 1 04St + } 4 Q@08P'P0  P0  ߎP0  ՎPh0 ͎PP< d ^@T4 ,0 SD9(Ktppx^\nZZ^8<Z 0-LM@P 垎P8PP8t 0-LM@P 凎P8PP8t -80LM0SP P pt0@-PM@P0 0 ^ 0\^0 P0SS00@0ASЍ0 MЍ__<*vv8* p- 1L MP8K8 7 K$ K0 0 Ջѵp` P $K ʋ$ $Kŋ0 8KmP(K@  `$K㭋v(KpZ1`M0Ѝ7*7*TTݠ*kk٠*ՠ*??Ѡ*͠* -Q0L M4 0R004 000 040`0S+ Pp @⧍P 㕒"0S ꜍P pt0 2"0S Z0 00 X0 00PU0K3`P(KZ[ -LMP ׃@P` |` ᨀ,pP 0Rp„S0C \0 ^00[@-@MP 0SS 00B SЍ -QLM ,0 (@ 0 0 @ 0$0 0 ,KK -LMP0A Q@"` p0 0 B0&&P00R00S 0/S9SV00 V0S` 0-LMPPhdEAd`88 -LM`Ap  !PPP0U`VP -SLMp8  +; ; ; ě7q 0000 00 r ˟00088 ]8 %Q 8 P  ]P8080 %0AUS갰\\\\\\\\\\\\\\\\\\\\\\\\\\\\Ȱx\\\\ذ\\,\t$\\\\\\\@@\t\\p P\H\D\P4\00 Q00  dUPaU ]0[ɟ (UU0p0#UO0\0UI0H0UC040U=0 0 07 01 0 -P0 U&4P (1@0` P A P0 40 4PUU P 00 0'U4P ȟ0h@0` P 8@ P0 40 4P U U P 00 000 ` 0K4Kc0jP 40d 00R0K  0[P 00U 0K0U0K 0U0K 6>P 00C0000% 0K;00K 0(P 00C000U$`@~0 ( P0 SrP@n  Pf0 Sc S 0000 0 [0K=0E U0K4K' P0K0PJ G0K4K 0P@ 4c000K4K "0 000 000C S0K4K 50 &0K4K4P  40ğv>C 0C 000z `0Kc0P i0@h P P P0 U4K($0P 400 0{0 0 q ß000 GQ0 +Q7 -Q4UQ ZQ  0 MS0 00 TR00  SB @4KT#00 @P 04K00#@P 0 00 <00L CA0C0  RS000 0 P4 000L Q 0 4@ R:\ 0 4 R@R Rd㮂;P4  U 0 00 r 0008Q1 r 11QDRd0 0v>C 0C0!000x1@S 0vn ` drPlp3 0SX10 2) 00C0040 0!4 004 0R0 0% PF@{F@@@@e;P0000 c 0 S 1X0 00(KlPTS\\\\]n'SS0VL\`\t\M0Ѝ隆* --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 0  PKⳀ0YnKⳀSKl0NFK|E E t d5 w@PAP@$ 0RF4 K^MЍP 0MЍSMЍ -LM$0!  0-LM$@P}P}$}P}8h| p-LM$`4PK@.0(<;P ;P800000S4KKp(_ -L@M$@ 0PR/ 0`00dpKH` 8` 0LK; P 4Kc#40L0 d` `0 Pd@K0LKd0 `00S$K -LM`Z$P@K 0;P |00 @;pP@ y;pu$K -LwM 2 0(, 2 KP||?`QBPP`XP?P|`E@1@! 0$P@ 0@rK"~K 0 oK . ء ԑ g;KP 100@ Px|?oK ᓅ 10S~K | |` ,0 S3(KP_ US<_ -0LbM0K 0 0p" @!@KLp^K`pP|00 PNK0 0 ^0 K@Z 0 S2KS_ -LM   K 0K 6p K 0-L MP@<P  r>P 6<P  1<P , 0PK0$ -LMp`@P P U@P -LMP`@<P< pWW0S1T0S S+W) P-~P@>P `P0P0UV @#3`:0S!{PPp_ UGϠH*MP |xtplhd`\ X TPLHD@Ѝ_____`0`\`|````aga4a++* -LpMK@P`  : SH  l0S4   Kaab b -LMP: P -LM@P PzPzPzhz -L$M@ Q< D0 R 0 @݆0 @0pB@@0iPI40 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  ὆P 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@4 T: }PH 8 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  rPn 0/SSj @  u0 bpcZ_  ti pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@40Tj:HP00@P8 8 <@uy(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN )0 @Tp  pG DKP (0 @Pp T0I0 S D @ @e0DK as#. 0| t0p h0d @P00p40 40Snv@P(K @P 00 HPd   @P 0@0  YP  0 7P 0  P @  ᑏP x0 : P3 Tp K,P2p@p0P#0,S \S S 0 ,S@Up ==Pp 0PP ptu P@T:p tE> 0p0 P= dp KP8vPPHp: R \R R 0 S S S0 S S  00 R  0L@psst-)pP ,0 S`*(Klacd,d4dXdtddddddee exDeTa 0-LM@PP@ <0 @80M ЍS@-@M0S :S 0^S^@S :RS:SS0@S0Ѝ0MS  0\ :S|S S S 0R:SS  |SЍ 0-LMP# P800S 0XSxS@a A00A  RA0A\ W0AR70AS4$@8 -LM= `PduP, @d p P0 PddvP  @0:SS`PPd vP@T rE@ -LMp= CPPduP `d@ k^S0S:Sh 00PU\S0P R:R\ 00B0S 0R00CP  0/S7S7TRP# ER( BR CR)$NR RR FR"fR cR eR bRrR tR nR 00 0 00:000UP@T@fd}uP `d@0:SS00T@f luP`V 9rD` -LM4@P F%00000 p-LM@PpPPr`0@@xy~H`00tPx 0@ @u{x -ML M0ǟpd8  0 ^, \ ` h( l8 põ\VP h}PF t0P  `E{0 0Tx X P(  tP >KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  'P U%|PD%0S@ d  0t_P7 h< }8 ( 0 p P D8 R@ <8 @80C88 Rppfq}PJt`P1  zP.`(\8`%T0%Pd p P |xHx PPH(W:|+d8:Plğ0Sd02@ d @P(RdF$T+%q|8H p0 SU!0U@E\S 0X@ U:;Pf8tPVqP^ d$0fP@`XX d @T0#SS hPl(R PP0:S@l}P@T80T8 T0S*.K B0 B0CL p( t8 x = =pPn @0S :S@DxptT(d8PPP uP(Rd#ppvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f psPVmpP^d# )f0f fpPXx `0H a@2=40(.= Sp DP(Rdi#X8f`S0A0 osP`V 0@S@8XT 0-LM,@0PS,0@S.$8XT -RQ3LMP@ :Q sP*W000@00R O @10S0 R r 1S010pS000 P$PU  $Ppʸ00S e4x000$Pp`e t00Sֱ f Es `(V  x 0f0 0 0SXT p-LM(0`S[@0P0-00S㢱20 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00SzxXT -LMQpW0 0 -M 0 S S@nЍ -LHMX@K 0K Y'PK -LMP0P :4 80 @+zP> `P0K0 00pZS00@ % *,zPP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H #X낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ xyP@t(U@࣡0a08 PSYP4\X00 S KB.KA BxA B;8 Z`P@B0SPwK@@0h(<Zm h'!PP@ @nK`FH`Fp) VyP p Py0PY00CS00Ӥ0b PN pL p @EyPDt (0@P P% t T@<$PzPKt0C(0C8hp@ @<l8l@!W08(0@ ,0 S #(Kef_fe -LM0 @R r 1S01"P0 0C0  -p-1L]M0PC/0 `>KJK\1 0Q ,Q @Lx 0K 0 KvoP |  0 cKx1 1 4 *gp@ 1P|oP |P pl0|1 00? 00@ 0 Sw#KpB$f -LM@QP&00J,10Sm0 R r 1S01D p00S0"P W)0P+ X'0`X@1@!   20P d  @f 0d  u00 0 d0upX0000S. XT M-L(M\PK0p@0L0 0 X0 WP`'0K <00PT` 0SPQ0"S XWuv0"S V U@@@@ R( K1(0 0( K1T$0P`0(K0f -R00L MH /@ D H$Q D R@00a 0< 8 0$3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 00   0bV`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w_ !000Y W070cH0PR\N4@T" 8 V<U < 0R8@T00 P00S !!<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(KPT p-QLM@P`p`S@rP$K 0UV $0K0s@$0 @ $KKp p-`LMD@`0PS P@0S x x8 -LM   K0K %p K -LTMP`h  0S v0v03@P0S0S v0x03@P0Sx Xv P0 d0 0u0`X0K@p P \ R00`00h<@P8Ol P@ 04 r 0@ )0@(KS .H-pf -LM`0@00\00`0 p-p0LM@`PZuP `00U ,0  xh!iP@Tx8 -GMLM50p ,0 Up@c Ep0#S X5P0s Sx5@  `0S0@hT<5@05ZP00pDT8 0S 5`2tP `Vl[kP& 0\00`h0CK=KA0C 4 FKA4  ,$ 0C Bx |$ 4 $4AEKI B0C$ 4 It h@T9p $px4ps$PX hxԡp@" pPV0#S 0`4 |4 l4 4d4 ht u`4h$0P bhP^e[rh00S<@KP tß @p 4K\@0C\\4H $P`|h@\ Ppt X\ 00`Z `  ,0 SX(KfS8fffx>S,- Uf ggfMЍeP0MЍ,gg -0L M @ R R R0ᓗ0 Prxh h0r R@0@0@ 4r( 0000Kx>g,gggg@ -LMh* U 0-LM0@$K$ R10t!Wrp PLH1$ PL`R5\\\\$\$\\\\\\\\ pr 0 .rp P# @`R01S 0 r |  0rpP,T,rPD@ rK0,gg g0htg4jdS -LXMP` t  x0 Q40d pP`l0 p   R0d R0h0 4 P0K| 0 P ( l 00C,̠Čl 0("Č#Pj,@K  kP ,0 `@,  ,0!0S0  kP 00pW0bdCQ <@P <`0S!]i1@@ 0p $K1 -0LM`P@00 <  0S 0 S =S00SR 0 0[<f!l 8 0 KkP T00K @Q04@K40  40!0S0  ykP0 00Y0bpCQ @P) 0S!h1@@0P 8p 0P@]bP 00! 0S0 =S=00<0S< 0 (K1 -LM@$~!l@P0 @~0T -LMp`s~@T xP  lP00 @ťPh~@k V*(^~"h W~0T 0-LMX! 0PL~P߷!@PP@Tӷ00P80@-LMP@P 0 0S 0Q0cЍ04kp@-`RMP@ L 00S0\0cR ^Ѝp4k 0-LMP-k@a0P@ @1h8 -R00LM?@ D $R D R@00u0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0e 0g 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S 0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KPT -LMNI K -LMKEIK K0P M 0ЍMЍg4T0MЍg4T -LM0  g K4T\9 p-L M$@K`PH0 XKp4l --LM0 0 K 0P M 0Ѝ4T 0-LMP$KOPU$0K$KK0KK|* -LM0 0 K -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 唴P <0S D0K 0@D0 @@ DKM 0ЍQ0M  Ѝ -RL MP` ?R0Spb10Sd!00P @0P7]0 000 R r0 11@ppp&]NZ@ ,K0 KL"V@,` X`Pp,0Vp `_pX@ 000C 00 0 t00Sq ,0VKZ@0@`0  f00 `00S $KXT< --LM00  K p-LM@P឵P0` HH T  ,[`,  +h xh  Uw -LMp$K!P$`@@  PU 0ShP@ @TTb00KMЍ\ -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0``p@z 0Q X_PP}  0``p@+0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0^ P\ X[ g\0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 P8e0P  ` .e0S0@@@@P 0 B 0R #P0 e`00T QZP RL _e 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q g ``  d`P U00L0p00X 0Wk:>[\0HS:00\ ` `0@@\.[(K[z* -2MLMD4@0TP,0 ``0V  ,  ]P 0`< 0/S0000S BK@@+ Vp@P ,R Z`d+UlPgBK@@+Up,#XW00< >K0C< >K,BK0C0CI B< I0F, < /fP PP"@iT  0d( K0Z (Cpd  ',0 /S \2Xm/00  ,8[Sr (fPm f@P Xf<@/0f@]+f!PIKA@P K0STZRE<0U<: SA, R:>01L!PP>( K0LC,<[/S@ X<@/0@fZ ( KP6 P1 PP) P="P+ P P "# PPP P2P /P 0P  1P 8P5P 3P  4P9P+\P+[PIP CP @P APFP DP EPBPP  NPMPKP LPXPRPYP ZPqPoPfP dPr. mPlPgP kPx|PvPtPsP 3P }Pj2P 0P 04 040 0DKXPDKpq QpDKGPDKpq} Qp W0dQo Pm: "|040 0[040 0W4 4K# K0K0 pW PT Qi @ b@ P U}J,QA/O4 0 4K( K0K p0 (@K0 ?B%@f/K0 UϠ4K0K 4@ p!&040 0( 0000 K4K0Kvp   H <  +!+K0i @-0@0@,0M0$00 00000 0Ѝ#EgÉܺvT2 -/LM0 @ lK,0 `1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTc?1 0 @?Rp0@`P@Pl@  Z@@P?0S@@:  eoZ -0L M0P@ 0 (`K  !>@Tx ~op` 0 P Qn/B(K 0 SoK|lpltl 0-LMP@!1 1 !320QH8hY0@-RM@P \4, 0L 0l51@PЍ077Xo* --LM0 0 -LM@PpT0` LLT  0S0$cs[  j  Uw --LM0 0 S Khho*o*0MS  0S0 0S Ѝ PM Q 10C0 Ѝ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @X8 0-PLM @X8 -LR0L0M@@P T@ lR0  0 R B0 0 Z -0LMS00 P@0Y.0D0TST' T%0 `SPpp``UVZ W@@ W G00 Z@0 0  00`(Kn*n*n* -LM@0Sp [P.0Q 0 [P"PN000QP0 0[P 4`4P4协  @R00{{m*RRm* 02 MЍmNA900 M Ѝ  000MЍ DT -@0LM0StW  0 :900 DTmNAG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q ЍPTIICm*6?m*6 -LM` P@0SV !ZP 3pP @TP @ -LM 0 0P9 0-LMPP 00@M@@M @@8MЍ9 -L M0`SpP 0K4K@P 4 R 0#S S 00S# S0B40 4 P0d40 4PPPz 4 W40P@@0 S SPP P P  00S ?R0S`1P8#8 $#$(@"( @0S OP PPP/ 00@% S S@! 0@1U P@X @00000c0P@H@P T 0S0 0 (Kl_x^l -LME0P9  0-LM0@SP$$W 00 08l_MЍ9 0-LM0@SP 00400S0 R r0 110D 0PS PP೼0L00P @0PL0 00DP L0D0000000Sˏ8XT 0-LMH0@SP:8DOPDHP8 -1LM0S@ᤏ0 R r 1S010SjPH  UP Pe0 :0 a100P`PP f-DUGP `2P 0`cpPD U0P0f00PD0P0DPS S 00SM00PXT p-LMP K2`P@' @P$   S0P00ı@ S00Ӥ@000L0`$0D0@,0<0(080 0 0 0yKp< 0-LM0PrS wS aS<? 0@Ꙥ00eR8 xR +R ; R 008 p-RQ3LMP@`:Q =PP:xhNm 00x -LM @(00S0`00X00XT 0-LM4P0@S㛎0`000S 8h虎8XT -L|M@T P ( R / 0Nu0SwZ ZG ZE :0 PP` 0  pP`q0S  ^ 0 00 0PUoS <0PUo R 00cPo K  0 0 40S7ߣ 00P`0S\ 30S 3\ 08CJK⼡P0: S 0;00D ;L 0ZpK K⦡PTpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0P~J0 000 00+L00cPo 0 pq# 00  P @0P^J000PW 00 MP R :0 e00 00S0 p-P K 0 pq00S Z00P @0P'J0 000 0P080$0S C  (K<XT0M/Ѝ 0-1LM0@Sv 0 P0XȢ 000@0D hPG0P00P00000P @0PI00P<0S0 80080S& 0 90088  R09  $0X P  8 0080@000088<80M 0 SЍ6ЍM SB0SPЍ -R00LM?`$RZD00~2p0 Pu 0-UP  +U000 P 0  v 3V00S 0U0XSxSP`p R 0U ``00SAAMM0 @R Xf@h 00E S u4 000. W070 cR(Q$00S \ 00R00S b ݡ"  \00R00S,, ̡"00PZ QG (KPT p-0LDM \@K:PK`  SR 0@K @0 R0 L@KR ~T0 H0 D0 L0 f뱗fNmm -LM@LPpA 0 /T #R 0 1 C P@36:/0 C P`$*?XQPdP0@ M0P@X P*0`@@ L0f MPP@D"@X-00@ :m -LM0@!  0 Kxm -LM`p@P0PP@0  pv@TPPKTTnm -pLM@ 0 0P  H  -pLMPؠ 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ 040MЍ -LM0@00MЍ-AM0QDL|Th(0(0000Ѝ M-LLM@ 0p t "GP 44B4 000000p0l0` GPP A{ 0000gh00`0<K0S pt 09PU 04,"40h1(000@0(0,@000d`\pLp t0`l ` \0 h` d @@ `0lKwP( D0X 0S` @ 0@ P P50p0 K}@ 00P 4@ 00兜00CC (K Ux>4yU~f M-LM(@ @0 @KK`" 0-LM@P0S puD00S@xC8huC -LM @p , 0  | 0  0 0 (0 H0 @ 0K DK 0 @0@0XD0 ` 0K00D0P @ 0 0P  P0D0  000 0`0wP 0 0S D 0TK 0 h@@  $G0Ϡ@ 0L$ HKvP P+ pp3$0@0K XCP0= @@ @Q R P00Y0X00S  C4[  0> 00凛0SL`KY`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0{P>0SPPf6 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@40#S  ,0 S!(K<?B$y -80LMQ< 0( MЍMЍMЍMЍ p-LM@PU@jDP" P<\04`Kx0 @ 0 0(00<000SKp<U0MS S. R > Rd<DLT\0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ 0-0LM0000PS@{P YP qP  lP 8hf8 0-LMP@@P 0S S RP 8hL8h+8 0-LMP@?P P 0S 0HK0UM Ѝ  0-LMP@P  >K0h 8 0-LMP@P  P 0S S 88P 8h8-$$ M @ ЍUUMЍ-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0 I 00 08 0-LM0@SP*80b0 I 00 08 -LM0@S0C0 ,<4("4!< K0 I 00 0K 0-LM0@SP0C0  KI,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 7pR 8!+A[KT081 4A `T041 081 `)꥘.005@81V0OK@  >KK娖K?KU N/KPl@ ,0 S (KTyMЍ 0-LM@PuP pP kP  8he8 -0LM (0 (K KMЍ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h8S 0 P U  0, 8S888 V -LMP@p`P 0@S RV -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -LM0PS`p@ ST- I$ $KP' $0S$ R :R T ?P@XX\$0  $ <00Kdy UM Ѝ -LMPp`@P( PU0S"0S :SU T ?P@PP iT <00y U M;Ѝ 0-LM @Ix0 0$ S 0K,0 0(0 0 R r 1S01,K 0P0SK0XT -L M0S@ 0 0SWP 8 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:S?P 0 0b00P0P  UP! E0 0e P0 #0PW  }E000{P o W:,PP e hE0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  2E0000P $V ,PP  E0 0f 0 P000S00 P4 00eS0 pe0 @00 (K p-LM0@ `V  00Pf`0 ,Pʼ0@00x`P` Ux p-LM0`0PSx~0@Sx~xXT 0-LM@P\8hT00Sa~0 P 00P00SX~80XT -LML`p@P0X@SpPUZ`VdU 0-0LM0@S~ 0P,  00P @0P:00P0 $000 0000S0B< S @0  0 0c0 800088< p-LpM0@8CP`JK⑑P00 ; 04  Q00R0 ;0  Q L ( 0R   Kp p-L M0@ C 00  K$ K` y=P0C0  0$0 S P IPP000KpMЍd{ -LM@pq0:00PT:0 p-LM0@ `P 00: 0xh} 0-LMPWPP00OP0T@80:08 -L0M0@0@K0  0R 6Ky MЍ\st,@RM 0S@  RЍ0@-RM@P \, 0L 0l4 @PЍ0 -LM@ ,0( P00 -LM(0 :1PX(0  XaA<pP+   d}E9q`AP<P 1!0 1!(u 0  P1D 1D , Z00  ,0oN -PLM@ 0Ath00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 0?P0S0@T0d p pGW0WXS 0gS80S @00P ! `K :P@ 00C>N6( K 8C0SP0@ U T00SR`1S S S KܧP w0S@@ -jp@j0S khP@ _0S  R W00@ ,0 S(KL6y -LM 0@jPM 0Ѝa0M Ѝ[M 0ЍU0M ЍP -LM 0@GpMЍ0 10M0S0C0R:Ѝ 0-LM0 RR@  P  100P:R0 b320 8 0-LM0@10 0s00R: 0R PP@  ! d:v @0 1 8 -LM8 <0 P4 K00K@ `P? 00 i40R040 0  R5Y0S @TT T  BR \ 0210 32@@0Q&0 0Ppp T( `P 0@0y0@1 @d P p X0 40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC L 0T0 ,`P`p 0@0XPp  Q 00040 "00p <K 0  @000@ (K -LMoPpU 0 X Pl<2P@ d< +P]<8?0@T0 P@ 0H0 80 Dp D 0 S S*S +S -S S  00 0D0 0S 0D0 D 00S0XS xS DKH0K P8  P  D 0D0 00S S     D0  X0 QՒ<,Є 00@Q9)0D0 D/P00@9P0P M0SI RQ 0D0  @@ 6D @0D0 0P 10@Sࠃ 2D X @0P@  0 PP0Є R  \BS  0ӓ"Є R 0ӓ)@D 0D0 00@ S00 ᴀ @EPeP90 y Dp D 0+S -S```0D0 00@ SD 0D0 0P 10@SDP0@ <,D0D /P00@9P`+0e\SVlDp ZDQ:NP IP5iP nP0D@K<P) D00CD0 4PD0 0D0 0 80 D@K'P 0 D0 80 0(S  i 8 080 Dp   h 0`  R080 00c0  R   r 3 Z ``Q  E VT P ڤ91H C c"@ PE 0&!T P 5^Z[`P 0TKF4`^ T  9RQL LK Z 5@`P06L0 T @`` 8TK1 1"T P 05\TK!Pj`0^(ʈHTK1 "` 0eA " `~L8 2#TK T P 0TK8K<P 80S?Q`  0f@T=  7TK1 !T P 0y GCb46 56,ʠP0 LLTK !T P `FVHǟPp4656P0 T@K0` !@PV >F@d  6TK1 T P 09 FCb46 56,ʠP0 LLTK !T P `FVHƟPp4656P0 T@K0` }!@PV 5T@ PP 0#:?C0C PPTK@ K<0Ki PH  <0@a@0T0@0 @0 0< @0 @<0 Pn0Ug U0 P 0 4@lT H P<0H 0<0  R< r H0  H0 P080 RH 0<0 00dHB Q@  0S00 $4X 0Pt [ ``  t Px L t0 ! 6H0P| ? H  ! w6"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S zPP000'S S SQ  R0pbPP@@[D0P 0P @T0U 0g R#1 0@00S>PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0ڀրP"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (K<0M 0@RZR R\00Ѝ0A10M 00 R0: S:Ѝ0 \M 1 21R  10 02SRЍ -L M@,KP0K0p0 c,0`0b2SzG  0$K -LMp` @+ 00RP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 BP U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 ЍVVV V0@-@PM 0Ѝ0@0@- bM@ l 3. P:Ѝ -2LM00< S@ 0 2140 040 8 4 00<0BP0 S SP00S p @ 0p W0 XSxS0 SP"`V< S$00S T0#03P0S  T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0B 0 S= PpT  $ 0200SW* T0#03P0S  `T  0 T000 R 80S 8 0 b 21040ASQ00(K<- M 0SЍ -8@LM,    h<68dz -LM` -LM<` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! .@0 1  M 0"108#8S"("$"""!   Ѝ 88S00000PM 00Ѝ-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ> M0S0Ѝ 0-LM@P 0 S8he$D0C05 `0 C>@0C01B@`@ K -LM@P`PwP00`?0P@``kP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zv@Pp  ! :,Lp 1P  -LM@` 1 1`P@ Dq> APU0Sh/PUPP+ 000S\/ ?@P `p @T0S\D/@T+P@ 0S 8/P`t{HXT,Vq0 SM0 RЍp@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍM0S SЍ0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P T00c08 -LM0@JS000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?mP 0/Sh00m  -L MPp@0  d&P000 %p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@Gd%dP% @ %0 @%T  U0B0C@%0P S04 0 \@ B1Q \000 O0O(K{Q 0-LMPP%dEA%`88 MR10bQ1bQP00Ѝ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 ~ H` D @ !@ 9$0 p Po0@0S@T SUQPRZ 004K40 \P04pß0Os/< PL$ `GPU`9@H6@`Uį0p Z0@ d$P$p3`1 Qʭ P,C! ,3 `$HD 0n00a<L lpz}HWzG}G2WPd00@h$P0b$0p031T0K`PX U 0 dN$P0H$0p030KAPndؑ`0@P  d4$P.$p31XP@PPPp0@`DP{D@$PfP$PP00"$P $<@$P0<#8P 0@  d#P#p3 00 P00bP 0P0!0X0 00 0L$P P(KP@D@Qnm{?Q{ MR10bQ1bQP00Ѝ -LMP`Up@##0c0h% 0RM 0R  0R  0R 0R 0cЍ -LM0 00  lK0S lK< PlPK`< P  P\PXpU `# \# 00`K0c\0 0p wPsrP mnPdh\ 00``RPP!#P#p3 10`0 XEp`0 S\ 00RPP#P"p3 10c`0 3P/DĔp0K``dV ʨp` @0K0Pd "P " p 3\0`2"1Q c P` \ \` P 0K Pl00;Q X0 v># 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K0P <0S@0SKlKP- @ K R  S ZʐY@ < R S ppSʀR~@p < ZzYwP@ K pіL RKx0SH 1\11`Va  A=0K4 L0R. 0pB=0P L0\ @0K 0O0SO80 4@ 0PlK fPx L0R80K@0 <@  PEW 8KpGJHZ @ K PoSR ?!0 @K8P 4` @P <` P00@K(Kl{n{dRhl -LMp@P`10S 0'K@-p0M@ 09H00 NS N0S: 0C"0\ZЍhP@ -MLM`P8 <( u0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (KdRhlL*H*P 0M 0ЍYdQ P0 0M ЍPdQ -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =04(p3H*L*T*X*P* -FMLM90@,0 9Kp&PT 0T00 ^P 0:S /'P 4-(P/S .'P I0:S@0/S 5( P)*B^KPEPE++'+'.'P@ @4PTp@ H(P\PUIK966,`fV @FFH`fg0`j6fK $ ( @ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"K0#"F0aS)KV`@v KPK`P@0V0 SH&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6Sz K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg,#qK0(A 000 00 0  0  0 P ``V FP*Y`{ -RLLM`@ %,6p@ P01h0 @000 0<S @>>0>Sv dp@ h &p@ @d h@ 0Si 0K~@Pd  RpP00PU& <U @>0 >SP dl@ d l@ @dd@ 0S,S ;S 4KVP;00>C40 0 s 3W4 R0;S,SHK VP& 0,S#\KMP PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K V4P@ ` \0KMU T  G0  G0@ P 0G G0`00 `dBP`<p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S pdQ h d0 l (K|$|LH*L*{Q%X* -LM@ P  hN{ p-LM@P`7 0S00lOh0PL6P0@0 V40T(0(0x=0(0x|tBl8V{ MЍ -LM@  -3L(M\4p 0 H L 0S 0S0S 0S~ 0!0Sx0Su*4||| -lLM0SX@0 0R@P (@ 9PRhphB -@LMa5h`5x p-LM,*"@PxhQ0S <"P< |"PP,P0SP% PQ0  B B,p P` 0:S  UP xh.xpphBP*{ p-@`LM@4  @P4xxdR P0M 0Ѝ p-<`LMP@4 @4xx -@LM4oh4x -LM< 8 <@K0<Kx4`K@_4@ 0P q<KpTR0@ Qp`4@K0@P4@ 0P [<KT R 0 @ QQR* 4KP'T"S `p4K4@K0@P4@ 0P 7<KTZ 0 @YQR 04K@4K(K 0-L M  @K0 K T?K0 -L0M@@KaM K -LM(@, 0B4P hc` -LM(@, 004P h<d -LMh p-QLM@P`p`S@rP`& 0V pKpp@-`M@Pb0 <250^@ 0<0Ѝp -LPM@P`p 4<`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KᾂKSK@PK@\ ;3[S @0K@P\ 23[S*[ 3[H3[ Q  H $HxH $Hh@0K@P0\0 \6Kll PIl l0 SP i00CJ K 00S BZ J0Kh X X X RX R\0l<\LX 7\0x @l d@ T P0`P p0 t l0d P0 RᴠX Hd~dPjd!PPE` 8Rp0t@\x 0  c a"88c !^@NLl00a#0\0 000#Q@DAJlPE000T h0 RT P\ X^ \l 0Bn0X 3><A0 Q@l0#[[[2[x h[$[[4[xh(KЍàS-0c02Ì.1M0 00Ѝ0M S 200 ЍM0 3# R02 R02 0ЍM bQ B2c00 Ѝ@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P&"xZ᐀q4 K80Kf,@K0PK4 800<h0H0, Q02[ZR$KP1#3P1 <2MЍ|PQMЍPM3:00QЍPM3:00Q#2ЍQPMЍ ;; ;SMЍp@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@x -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpQ@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M ЍЍHV@V -LM, T"`@pt3Z00 P T  W TTV1("SU*0U,!00QsKPI T 0W0T0SWT  !0Vt0RU/u P ,08!0P,K0K 0e,0|X 0SZ0P W T T0SP0S 000P ,K 0,0K00000  000 00, 0P, 00$KDVHV -,1LM0( s3Xp@` S P SS``(8?S@!Q vZ)?45VC"QqP0P_a( K(0@Q T< 000(0@T  030? KDVHV p-LM`P@'@!axh -LMP`pZ00 T0 G  0sRq0P00 0G (K -L :@KDK T0Z@ D0 J)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0IH@ D0e (K -LM@p`U@0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, K~(01(0 ( ,0 cA@ KDV -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KM!V\?DE% U2$0 n$$ K:U GU 1?"C   $0( 2 N$0 A A4@K -顏OLMX`p P$K -顏OLMX`p Pp$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ  !  0$Z @tP0P 0DK4 K@0K00S 8<0 hT@KlXPK\`K8< d0@ P` HXLH @\ D@ P`T 0RX\@ ;#;SL 1lK D@h0KpK lX@Kp\PK``KX\ h0@ P` @\D` L @ P`X0LQL`0\ 00 00L0 HKLKHL 0PK-PH L0I(K -LPM` \ \h d0 (JJX@ Xd@ʠP`X $Jㄪ\X@p8RToOP&`@X<@ h@㪪0 8 D@ @ 4 `` XZ 0 0  AZ c0XZ  0X R  0 `MbЍ -@LM%   H900D9 -LMD9@SD9 H 0D9 -1LdM0`P 0 y]1p4@K x@ | S0 0t H@Kp 0l h0 0d0 `P V\ X@ T`  0| T h0K P0 0L0 ]E]H0p0S8 0 S(|K  \Dh -L LMQ080 000 0 BS ] 00 XT 0-LMP 0@Sl000C L{8:#:3 201 32 l8Ђ -LM0PC@[ 0 0 b 00刡 0@ 0 `0D @1p0W00  P # 3TX0#0300 0 p (K p-LM0P,  0%R@`@l90\ lN@1A.S R00SRPx0 -LM 0`^0 4 ;~PrP 01@0鎐"pPI@  ?p 1@T  0A !0S0@0pW:XP 0 P0 000@C0  BP0!004  00C 0(KH -t4LPMl$@0, 000(@pPlKX X X` ? ;P( K0 `DCFP(`3`<0C<Swl<P<<<<<<<<<<L<ԥ<<$<<4<<<<<<<<x<<<<<<<<L<̥<ܥ<<<,(00 S,(0( 7(00 P2p0P"p"$P*$(P&p$P"00PpPpP P$P@0(000 p$(P P p P p1 F`V 0SyXZA P, pP` 1p`!P@?    i:B< 00 1p`!P 00 0 0R@\,0Z0$%Z Ul)0@  p00SD0 0SX[ 00 ,0 S0=(KPd=tXTt -LM2@, 0$PPl90\ V>0>0U |M1%vW\b0ST"00C0@2 @P0!0v"1`(L$X! 1AS1a0g1 0 S K0S (Y  *0S 0, Q` 0 ^ V' $0 0gR &0S 0Y0g010g1  E )0S& 0S 1 S|p0St 00C0(`0 @P0 0S $ 000(K0XT  ->0>0LMRP8 n1"( Y 80P8ce10cY czp`0 1S PTy01Xa140a1!010`0 X 00( 0B0P40 A:Z0( BaVp0S8  c 0S  8z 8011 010XAp@@(0X@2 !(0R((Ko)(K訃HЃ - 3LMp@Pk *"*RP R B0RP Ub;$ 0b S:XWR U53;2 @T $a ! PXD R 0S R>0>$ 0+ b< . . $ mc0SU * 0S  ,pd !9T I@TW PP\m @pG !0 1!08#(R!1 S1@10S00@@1S$ R00 1Sl0 0S  *1S1100S00@@ 0<H -LM`XVp# P0S 0 @|0T 0S dh4X@00S0 h0 0CR0 XpXTT \  -L MD P8 < `Y$8 0:CR*80< p>0N@pPXP 00p0 P  BpXP$Q a  Ppde0S $ 0b S*0S b7 $0< c:b0PPA 0S>:$0S9<0S$0$ c g b-, 0&Rl90Q 80@S08 R 800C10 @0P0U40  p Y:3), 1 ""p  0 W0 3 @P0;p0#  0@ 00S0@@00@P 1P R0000  0U 0 *\Y# ᰑ01 R1J438#811  ] P  w0S00PP`6:39 )8#8!1Ბ1 !2R0 B101!2 Q 4 @0S00P40P0  0PO 0Rt1Sd1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00t 00c0!2QB!R 0P<PU 8 R  (K<0|Ђh -LM`4 pV0F80 V@@T0 P|20S pRp"0Sh2 PT"00S0  V W!1-@X$0:CW-*>0~ Vp:X 6h0Ve pP^ 80 0f@T `࿯P|ePaᶯPTTV 0PP   \V@ 000$Q a / P 0S$  bT 0 0 BS G T p0 0S x`V 00\V00P040@UVPSV000@(KXT  H< -LMP`;V(1p0S 1!@1T PP9VU3:U P *00S 0 0SVP@0Q P h\ 0 0CRP0 U 80 0S 4sU 00UpXTĄ   p-LMPU0`0S 0 @0T PP#@00S0 P &\ 0 0CRP0 U 80 0S 81U 00U`xXTЄ   -L(Mp`U40@ St 4$@4T wP'$0@T@ Y@TW8  @8P< L<@$ 0:CV:kU@ 000@0. N^@PUX$0Sd@D@ DP8@ 40 DP:P8P !8P!10b1@"4P(0UP4P :@PD  20DPP@@  p2P0@@DPT ,20S  <@`et6 P1 X-*$Q a P K$a {P B e800< @0< V0S$  b f0ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -'QLM`$rP@ 2P0^p@  "p 1 @0 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0K0H0expate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PT@(@( @00 ?00, 0RX(K00 p-L,M`0 0R0 P 0SD@K(p  0S((bp@DK(0\0+@ H0040 0S00e0 0 SKp00j p-LM`0SP00S.`0 @0M@c KY  00C00S KpXT00 -0LM0@S`}뤀夠p00S @VP1P!M@c * a p0`e0e00P V00S mUXT00MЍ 0-@LM P>8h p-R00P0LMS P?P*0SR *0S0,K  q00 0!00^0S0c 00 R L0Pl .a @0Q010C  P 0Q0Kp -LM@K 0 0 L  B100G*2 -LM@h+7*+PRM  Ѝ0M0Ѝ -- LM 0   K -LMğPP,  P, T, P#\3#0#P[%[ 0 S2 NL 0NK@DP@D0|#p3 PP ` ^H, [`  PEP``0 00RD< 300\ "0PEP``0 xD0"PEP``0S UPEU:00 00PEBKHH{-%T'0mS@ P^ L "0 "L<PGp` %S00W0S 0@pG@@W@pG@TB.K@ B BT<P~KEpG0pG @gb@DT0R S 0  D,K0gT00c8< 1AD4< A0 < 0< MK@@p0  F.PPHKgT0`0H8< At0A < 4< 0 zM5 ,0 S@(K8<dl4tD>J*F* 0 0C0S2M-S0!1!Ѝ0 00M100 00 Ѝ -LMAPTpm%& R0 W 0 0PX@ P  } 00 AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1UK0P  P CPT 1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 IPZD< 081  01 0ā0P(K -LMPp Q0`@\ Q QVPP P0S -L M@pQ 4  P n0 %`P{cP> Z) 0(10S$1 0 ! 0S 0P * 0P$1 0$10 0S0P  0 `P0 8#R J`00 4 0 `(K -LMP@`QiPPq  Q0 Q000a0UP^ 0 8ᲀ#xP`=0 R  0S0 ` p=P(E000Y0n0@ 0S$10 (!$1 50S 0!P ) 0(10P%$10$1  0h8(#h"x 0 /p 0S I00  勽10 -LM@pAQ 4  n`0 PPxP- 0 PP #0 0S0P  0PP0 8#R >IP00 4 0 7P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 <@KPtP 0@ kPJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@6PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00 冼   8#8 @@0 0@ 0@00 DP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X N0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$H X 8#8 B @0 00@ 00 DmP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd෻0P pP(`PP  0 0b8#H0T ʲ0S T0 ᔻP P -LMpP`@LQ\QQW@pT0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00WW800C80 -LM` GpP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ .$1P\2PPBnK`F`F08"S P:F?0xBNK@DBK @DA0A 04 㣼p` 1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W ∺@00%BT  z@ F : : ᢳ8$P0@<P0p 8$P qFO00 ,0 S (K̠؀ -LM`pyQ 0P40 00 0 ? Q< R .@00%BT  @ H : : H4 P0@ P+ p G P 40P FO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP aP8 0,0ZP8 8Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0xh -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 /DR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 N/D008#8#H! 04 40P 00P00 00000P0C0@P0 40(K贅 -LMP0@0P@cH$HX`p %Xc0@@bH$H[PX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @0H @cH$H4 @000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0dPU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D  P040 0400D Q808(|D40P4D(Ko(K -LtM@ 0  PP` > 0Ph 6 `(0P 00h"0  0@ `p| 00S`@d 0h 0C 8xp hp#X`p 00C8Sl   0\K)PXX \p0W T`V @p d` (^#x0`0C8#8 I 00l0ἐ 0`P~ dPP @a8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t "P0S H @00 0S DKZP; 0DKL K\000p 0S @0H 0 0SpDK<pP 0DKp0 L K>00008#X0S0S UH:dP dDB4 00c 00 į 0f P4K< K8|#8  08# l  0 0b00屐 00<0 00l80 08#x`0X0g8#8 I! 000ഐ`000h 000(K -LM@0pP\oR 0080S#80l G8U#h 0  b)000 R C CCC0^(1U0E(10 00G000 000B800C80000 -L@P/ 0`p( 0A 0P-L 0- L@0@PKP $00}0A -@LT 0A -OL@ POtp -0LM"@ -LaUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlping6dateztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlencryptsleepmvdmesghostname$:Xt\He(@@dhlp̆ Tr@@tȌ| unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputp|<usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinp|<usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSD+@@+@h +p+p +p +` +@ + $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u16018032036072012001440288044 448(T84$4(4 0484 |@4 H4 P4l86X4`4:5666 666$6,646<6 D6 L6#T63\6#d63l62t63|636#6@6@P@6@666666666667777 7(7 07 87@@7@H7P7X7`7h7p7x77x7777777777 7 87778 88 8(80888@8H8P8\8h8t8|8888@8@8@8@8 8 8 8 8889999@ 9@(90989 @9 \9C$H9CP9C$X9C`9l9x99999999999 9 9999:@:@:: :(:0:8:option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPsTh ؠ ^؀  @ @@  @(@ %( @ؠ ^ `N@ _ؠ^@dؠl< \===g^ggggg hhh^$h,h4h}N.{ɋFsUw-kUٻ4.yw'篒W;}ER$7eRD͒N4OZ^%7}UIE0UJWNU7pKˣ}%اqJxuó0cSbQ} y/`l(ψ S>CcGueScT}ƻdT$9i:^L>qt^ǥ޺)ʢ٤ҙN[1iQF4jUTz:]of6ٖTbŭ< 13U0zR*kt]ئl:0zY_dO`)H6@e:gjpqft֤Eh!YfR-RfoMaav-Mk\WM8GmkS76=|V2Xj֦],.IV9̙v.JmV3miJ0ˍ-2>8)pi1#M xtJ, @N*Ӡ4plxK|v0՗\-TSH.ީcH;fjIaᩁ;g#(@R ,5@zm"׹$gtK`)Ksg;q08@[0+k]2h_ju'e:;ڝj5o]j]ʠMzvJB>@VtJOĸѕʧ/&Q8SHAS[LsW U7d?@7 K8TyAx ^DDMOD׬BpNz조X?1Ts"˜[KAV:), =VqIF $kGr(6wr S85.+)sAgp ;lFa4t|qJz`^Z!jA8 hL)mp,xfn4U>nrY q6!p,Z)l";.A+bGlH*ik118ƫ.r`MTC%o psXjD*%# a^vCr^6-Mij-[~k y9$Qpr8D!VQHp_! =J~d@9ciE0"ks ˶XɈj9%ʂe9А eI6FauqñڈKD"lF+`u#ǤjjD9Q+],̤F$Gdn<hS y(@ ]ER 6h yA+4g*49ZH9%!Yl]: uftWq|nuCÝ8ΣSaԒոs(w$&')OW ﻲ< M "Mh1ņkR)ޯsM ySȃ0ݨtpY&U/f$HH}d|*`5fԃ0QI 1̚J ;Օ-P3x$0cel3 #rZ3ڇqJTW^ sӺLIКD 7V~[_M1Yx09&D]m貴Jp> c:|c 7چeAZB$s <WƧRɩE68G),G'm'r}} aP]pc\O0۱yAnswIkUKu\vI E|b2vuݮ u2FF m%[UdC<FƄ\%W=!,vP9j<+!v 8򀖸A@O^oh L'cnp kh\JSP VYDQ򾏒c-=+vř]S0*Dwa 9: -M~oրDh͞H 4]aBNj<9|$9 >&o_2ԗ+KwIPwjŠ.$U˸ҏYH) ]^"N Cv%{|/>DMdJOzYHƍRtŢvCN"3 \aK=o?R2nJUɍ0Q0)5EQ=dQr[嚴C@1]mL={88O7t3O#gؕ^::YT^TѸO/_Z%jim=`"oO<7r!ѐAA8Q O u/E/|W#O,1cҽ~6ru)rb}hm j+_GϾnնa=8ż6߮sN^oo?ӝQmfEy4ƤXN)ͰFVFnGE}٪ϐ#$J )@`l;Ot16ܣC.дk\T0|쌔 X=se0,Pxf'ٍh&[,2 0Uz;5#yͲ"wt4 'Fwˋ]7b<; RE#=b'K͜ru]R%#M%n;LVO 咯' c/p >%&AhLUWsb'~H~*uKFx-/ҕi`F7_OeݥLDv53mϞ< 2^Y"f?z1M]:MRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %sbckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions can't get mem sizeYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromg^ggggg hhh^$h,h4h cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv5v5,50585@5HDPDXD`.h@@lPCtPC|DDtt 5 58\$[Xp]rr;;Pd;.`,0\LS Kq p(@4@@,KLJXIdL/lL/xL/L/VV@w33L1L1L14^L1L1L1L122L1L1L1L16$5,54 5<5D@5L5TW\Zhrandommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufound usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)\%03oNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %d --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: invalid peernamefailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lusendmsgping6: wrote %s %d chars, ret=%d invalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion errorusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d ?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: Warning: some edit commands disabledWarning: some commands disabled@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSEInvalid LESSCLOSE variableLESSOPENInvalid LESSOPEN variable...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sNumber is required after %sValue is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersfakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchp|<( 8@$,0 8@@usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [[s7~EWI)ڼH(=,ٱvmc)MR 5F(w/Л9=ۭJWZU=#8(B\_~7P0A_}kQ\(u@u.2tno77G^k|x^؊0`*SOE4TS" #1d)g_c@cÏ1?α^bO +;5XĒ  /ΕKqI|f;q Pt`o/'cPˤʂe /2m*d_s,Ms5\,ad,UarI3Gh`K4yd!Q'inY G8wRf@tq1pD%X`v-@ afѣy*gP`Y$F>$&8 i^vvHgwVƩ MbHaWUVzf[GaNL^DIEN*gN \msa p#qef ^9hupz%amA< ,A7aEs& Ev+4x,]\ XeLXA,`Rs6]}R.)$"+ 0xFJId?Cή}*Rqe閎*1]Kuk<2g~ԡ|xKpt$4'& Q!Qe['_ģ:ڽnj5B#{McLC܆5S E k%c ~ C SzbbrJ"x4/b"\lu!>ԏnڛCڰ}KJ[&k. &3O^s7tٚ[DTqfm7ym%DDi_mC=WEw`$xE\E}qLfEMHK]d(0Vl /-WoΌ@AJ`U\q{ڔrp@hi.-RmaM9 T2ka#220owT ^7Պ!diht8bF lmc<䚊˩s1J ^Mk迆v+/?pynjtz6.%LV$%URY[Vd|[B$A;퐶\I'~xW&р$bÁZ5(_Җn:yu{$K4`E QhP 5Yh܉G UL@ؕGEXWF+2kMs z\ J:V ׄJA>oU<1ؿ=yH E5- ,mB c8z\:ic/M ^#)1ϲx$TIeBuS9_ho.&<~I4;zj-6hRtw낑aƻWR) @gס:U#c#- Э5ևѹ?}Bb5黆R* ^&Xe |zI+CgE0ؚ Ud.T7A=8Q`&~WT`V4KCJm P4XQlw>>Yp|ؖ5؊siDJ@o%d݆0 I2+gѪ-؍wk GO"uAoet άQl`_L%B,C$|u "~m, ܒ !C6mCCLk\rJvl!RY޴c ukkPSykx ?tw_N&~(>^Kqy!.މw‹q,TPODCzhv0l?—rDPJvwO5;\qF<8xT7lmΥqj) A#$td+ ?K}.[y+_Hw#q|Mc?WJ ǃdpv2}5JF݋㡇6F_Auk@+g/nCvw,}9ݹM0r0:>韝M2u+~~uTa\o}7RIJYu.淺S?RrB'C&AZhzheje͡;|Q"c8s_*uSz^k/ C ,[ ɶv*\6԰9 VEfB:6{+\FB ]\pM᳁v"Q6Zsw]-a߱>2p0KwTqV-V)$ z;* 3* vwXQ1\cQArF0Lmflâ=28iB%iS3;d,*[b)/{o{G$9SGX[?~pxx׺.: \ L90Ͳv|Xh.zdjJf6oˊ[3*ڬ]HX*I҄c|K˰4QUERǕ(jFIL,3oE1]̋$im4qZ[lu)3 =쮗! &M>םf <^]w}qub3:I{Y0Fg;,P*.NP;D-+[$?BxeWL v`xx6 i?cu,V-65Pl]m2gmq^s2SXS%{z+Mפ\  =cUL\u םfJO+eT t.OrFIQVN'Gї OrO)Xi:QžmĄ^6Ӭ&P-m /jx$E{LBP K81Kmܢ3 6F5*uZmIdZ:/|k8 ^y¤jq/?2I`kQ`X%p HBb[vK7Q[`W2DY,2X*'O5h,pIi,ZP=X;M+b iEk?U:rO<&k-+%T"BDWWZ-9Ȁ04|"Jj+zݯAiNer^"QNSm%rEQZּ8jh^,ȱ斖4j ŐDže*q< "(P.$=I=U̇mCe_MH.YŔI;gȕkuŁ[U\_s3ΞPW>Dq.Wz%-"wȜpضpϔkitje^)RBI*-'}j&^>ΈRCWֺST@]&,>e(N#PN8Fw-$ jNۗ:p ɣ05E`йush͓6L`Y5Ca}` ,􁏕6-pSeWͫy뽴=@jYk@N[=_Ɖ7HG*ۡW[nǸ-I[(8s&b|ɖnQO=zO2#JtU:VcRն bR] {1jh"3+U•Ѽe>R{9QfXF'w}&tZ*Q1:.:e@*- MluWci vXz -[$S+V'#ۧS ͙Z+鮲)DuVLzHg#'#sO&ev~`>Ն''*g-w‰y;TK6})$(>e5R7͵~'ٿ/Yv_g~mɮ )GG]T ״-,{:_!!O/e|}jΙ80ŝ+7 nyyhq7f2Z,!:Xffhސu]s-DsSpRIdɷAxYTg:w 2>Lr lOSd2c|K'?M Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxy\Gx lG|GAGBCDGEGFGGGHGUVGaGbcGe/fGhGiHLHl0Hn:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vp|<@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGSVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:G^8=v0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface table128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %smust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missing: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstexpiregatewaygethopcountifaifpinterfacejumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): p|<@{` usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'5H4"<LTT\_phx' _\ &Tě#̛p`$ԛLXܛ  !txgԠ (H4@HLHXgdHpH33ءgb,3@gT3l3|3g3Ԣb3gb(3@HLXdXgHУg bg4gHg`|HbbФHXX XH(8HLH\tԥHXX X,X8XPX\XhtXXXXXXX̦XئXXXXXX X,X8XDXPX\XhXtXXXXXXXȧXԧXXXXXX48XDXPX\XhXtXXXXXXXȨXԨXXXXXXX(X4X@HTX`XlXxXXXXĩXЩXܩXXXX XX$X0X<XHXTX`XlXxXXXXXXX̪XتXXXXXX X,X8XDXPX\XhXtXXXXXXXȫXԫXXXXXXX(X4X@XLXXXdXpX|XXXXXXĬXЬXܬXXXX XX$X0X<XHXTX`XlXxXXXXXXX̭XحXXXXXX X,X8XD4`XlXxHXXdCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %sdhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %lldDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc'%s' is not an interfacesetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloccannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedget_rdomain socket: %sinterface %s already has the offered subnet!Can't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exiting%s rdomain changed; exitingpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc%s%s/%u %s"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s?  ,<DHL      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsXhtVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sg^ggggg hhh^$h,h4h~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv   8   ~ $ ,x 4 w 8d < H Tl `( h l 4} pxP T X, \ܰ d pܰ |  8  8 د Կ 4 ̶   ,  $ H    -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$t>Ft `ttfcdslmnlyp 4<p  d 4 D( Pd h D 8 | L ` <:   p|  d  `  D $ 0 8t D T h x        0  ! , <l P X d  t L$ T p x  #   ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():>IFS= ${PS2=> } ${PS3=#? } ${PS4=+ } x  a$c,0r8HePXdipkxlXmC nfbup rlshv xh      t_LP4 { }t>$(,048 ]]<>!let||&&() DxL̠  \ ` ` ht>@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceblowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] rounds is %s: %spb:c:Enter string: getpassusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfs(4,4<%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%u[b0b1ncdtscsbpxbxfxoxtxdxInfinityNaNlongjmp botch. SHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread566,K^[Yy]^[Nn]yes646NONEUTF8ttyname_r/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpassblowfish,8blowfish,bcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhashbcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$ 08`KT<  KT,`[~ [~KT`@@<@TU zT{bzT{{A NT؟4UTG!f gSUT޷9ST4ST4 N>!UTS UTS UTS bsl!UTS UTS UTS do!UTS UTS UT<!UT UT UTk 7LaUT UT UTk 7/s!UT UT UTk 78<aUT UT UTk 7ʖy!UT*UT*UTk 7KaUT*UT*UTk 7$!UT*UT*UTk 7!UT*UT*UT*<&!UT*UT*UT*=V^!UTUTUT"=4tw!UTCUTCUTC" !!UT%UT%UT%4!!UT%UT%UTk 7f4M!UT%UT%UT%(4tM!UT%UT%UT%(^!!UT%UT%UT%(a!UTwEUTwEUTwE(VT@,kT kT ?NtPO+\2J)y2sa86S dɕHm8hwfBQ~:ƅI(䀪*@ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0iA ...B . ..C binDmdecsbinshareC .B ..encrypt ftpgrep;fgrep;egrep;gzip;gunzipgzcat;less;more; sed@signifyD .B..E . ..termcapF ...$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy/etc/ttyssecurertsctssoftcarwindowMD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefglob2ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattr`VlVtVVVVVVVVVVWW$W0W?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%h %e %T realpathinet6_rth_reverseSHA1TransformSHA1Pad/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %slibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANGo p$p@pPphp|ppppppqq$q[%ld]Error %dsnprintfvsnprintf__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size @6L̬4  $0Ȝ4Ȝ4x8Dx$HD.XT\Hdl xll///DJ RXppa$rD$~$~W`. $,4<,ydHP0 T; X; `A $D h0| 0| l0| p xd  D t ! punblock and -DNO_CONV?, H G D  4@pG lE B @ @8         ( 4 <@@ T ` ` l h 1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:Wl55P 5555T54558L54t55h5,5T5z<55/tmp/EdDk.aXXXXXXXXXX^pgtg|gg^gggggggggg^ggggg hhh^$h,h4h~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x"" e j    ky ( JKYdu f    bv z!w" (F2F8R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directorya (Llb @B c (TTd A|e f F 4`g h  i Dd|j ܲJ !K $L Ddm |n "p H$P $q (Tr " hs !S !(8u "$HtV 8w "x (8DX APxy z "  ~ !<? |# \p A|   ,,`... (interrupt to abort) (press RETURN) H458 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUx &:x$:D:/L:t:@+|:;+::,::@%:&;4*4;^'`;w)|;;(;;p$;(4h$<4<(<<P=uX=p`=\l=@x=l h ____X__X4 _ _ _ v _|b_L__` `f` `4^(`h `!4`"<`#u$H`%`&'L`(T`)\`*d`+p`,x`-|`.`/`0`1`2hW3^4`5```a aLaxaaaab(bTbbbb priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP ؠs vGgsg%$( 0(EHC P E(  0(EHDHCt=H(2` ... ...9$p|<@@@@......<>4 8 | ,g4L{}abcdDgGhHilnNpPqrs tw xy !:#=<2@2t> P  xH<L\lHD$dW0rXP$ h(Q08Q8hQ@QHQPQXRwDR`tRtRhRpS,^ _ xx:xx:xx:xx:xx:xx0000000000000000 ^pgtg|gg^gggggggggg^ggggg hhh^$h,h4h?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ 6N(08@HPXw` t@hp,AN$N  d X | X(L6068x^@6H6P6XH7wd7`7t7h7p 8$8(8,8084888<8@8H8L8X8 \8 `8  d8 h8 x8 |8 8 8 88888888888888 h888888t 8!9"9#9$(9%89&D9'P9(d9)x9*9+9,9-9-9.9.|:/:/909192939495969798:9 :::;:<$:=0:>D:?T:@d:[x:\:\:]:^:^:_:_:`:{;{;|$;}0;}D;~L;p;|;;;;;;;< <(<H<T<p<|< << << << = ==@=L=d=p====455(Q08Q8hQ@QHQPQXRwDR`tRtRhRpSHQJS?GMTUTC,](4DLdc p @|'(! 't(*+d)l\\T<9T<:  U<;tU\TtUТ̞tܨ4l ȭ,lܮ,zXzH8V8V 1 1P .shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppŒPPddv%9dP?PVPVITVTVNX`WXXV$\||VcVj`s``x``TT`#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 33 $U 600 ;; systrace) M systrace c 50 0 644 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 usb0 usb1 R usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio diskmap vscsi0 ch0 audio0 R audio1 audio2 fuse pppx hotplug ptm local wscons uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 video0 video1 uk0 random tty00 tty01 tty02 tty03 R tty04 tty05 tty06 tty07 tty08 tty09 tty0a tty0b apm pf R systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi @ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0ifwd0jgrwd0jhwd0kirwd0kjwd0lkrwd0llwd0mmrwd0mnwd0norwd0npwd0oqrwd0orwd0psrwd0ptwd1aurwd1avwd1bwrwd1bxwd1cyrwd1czwd1d{rwd1d|wd1e}rwd1e~wd1frwd1fƀwd1gƁrwd1gƂwd1hƃrwd1hƄwd1iƅrwd1iƆwd1jƇrwd1jƈwd1kƉrwd1kƊwd1lƋrwd1lƌwd1mƍrwd1mƎwd1nƏrwd1nƐwd1oƑrwd1oƒwd1pƓrwd1pƔsd0aƕrsd0aƖsd0bƗrsd0bƘsd0cƙrsd0cƚsd0dƛrsd0dƜsd0eƝrsd0eƞsd0fƟrsd0fƠsd0gơrsd0gƢsd0hƣrsd0hƤsd0iƥrsd0i@ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0ifwd0jgrwd0jhwd0kirwd0kjwd0lkrwd0llwd0mmrwd0mnwd0norwd0npwd0oqrwd0orwd0psrwd0ptwd1aurwd1avwd1bwrwd1bxwd1cyrwd1czwd1d{rwd1d|wd1e}rwd1e~wd1frwd1fƀwd1gƁrwd1gƂwd1hƃrwd1hƄwd1iƅrwd1iƆwd1jƇrwd1jƈwd1kƉrwd1kƊwd1lƋrwd1lƌwd1mƍrwd1mƎwd1nƏrwd1nƐwd1oƑrwd1oƒwd1pƓrwd1pƔsd0aƕrsd0aƖsd0bƗrsd0bƘsd0cƙrsd0cƚsd0dƛrsd0dƜsd0eƝrsd0eƞsd0fƟrsd0fƠsd0gơrsd0gƢsd0hƣrsd0hƤsd0iƥrsd0iƦsd0jƧrsd0jƨsd0kƩrsd0kƪsd0lƫrsd0lƬsd0mƭrsd0mƮsd0nƯrsd0nưsd0oƱrsd0oƲsd0pƳrsd0pƴtty00Ƶcua00ƶrd0aƷrrd0aƸrd0cƹrrd0cƺwsmousewskbdƼ st0rst0ƾnst0ƿnrst0est0erst0enst0enrst0ttyC0wskbd0 apmapmctl biodiskmaprandomsrandomurandomarandom dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08`KT<  KT,`[~ [~KT`@@<@TU kTwhbkTwwANTG^VTcf)VTcf)`ANTVTBVTBaw4CNTNTNTMHWb yANTLST-?o(ST-?o(cANTJNTLNTsd"ANTb NTb NTLeXtVT*VT HVT Hf$hVTBVTBVTBh$ިVT`VTr[VT7ĽpxP\cAVT!aVT|VT7ĽP)VT!aVT|VT7Ľii)VT%5VT%5VT%5jbVTG!VTG!VTG!kVT㳩#VT㳩#VT㳩#/tmp/fstab.shadow9 VTi&VTi&VTi&/tmp/resolv.conf.shadowFS VTcf)VTcf)VTcf)/tmp/hostsU)~cU*'VQ4A]Y%r0C1hGb"PwHpа! sQA9^m4LIxmKvAAj*I6:5%sE0]iĮ?Akqւѐcg5481{t%V/.>0,f1IL877Dke{N"~'ɔ(dB2s?\AEN-g`w;2?NՆ%Ya(v ;;"}:/w+F>&9MAq!rWZT:p1u1 XmjSBnuqj lNݕ~M|է͎3}"H γqSKR?xq`S&ra}udۨj  EYHyoBM֑ߋe3&}5'zey`yG}[\΃3\H\XnjO*+81y'|lZXD5n:~!4i .y[f5_! . ..firmware;signifygroup< protocolszdpasswdtmpspwd.db serviceszasswd.origpwd.db fstab< resolv.conf$ hosts< . ..openbsd-57-base.pub ... .B ..ztsscale- .B ..keymapsEmisc ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _unbound:*:53: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: dialer:*:117: nogroup:*:32766: nobody:*:32767: untrusted comment: openbsd 5.7 base public key RWSvUZXnw9gUb70PdeSNnpSmodCyIPJEGN1wWr+6Time1eP7KiWJ5eAM root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) finish_up bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK=; continue; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK=; echo "'/' must be configured!"; continue; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK; DISK=; break; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $AUTO; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _prompt _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn" ;; svlan) _svlans="$_svlans $hn" ;; vlan) _vlans="$_vlans $hn" ;; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]] && isin ${_f%${VERSION}.tgz} xbase xshare xfont xserv && continue isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi [[ $MODE == upgrade ]] && rm -rf /mnt/var/tmp for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/usr/share/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return;; "?") [[ -s $HTTP_LIST ]] || continue less -XEN < $HTTP_LIST ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } install_sets() { local _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http cd nfs disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && METHOD=cd;; d*|D*) install_disk && METHOD=disk;; h*|H*) isin http $_locs && install_http && METHOD=http;; n*|N*) isin nfs $_locs && install_nfs && METHOD=nfs;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [[ $_mp == /mnt ]] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } apply() { [[ $sshd == n ]] && echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags=" >>/mnt/etc/rc.conf.local [[ $ntpd_server == default ]] && ntpd_server=pool.ntp.org echo "servers ${ntpd_server%% *}" >>/mnt/etc/ntpd.conf fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi aperture= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } feed_random() { (dmesg; cat $CGI_INFO /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _rf _ifdev _mac _mode _server _lf action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' $_lf) hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" done if [[ -n $_server && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,}$_mode; do _url=http://$_server/$_rf.conf echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $_server ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${_server:+http://$_server/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $AUTO && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# totalx"""9 ,C"0C",C"PC" J"ERLl"CEtq"STDe"SLn"RRm"CEtq"STDe"NM4m"h"CLr"0PLr"0RE,e"@RRm"CEtq"STDe"PXHs"j"TF-\F-pH-F-lF- bb@bp#9.(....$.D.&.b)hl//.PK/bCԎ**Е/|*$y*bl`=*R*o*r*k*bG0H=0F0<0L0;0b:7/H=0F0<0L0`G/$//b<x.b+0/b,/b)*H=0<0L0*b*H=0<0L0bG0H=0<0L0G0*9tbb'@@..@  XdX@bbb b$bDb0bbb4b@ E8(@AAA==(A*bbbbbb bbbbbbbbb b$b(b,bQ 8b8b < +80808|18l28000C90T0L0C9 1 1 1H 1 1( 10 18 1@ 1 14 1 1 1 1 1 1 1 1 1X 1X 1 1 1 1 1 1 1 1 1 1 1L1zaurusvi61X71<814^1]1ʏ$$$$$$$.$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$l3̥3̭33\33$$$$$"\"""""$$$$$$$$$$$$$$$$$$$$$$$$$l2b2a22=2;2T9\e28p2d2d28@t2z2P9}2}2|2|2|2|20|2|0000000 000000000$0L0t0`00<0d00000 000P0`0p0000h)1D)1d&1h%1@$14'11*1X 1h(1L'1 '1410~22L9Ht22x9P2l292922Ġ2}2}2|2|2|2|20|22$2020T2\20 0p000082@2L20d2l2P0`00000000 000@0P0`0p0|0009\2԰2L2H222ܥ22ȣ222d22(22ģ2|l2282X!x{x8{9 2420 -44ddd[[d[2d[2d[(Pdp[p"CRd9p 3\3 3c0c0' c'55$s ?/ |435333 33tA3D=3;3:3 9-9(949<9D9H9`9ARCp'G3E3D3`C39Q3H34J3H3P3H3 I3(I3dM3P3xP3,O3,I3]3lQ3dQ3H^3Q3\3(Z39stdP`3d3Tb39bpe3k3hf39e3e3e3j3e3f8@lm3v3p39w3|3y3y3px3 x3`}3x}38}3X3<3@9ą3T3P3h8$833$3X9th333@38l909L9\9t999999L9\9t999988T998Gl#9H9333X33339 3404T3d2d33` 444++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyT94T 4h(44444(*4*4<04+4,40k8C4 >48494?4?4|;44:4D:4|?4:48;4l;4????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1  c cwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|+Li#(0 \it1L &%D/ƱbXh' Q)0W07a5@S,Q"[XO2hgػb$y!"!,~ t 4.Lp(p2054<|"@!(1 R+dAH!(XL0n@'h&(/2 N6Px.(#8H c0bx6h@. l8"̷b2L'<%L؃gU34_1`q5{8gU&x4bgx$X4:Pf%$)4c`1Lx# X 'd$+D5t:&hF@])$Q 1b q.Tt,"P:~+1b#"`\0!TJ.l - #)\- b6 k7G 6Y &Lt W08y |0 (D / 4g 0`(p +L A1h (   Te2 b* d $; ,w+0J "8S D3`d 8 q b$ - Ȩb p4 `Si vi N*X 1 5t 6)X 4D5 P7 D  g c ,i8`Լ-4@,4h8\Y3JL-,[$tb82\r8N|J" 2!0 8b5,Ui@%,W+| %<3("U0)'(016Xi7I3lW3e,|q,H(#H2pR+l",3Lgc 40D 4t'e34|-$F 1_XJ%hg (t[6pi|ip/0#}3,a3xi&lx5 xi$4+/$7bM +_'dhh4~dg0$l#<M7`M94<o#pY)W7V7H2T 7$d^#t/|-,4 ,s4$'\/'(9"lG bS#[<1LjlgwH841Xlh,)&@!x!Lbli0'(D"X,78`4XF(|ebPqw5 { 4\ c \7*4(ui0]5tt3ph$S, 4)T%#T1x#!@dv+Pg\T'!TpDgyh#0,:g+A!t< `#@!&L"P4(`,c#L 10 (##8I#<[1]#0o#=*~#;,L#1#\b#8X0#2t#4P# O4(#l6#)#'$8b$6$H#$5t4$$h>$(.L$Td3`V$| 3i$PC.l~$E($P'4$d "8$2$4$8$n% $8!$ &$#$(:g$3m3@R3-lf3bo3pv&3t*3`5l3H53@03 '3"3R#3:43 b3+ 4-!@4, 24x-4A4P&LU4Xi`4,o4U 4742`4T54D&<4#4+@4L(84,-4. 5%05$;#x!5_(X4520B5P0U5[)Lf5&y5b5<\6\5(T5 (85Tb5`H/555@05!5,%< 6`0P6X8 6%d6<3*6 g463/8E6(^6tR65]6bd6L,u6$T6&(68546_56 b6b, 6c%6 !6e,<6&74h7F77܄6 -7597*8F7&la7X1j7y$87HG(7&T7)d7&t757L$7F0L7 17؜87+L7[4 8h45h"8%)88_!?8piJ84^8q30v8Lg8 48g8!l8;:'8:858 -8+48j#81X9 "9(<+9@",:9bK9.d[9%k94-$z9R-9t39pC"9qg9% 92@9d$`9Ā:9J79e8 :2:H6D,:)|F: [:+g:H=0P s:40p{:,b:.4:M%:2\:@4(:2d:(,:|'\:&d;<' ;D'`;#<&;^5<5;.4$B;bR;%$_;&(m;!0t;X 1;z% ;`4)t;L'H;!;P8;Թ%x; a3;!; i;̎-<C&!<P04<X-,J<,Y<Е/, g<&q<xi<8 < <7<*1X<Y.p<t+ <(g<#p<P(4=o5l=h3l=v(D3=$.@@=.dP=DP)`=Ժ p=X5y=0=Q%>%>6`%>lW,2>z4HF>bM>-i>̈7An>cw>3x>u1 >b>L2 >0>'5>d.#>!>p">4g>P"l?8 ?th?L"6T(??*5pS?y/ e?b{?1$?8b?x5)X?`1-(?d])?$?&?b?4c?3|@1  @D8 ,@bF@*V@n#c@*Xl@h4 {@(j6@6@4-@3D@b`@ @l P@@2@o24@--A$~&A6 A# ,Ahe(AA',PA4cAU*mA H{AR8xAB7DA1ALL'HAȥ 0A bA5AX4<A&tA"AcBp4gBb Bd_%&BXY%|1B̫ H4\Nh.N.t N2pN `.N7Nd#pO4#LO4~""O?4U0TiLU'[U#oU@2(U\ Ut2UhQiUpbU%|U@54@U/UL2UP)\V\tiV̭&HV$&'V('x7V"IV@! ZV5hlV +HxVl6-VP 1V0P# V-VPb(Vm)V#`VD!Vxv6VxiW1Wb 'W#L3W 5>WPh"8RW HdWT 7xoW &DW` "xW|8W&WԱ#W% W$W+W& W+!W7 W!5$X&@Xbd;X)FXcOXll&VX bjX\(tXi-X:X.X0:gXb$X?(pX2X(#DX "8X3 Y,4xYxi'Y 59Yc#,FYܔ2dY`D'F`\N%K`$W`&Dc`')8v`d2`Hb`t(`|6``"d`"g`c`Tc` %X`Ȏ6`(aq(,aq18abBa.QaQ)Za+kaLgua$ba3\ab(aqgat2HaTx,a\"Xa<>2a$b#b|P7\$b%<6b!$ Ebd+$Xb#ib; ybt+bhbgbuib"`bcb,(pbp cbt2DbX.b)%cbcD20)cH82c;g>cxw&HcTP&^c$#`rc$+`c(#(cċ7cV1,c0.cp&<cLr#cȻ!cd7Td`r.*dl:'=d$TLdui]d % fd5|pd܆idpo- dЮ#dp$$dbd<"gd`N1d(U.Xd3(,db#el6De.L1ez.Hel4^eK5 rel.e -ebe74e*(el$et&@e1e47@e/7eD,f`.f<#D"f +2f|&$d@f7Mf'<^fPhkfPbzf !4f|i f8'($fz!fxe3fx:fbf@$.@ft)f8bg(4gl"&gd3@6g8z,AgHb$Pgt@7]g$mgyi~gD,g465g+8g,gg5tg0gX8g#4g#hX!dhy- *h6x9h($Mh5|Xh1eh18uh$&hR!hX3h bhh2`h,bh.dhs.dh,j&0h hi%h iT/di -+i67iĄ#`Di@"gOi7([i}1pgi'Psi6<i!5i$/iU.i,i2i'iP it6iB3 j|"j2)j'2j~gCjP.4Sjg[j(iej,LrjHM1j+j-5dj-lj j0j1\jhb"4jD0k8) kY5dk''k<[7\Ak(HYkbhk7 tk48k2k2k0k4kdn*tk-(k(x6pk<-4k2l- l1lT/#lP+3l M4pNl\gYlLgbld6$tql,3Ll,!6 l ,lhTllb$l"lD!ll#dl=,\lL+`lx'0l,"Lm#m7-,#m7 1m64=m@5`Gm t+ Zmؓ$gmt$qmp 4m$)5mзbm bmU(Dmsg m4Pm,$ mbmqg n|N4nTM7H2n-T?nbMn& ]ntbmn0%Dtnh5 nL-$nhln&Dn~2,n(/ nsinbnL2Dob oMgo`,#o,202o1Eog.Vobio |o;1os-`o0.!Lo2Ho* T6413+df7@L3pL$,<Z2(jb(x`* R58\,`%l_'LΖ&@ؖX!<x'L[(  5$*`#<4$?HH7L+ \w$sB"4gX5$R.l2ŗg(30b 0$3$4'r8T2x'=T&HDt(X=2Dad10sb\C)"@@b|A7hRt97(_#6h6`st0P&@"(3H'ř06`ϙbݙ$'L&4\!* L8 +L4l=bJb4V6tk@1'd[#xP3_7Ě6ԚH4ܯbL^( -@ ($p6X7$5XE 1R3hgs'p̱bgp6-6X4L7Ǜ|(hכv3(X&\lT*X(]"$6H6hGp(Yv(4rP($X& !p X 1HbĜ3МbߜT%6}4 4L- "g, 1L6bQu/c (n 4Hzxt+ !Di*b'4pJ2PŝH,2ѝLb8-D. V!@81 53\5H' 1<-N (|X|_"Xg`5qr$X$/Tb&d$$,Ğ_"LԞ,0P'_'H: 08\0H`6%?,p3\+(A6MT1b0Lw"\z%Pv2a0@+L8h&ld5@ yi˟Tm10ߟ؊"4Th S,<#|'b64F 1TT`5c-3{ 1&&g68P'à*PӠ$,ߠ;'qg$He.t T442v+8AgL2L`ir:,`0o)p6(pbb(3ա'l_!45@b -g)Hb7HDp'U~g^3q(6|% BgTKt$xSMgZ!k:'%bpj-0 c685|.դV7L 5@,,*4  Db1+b8"0K\%$l|"v+: 3hx7 10ʥx9'<ץ <7}'{%d-@)%p1| HFxbPDL+(b|+r,6b#%$O&X g¦$ɦ5gԦ'"8}2lu+D(&D7 &63,I3<JpU,LW;ga PnL%uXiyb&D#|+5T\4ǧ|b^)8 0`C3$|)(\&(4bD8KP6V&<b,|4yD#x&XL!h%8 68|2PӨ8Ri.X(\R "h5bJԧ(d(l}-54+ܰ'#h&©T2ѩDJ X3x-4o)$5&L&(&0.4A3tQ1^h0o&x^6P\,c%.|Ū Ԫb)+c#2Ъ),h<(<Q46H]ttij86t03<". t  6N*8ë|'ӫ"T+H5# 84`ht&x'1-@6tT.`8.ll1<@b(&<0$4,Fg2LƬ*d֬X1pxh0524b Db-$8i$*$l94D\v3`XDx-rh+\V58 8 L@7(a0ŭb٭c 7DgIg b350%=4TN2fP'r&0|d.\w4p.-i0Ʈ+-Ѯ\((ܮ $*00&|(d+U#(8- hG$Q4t^'6h|htlm38&l1TU%@&(m3ů) 4 D(DP"(DU%<5W%>S1Mb\4$j/~b`Jgؒ80bh*D'Hɰ8 հк+a%0"}- -t1 ,`-%7$y*B&8M (f00y8 4P6|bL'x]#Tl cu}2H1$bP$XT4ó$P5ԳQ3L0FgX5Ԏ*$$6L#e8`90O4bV4k.20{-!TXiD3/`P"`д\"״h&)<"( 3$p3%p&3؛&4@t,DL1PV0iL0p !,zd 1f0 b422&(DƵ&@ӵx$<:@Y3 1 b"15|>XbL`b\t#g5t.`4-bP74:g,a616\̷!!X׷e3P\.xbqg ("\3l")0"A5K(Z3_K"lH"gxh4#-Tb<1c¸0g̸bָ@2D 3,b-+$h9g0D&|N%DW*7cE+q0)lb2|f1\bH-ƹlS,ҹ81(@G$t2D1hԜ,*2x:h4BB(N=$\ Vi[+2g6xL?2 (8" 5p|'l0ViƺĨ8 Ӻ!ܺ`4p$ p('#@"152=l2<M&T@)4^2nh0w1.-8''PhO)p»'̻05"4/`=#0 x%S" ),!88e6DԿ4LVĀ0dcЖgoz.}yiS,<E7\k*X&D,5ȼn1ռ#@T7p&|~iP"X*&0L"g;,O-TLbTbbp6p]38bF,4`VLW0 Z#|c65~ P,Z5 245\*g'l !  p4\xb((<)g2(X084ELD6S%d 5o4px\1X\#dV/ -*&,%(|tb  t+ 84T7 U+HB+NbW0gDs5,qa3 (0,4.L/P,.|4t b6+b@5T"36/JgV,0cW08j4| &8,Vi@V(TR'8w"e38 <tv+: :y/$Ȇ-@9hId(e%do01<~m&,(D$ +f#Lx6p̥3ui@́&|6@,6T#0$,'dQ3=-Rbb$gj X /#@ 0(8`!1#8<1 -y digl3 " PH7 d15z#`D6 /D4+<.4X"&p(&@Dcp3b$lb$$68((Y7`;+K S@:\P#Td*&@uh3`}18 x+#8 `L)P#\(7T,HO9+[4#`h!2{\u+R&<_8 k-u,t+ g 4||%a$0lb\3 ,w$T 4]0T+$p+2t70, C($XV#_(!kpb\.4%63D6 2$.84)@@[.hh%2i#&"+X^5;Ш8 K~4h[l q@'L7(#T5Xq4l!060)p( t54<+"|!4t0-AG1OL)HZpbd6{20+6Dv.(B+|bȳ5|$S&\"$+  (P!!1 2d+>v8L\%8R0/!$]L/q<- |V1j$@#?gN&l54&-"Xi "T5%P(8b%,@xJgN8!`\ (dn --&gl !L'H-&\8 X5\ 1p+, -i.&9t$|M!+]x#d&o0|[)L(0(bР1,0u,(&#(6l.# 3<0yi..$7X^0?(#XN`0a-s5~r2G$l9,<$|V%h)1+Dxh*Xp)Kܒ74Z"aR5`q2y%F/33-48Di/gh!4104(L&3t<P.IwiPv.<`D5nH)yJgm$\"t~'rg.8&D6(8`0n%b +#$.p-\C" H0cP7(\+q0&l816 & @\b%-ܓ)l(4k3PH1H+,d:x+E/ \X,HLo4`\1gW/{4'<3 <%g#D plv.pd&0Ș5 "*(P.>\#H@V6Sp0fY7~K5|-"*Pt4XW4(4y5L4D,bЍ%$xU7:dv8@J18R<;!b5duc$7.8̱${&(4Xlb 3\7,#N6`(%\5,&((^00/&<5XI|(X^/!n`M*lI7dW0 `.4gxc,T.#4|8 'h+8!  b) 64F0.$Zhh#t8 L*/ L#x8I-P$T5xP4Tui4/(08X"P36t)\ *7̖g>d20S %,Z(<m*&ģ2hD:4@3h|%4:e8]10 c, d 7 4(- 4(<N&b|\& bc&N! r&K7`&,^%|&p8&,b&px3&N-H&h$`&Jg&L#&5 '#' '\3<('V!.'{/\?'`8 K''5a'b(,w'4x'('5\'3'|43'g'̠4 'r18 (h($'  (00( 8A(%J(0!5dW(3q(x+&@((!(0p()6(%d(,"|(g3(82l(-&(<8(X"($b)b )^)) ")63).A)8L)gS)MgZ)`6n)84 )#.@)!) ')P,()$b8)R#H)")")4 0*b*%*Z(/*v87*3A*Y)<M*h`*(s*({*-*7*\b*C"*$z-h*ܛ8*b*x3+ b +P`%+""+P'4+0j8F+"tP+0c&Pb+T#Lp+#+'+"+L-+b.+`b+ ,%+P3d+3+2,t6,hb',pb2,_%8=,$I,(bP,m/\,%Hl,gu,2$,l"g ,̆6,,.x,2h,D5, 4,,x6D,6,y),%,,( -@:g-PS2-:5-\6LH-5<W-p#8b-t3Pt-4/-Tb-$"$T-b-'-Df6-!-T60-42-D:g. c .G0.xb%.S&+.$b9.@b7K.!\W.'`.5\m.%<~.1$.|2.b.H: .#2.`1.,*.. "!.\1/ (/H+P+/)8/J%@/$. H/N)X/x1f/ 1/,')/6/2/P"g/ /D}4/dJ+/0 0i0Db$)0%10+!T=0X2P010n0#w0%0%0f#0`0@07l0\30Q300r(0"00!0 1 b10/ $10616<A1iF11T1 %c1x"pj1&xt1x.1D?g1d3H1Ti1 b1hc1ui12!1 %82# 2"2(b*2532K.V2b c2\7(o24,!x2:2L.7(2f8 2Ui2)2T32i2t0 2@6 3/`35<$3h13'P?3K%E3(S 0U3e.d31@n3t2({3b(383032&83x&3 g3)%3 H3'|3c# 4b( "4pb04M$84.89@0:g:Gg:;-/:g?:ܮh(J:x6U:.e:iq:Jg:M-:#<:4v- :Xi:b:\>(:%T:5:Ƚ6 ;@-x;x"$;4X2;!V;4P4(j;$s;[%$~;T\&;$b;si$;4;Hj.;0k!;%;8-;2 <\(`<@ "8(<\+2@8<g&A<$a0G<?gN<#[<&d<x(Ty< <5,<$<!d<,<)<W4<g<%<p8<i <\V0H=g=x% =31/=HO8>=&<K=LV7L[=`bc=@*4@r=Lyi=܋-\=h =4g=i4X=1$=c=@c=̓7=$,=i>g#>L*X>TI$'>n6;><5J>PA3Hk>_%d{>;g>P}+>4H>}3>ȣ2`>g>U%0>B!>6>b>8?#?,.%?l2(3?( 1@?h^3xN?gU?6 @L<(HL<28YL '(hLp)tqL!L08LXbL<#(L#xLbLp PLdS(|Lh&L6  M.2Mb"Md#0M8&;M@!KMh8 \M&gM1`wMgMD"Mb M,s-M,|MD 0M*0Mf7TN4&N -!N̫(5N,6>Nv8MNbZN$,dN$txN24N "N NL4\N-TNV&Np$Nq3`Nȿ0Np1N +&Ob$ O8>Ou$$FO&LPO(5)PiOphqOiOgO#Ov"OpW6OxbO\5lOxA4OW&O<6 P$5HP7$$Pg41P$(;PT,FP"tNPt25dPbtP)P$TP%(Px0P2"PHm&P4PČ+PL08P88PbP2 Q6Q%"Q%/Qpb 9QpbHQ,H"XQ],eQX4wQ,,`Q QbQ&|Q&Q4gQw3(Q QH-TQ B)Q" R H7<R2`$R0 -R|#6R %$>RP75SR34[RbnRH4-$R(Rl2 R)XR 6R) R"@R8Rl1R\y44RrgS": S1<$S&.SH2>S@!KSX5\WSx"(^S$LlS0 D}S#7(S/SgS&lSL$ScSt$'S@#0S1HS7TT `*`Tܓ7(T4 c1T 2=TE1LTV*YTh%gT.qTԡ+T '$T&T"TX% T I3Te(hT1xTL*XTt'T\b U|#DU2D"U2-U4 9U(b(UU_5@jU-<Up"U4UbU:Ui%U+0 U5DU6U!cU*%0UrgUȂ$Vt P$V7.V` D=V\4$IV&`RV6aV5tnVb}V(V60V4Vl4 Vp3DV',V(4V%lW\/ WbWb #Wz#$+W&x7W IWy-\WhgfW\' tWlQ30W$WP6W g6PW1W 1WDa"W60W4`Wй1Xjb#JjP2!8`j18qj6pzj -4j|~+hj&DjgjB7j#0j0J2@j)1j0jm6-Om40cm%nmHH1{m /$m +mL$ mrgm#@m*4m#m mO!m3`n-4@n-n&-n3;nP28IngSn|18bnt6Pqnn4n.dn'Xn\4Tn*&n<(n̈-n4%c n\+)op@( o$'oLb oK35o(KoH! ]oԡ(Hso#tou4oTV*ogpobo`3.o\p% op%od:o58o?4, p(0p؋"+p( =p})JpbYpP;)epG/jpdbtpb{pHy,p\.Tp'p sgp&Dp|#p "plS7p4lpY&0p )hq]!@ qD(h$qT%03q|0Eq/,Xq1kqD(dq89'@qlyiq0qgq'q|i0Pq<(4qbr(V0"r Z#X!ri1rh IrP"\Vr@o8br`_+or*xyr*p%r@;(\r2$@rt3r(bry(r M6Hr)xrH)r8 hs/  slz5Ls3/s4\Ls0Vs*cs6ns,W7sx6sh$Xs4 sH)st=&Ts Ts 7Tsbs/t8bt@N#(tx67t@/8Dt0Ota%@Yt!$8dtP ,`mt:({tp6t-\t"gt"tZ,tH#t!!\tԉ$t|}7tt.78uh2p utb%|uIg!u$x)u 'X7ue0 Eu"pOud6`u)2ru`U#0uԂg(uiut+ u{%@u0dutK1u61uP40u3(vHd'v(b'vlv%x0v\3?v^)\KvL'Yvpyikv0k8(|v|.v"v$ lv,6(vP-6v<81v$d#v_# wiwhk'0 !w&,wxf$|X%J| 6X| c<f|.t|