ELFa( 4I4 (   ! ! !AA((I)j)jlBۣeIjj$$ / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R aIР -L?v 9)jlp1jmain() returnedTXp   !,@@(TQ 0/liXp - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-, LP 0S P* p4 ` ,  0P,00,0p 0 $0D PT0T0S , , p -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,Pq K 0 Khgo>o> p-LM@`P3PUOx3e H0 PI00 h0 \8?3 @88943  : .+o>o>xD?o>o>o> Q-L@0 p> p> -PL4p`V$ 4! ,0 w0 ,0 000,  ,  0h,PV@0D PT,0 0,0>W?$p>,p>8p>Hp>Xp> 0-0L @P ,00,0 R 0$ 0 00  0 0㡆,00,0 R$ 0 0 00  0   0;00h0hNnNn -@L|0  0;0hυ΅h0n -L` @;0 0n -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  8u4S0=0Sh;K b4S 08#8 00L$H@0@@000 131C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd܆0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S2f0W6 + ^00` N00P00Zpd3 00X3  #/0W  -0pS0L00@`% 000PU00S`U \    8U ,Arlp>xD?p>p> -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h 000 PxXp 0 00 hp> q>p> 0-L@LPZ ㍅0( ᅅ0( 0h|' p-L@`@ sPUP00SdXP ?lp  000PS p 0U 0 0 F0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Om@ ل00000@TP303p8P060 0 308#83 R 00  ` @V00宂h,A p-L@[ ㎄P`dU  0い00PY YR`pp 0-LP@P 0.daH@ @0cP' 0H@ 0V 0' -LM0` Pp @2;0S3  09P.0  0*0,0K0,0 Kh*  KhS0S 08#808#80KhP  0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 Pk`0  @ἁ0@  0㪺0     -L M0PSp 0S` K@K ]PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 偖,P000Bl0  MPH0@ DP0 0 0   A p-L@Pᯀ04`Kc@p -2L M PRl2   ``0KST2`0 I0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 姁3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K{0 ,pK Q3 00,0K,0K3 f @4  0+@K*K( 7#t003 P3,00,0PiA T ,ArP  ӏ 0-L M|P@T   P00 K0H 0@`@,$0 J00HADq>0n n p-0QLM@`  `UxR P 0P ,Vx p-0QLM@`  `gxR P P0\Vx p-0QLM@`  `4xR P P0XVx p-0QLM@`  `xR P 0P (Vx0@- @@  P @   0 0< 4("4!̃,<,$,W0U VT0-  00  00 0 <4("4!  < $ W0U VT0@- @@P  N      0 00@ 0 0 0< 4("4!̃,<,$,W0U VT0A-P0p K Q,@ 0@0ll 0$ (, <4!4"<0cT$0 0!$` 0@0ll 0$ (<0cT$0 0 0 $@ 10ll 0$ (, <4!4"(00c0c$010ll $0 ( p- L0@P0  Pq>Xq>\q>q>q>q>q>q>q>q>q>q>q>q>q> -LM0@p  R 0 QP@ TG 0UD0$UP P 9 0S0U00T@,@ @ P"0!B203 0U>00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0' 0! <4("4! < $ +0) *(@! 0 T!0#40 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sf0Ib0 ! (0 ! xA< - L0p @05 $P i\0$ , P0 * 0, 0 (0 $ @ 00 10P@ T`$00  0(0 00 $0` 00c0 " $;#;c 0 $ @ 0q> -LM`0 R @p  t0 ! 0W0U V T0PS  0 (0 0 0^W0UT0UQ< 0RP \ S 0S]0A@0!0?30P0200 >0!0?<0040!000P000L! 0 T!0#4 0T!0 T 0|Pb0S  P 0HT0 (00h Hz$s> r>B<@r>r>r> -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 s 00! 0W 0U V T0 000 # 0!000S0 x\s> 0-0@L $0P0 Td{0 T0 p-L@P4{0B $C $`P UCp0R $0N $ PR R @R (pt#0N TpD 00N Tp꠆t>s>s>s>s> p-0L@ $00 TP"{x0U 0 $PpD0@P T`$0 pHt> -LMp @0Tz 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP0@00 T%020J T0 0!0; T0;V 0O $0PM T0 ;dpz@ 00O TM 0T@0O T0 3 DT0R $   0 S0C1 006z0R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0g -LM0p 0 ,0 G QE 0㊁8 0 0,0 : 0lppl 0P`$@(,(0 c 0..p .̠p, 0((< 4("4! l0.̠..l l j!lo|芁 0p llp0@P0 ,< $4.4,$  0   :4PP  K PB?P0`  0 PP! `:PP 1, : !0` , xA<B<,u>t>\t>t>t> -LM04 (@T ,0  c = -LM0) (@T :  -0L   1 <4("4! 10!, -0L @  <,$!$.!0\ 0- 80"(,#@L(P 80,#(0h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\Lt!`!!A' A10C0  101 - 0$N)` ,0  !< 4("4!,Q 0$\!! 1! c 100 Q0 0 m $0!00| H< p-1@L`$  8Q 01 ph6 -04p@0aA@ L'00 P0U Sd 480@P8 1080 081Q0C1 -LMP@ 5pP`( @0 0  B0 P` (0K0 0 *,P 1 ̄`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  ĄpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@ ! 0!080|00 1 !?\G<4A -0Lp`Q@4P @T  48 1 40! T 1@01P R 0S 000Q0  PU@0iPu> -LMp4`0A张TP 1@ R  P 0 < P,   ,P@@0<80 P8  \ 㣃  0Q0 , 0!\u>hu>u> -LM0 @p`10! P0UQ@,PP G/Z$ 0 u> -L M` 㔃P @ 0P GP0  P?P@ 0  00s0 00  0 P@ T0@ # , 0 , 0 0`  40 0P Q  4,3Cp p0 0$ 0"0 0 0! U0V0WT0<80 (44 <0 (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`4 <4("4!@0.̠.$.T  0$0 436("$ 4$#  4  (0 080 8 38("$$# ( 4 0 04 "4 4 "438("$$# ( 4 1!0< "8 < "838("$$#  4 ( ! 10# < 4("4 ! 10...̠ 0" ! 1.< 4!4" 10...̠ 0h" ! 1/< 4!4" 10...̠ 0 "< 4("4! 10 ...̠0p! 0Q1R1SPq ]p0d0 d 0, 0 , d1p,0 S@Qqp\10\!\(Kop, <48 ("44 $" < s  R (KoL(Kotq tlPT@@GR J0!0 PU@@DZ(XH0v>hv>v>v> 0-PL@5q $ d10d!@dA0hp 0-PL%q`AT R000d1 0  $ qp0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@sP(Z X 00 0 -LM`0 1 0! TB@Tm )T 0(0H$0S* 0  (@T    $0  $$pWN W 000(Koo3T T4 0(0$0S(@T  $0  B $0 $00S0(0(T0 00$ >00l! l1`la(K$0S0$0,(@0(0P,@0 <\_0] ^ ,p0 0" 0( @ (    P(\ $0@ Bh1S0h1la`hal0(0mHw>dw> -LM`0)C >00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I L S @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh L2@|P".,2@|!.@ 2|0 S0Z/C1!PZ/B1! R0001 0 ~Pg?P1pPA TP 8~0P80 NpP0) (\ 00: 1>, \  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @PB<(AI<I -L M4 l\440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0K2 .0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 02 @PU04 l10 0P,00@,@ 0 240pAT$00 0P0,  @,@ 01h@PU04 t10 0P,00@,@ 010@T, (0  0(0P( 0B0 1$ $00CS00$0$00$(  R000,0  0@ `U(K004000!  L40%ew>w>w>x>0x>Lx> p-@LT`L01 <0kXmP(00(0phllx> -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wm 4(1  (K0 T0S 0CTTZ >ΟW@ 0 @@@@ad.`#43p KW  4 0 80 , , 08 10 0@ 0 $<0@  @A , , 1@c , L W5 0) !0 "$#(, <4!4",  y@Lgnd Ha mB0t033 W  0 $ 0\04 $<0@ R R , E@10t03%5 W 0$040 ( 0  0!"4# 8<#L4TB@ 1p0, \, A , 8p 4p 0 W 4$0< 00 ,P@WF $0SS,:T 0CTj 0 T 0CT  40S 40(0, , 1@c , d 0 0@P; T`$00;  @_ W 0 <#0! " l$ ,01fs 1p0, \ 0!"4# 8<@Y 04 T@ 1?, \e 1=>, \W[! 0"4#8,T@  ` P> T< Z =0@P, \`,0@, *7T( 0CT  0T>04 $P5 $06 p$10!Rh 10P AT 0G?, \xRM H`0 ,@, , 1 c<0W 0$04 ( \bYJl 4P V>@6T 0T05 $0<0& 1p0, \5T |0T0, , !b4Q0(0U~|b R\ 0B< 4("4!̃B,<,$,O0M NL 1=, \U05 $<V@)0 $P` #P 4P ^.0hA 00 .x>P#?d}>l}>x>x>y>y>py>y>P}>x>y>y>x>x>x>z>z>z>}>d|>L|>z>{>y>|>|>dz>|>{>(}>l{>@{>|>{>{> |>Ty>800 04 R !-P\/hx:p#8 @0 (00@ 1?, \800 0  -LM0tp庐4 !0 0@,0 0` T$0p!0(0 ,`, 0 <4("4!  < $ _0] ^\0  ,,B @P  0@PC(@T     $0  F0<00% dh00t!@ t1ptqE0 PU iPU: 0 0 R U. (Kog0S00 H0(0(Ko+(Q 00`S  0S,0S0 0 0   00 ,  p  ~> p-LMP`P+gυ^O>.ZVd1t!l \|0`apahaXaa2`0@`003Ta_n@K00  坴xa a Af5 -@0L   00ϐ 8R2 d #8X 8$ -@0L   00ϐ 8R4 h #8X 8$ -00Lϐ 0R (  8$9;90@-9 0 0@0@0 0@0@ -L MM0P` ` ,0K "[@1R@ R $K2[ᏍpCWp#W)`@1ϕ R8 p (K"[`0 R2K"[0W00@ 0   00   &0Kl l0 00@0@,[@ r=@  008$ ### 0-MLM@P90000% 1 R* ?  p!0S`1 KT!0KAK=A AP 1K R000K003X000 K  0C,K AK=A AP K00C S񟗼P @ 0 000000000000$D -80)0L = *0 0  * p-0LM @+P-` x=0 0> `P|? R  (P01Ł 0PP9 x+r 00a=C4`#hh 0`x0S 408 `*  `0:0 8'0~> p-0L P@ p0`   000h\y2 0R`= \0 \ PV@ p l#x#DYp -@PL 1 `p 1 R 0 0< SY  SK  SI  SMS00-00S 꼖     1 9 0 R = Ϡ0| 0 R0 R S x0 h0 X0 H0 @0  0 0 00&$0$  -/0HpL` S ( 0 8 t @ t t t t t H 0GSꨗ   0 0NP@/TP Fh0h pᲀX0 R    $& -L\M4@KP /03K#K= 4#c[Qr Qn 0S3Q  2 3K#K= 2["[`0 2[d h0  w2 #K3Kᝍ0[[3 1C 0"Lr0!2"[08P"KKK 7 Py Ps r2">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K P1   @1\  P!P1QQZ@K&05K,15K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 \p["[2[@$I<0$ 4$z>hQ~>D~>v'N$|~>X~> 0-LMPLl0  zH0@=!0@ 9I=98  -9L@@, 000 000  0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- # 0h2V0CRt 72RD >0R@2@ 0C 0h;0CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0|1@@0@0  041@@0$1 0h1@@0 1 0 0h0@@0<D 0 # *0h 0 0R |00 0 t# C&$(60,p#"*.2l# x#~> -MLM1 0 p 000CSp(KBKII< D z0T `0S` @ T RpP@VP9 -LEMlA0SN T!000DD1 R810 S<08PK qO1 "Ġ"07K8K6 K=@  5KNoK?`FT  80[7 [6[ 00P30 ٘@  0 0$$$$̠ @  0(K<00 00''x# -LPM5 0 6 -1S" W%pP% l`KD4K 0CR@- <a KwP&6 #-1S 0q BW 0S*(K7 ( 1 0R\!`!  10C1 RH 3RE RC 3S@ !3$K R3 RYM4@ 0`]D 0 D B0000 . LP  6;6-0 0P YZK j20Sp0 { pQ2 R 0 RP TKU t >K O8K K0D"0C4K02K#K t B("(04"43K@QBK0 5[Y90K8 5K/Y*K> * YMZ=4@ B$[4[]04KD 0 D B0000 < { YM4@0 B]Dt 0 0 0C0D 0 ^5[l# >`> p-LMP <9k x^-0@`,`]V  xh|> -M LM0@cS000 R 0   9 ,☕0  K0 W0 K| ̠0KAK= APA>K R@0 800Ba*"0$ >Agfff 6S-LP@ 8S:  p ?QX8  #8 0 8R`X  #8` p@@D/_t T? R  (9Tp<>8$ -LMp0- 0 @P  , QPE^u@ a? R0 ` ( U1 ?R" D ( ϔR4 h 0X 60mP?`VPP0ϔ PR6 l 0XU<>8$ p-0L `R ?J $ϖ<< P0T^ϖ 0Tph^p0$ 0-@LP@O= 00 @0@0(> p-0L M @RP+ 00m P PEY^u!KpUp 000>XQ01KL01K01K0K 00P0$<>  -0LHMp$Kh`KD0 ZK P H("(D0M#K0K"K0 0H00< 0 00P |  P> -LTMl p H_l p@h\0?`  S  ~  /0 ۔>P  &XG>n*T  E>TM E0CT >T >T.p 0lXX d>T \0CT 0TK  p0l0?X 4X0 X0S  x &lx\  l- 0:0}`[(K=T !=T T=T =ThpP0 4XX l 6@ x 0x (=T L 0CTq 0ThpP< R l 62 h= R  l 9R  R 0CR = Xp0X)(9T 9T 9Tl 6 8 R   k,X X 80-0XPX 0 Sv8T 0Txl 6 = S0 @Sv = l0&88 }08T (8T 8T[hoPp;X W70SKp U X Kp'X DhioPn 0jp X X'P+X0 \h7Q 87Q  Q$  Q M0XPXP l 6h2oP7 Tsjp X X<&^PXpX hoPp 1S Qj?X 0p 1X 0XPl 6 = l 606p0 0S = $5 Rp 010   j,X X0/ = XPX0 4R p 101pfX  di0T0 p X 0T 00bY"p 0SX 0 P\ d0 t U t0 `  @h ℾ h凾 ჾt0 0$30 R0S   q05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 h6P000p0\  P:p0 T0 p0 X 0T 00b S,p 0d  Sd %:0B\0 = p07@/ O,p_X p0# *! mX U  h hP_DYp p>ii i5i i i iiii "A gfffx>*#p#816i(i8i A i iii88?71B#t#-%C 0$>   0 R 04Kd0 4K$K= NK0RX 0RE 0CRk OmPT XD㓽h@X0 r 0⍽2 0T X 0 !}hX0 x Xxp  ! x>   0 R 04K1 4K1>,0X [1 R$AX0 r 0S0X 01X 0000 <XD ?X 00"0X 0S00X 00@200X0T  (X +00#@+ x xP X2Q !0Q|2Q< 2Q4 2Q, 2Q$ 3QC 3Qj\g3Q' D0CQ >0Q]D3Q4 0QVP3 RX p3  n3  F3  3 @ 3  0TX0 J4   $4 R = X81>,0/ -L> l#x#~#|#0$*04$! -`L@LtPpe@DVta ? ( TVAϖ 8R  #8X _R8  #8X _R8  #8Xϖ8#8 XqpGXVw- @? R0 ` (P  ?R  ( ϖRP4 h 0X W9 L<9  0(<<8$Ȁ>> -LMPp60 Pa 0< R6 l k ϕR6 l 0X OR6 l 0X60 @P ϕR6 l (H0P ϕR6 l (0P8$4xV -L0M`P? QA <3P 03QV Dd0CQb  80GP-sϕ R8 p 0X OR8 p 0X\  RL8 p 0= 0`P $K0S82*`K0K2K02K2Q: 0Q0SX2K?2K*`K02K00C SK 0!02K0"K*`K2K |10S: l10S. S08#[*`KKz<@0 x<SP 0 ʈQ$[P& JK  DK  6K  0 0D P 0 0@0@!&`崽꼤[>0P 7[4娽  xKⷶ0 <0< P 9 厽<00 0xK +J8@ 0Vp GP 9 `qA= G0  sPK<$'l#t#T>$>>>>@> -3L P 9Bϕ R2 d 0X ϕR4 h 2Xrϐ 0R2 d X ?R0 ` ( ϕR`4 h 2Xk[  ?R" D ( ϕR4 h @0X1 R` ".  x1ϕ R4 h :XL1ϕ R2 d <1XV 1S;Q0ϕ R4 h 0X'0ϕ R4 h 0X ϕR4 h 0X ϕR4 h 0X0 8$p -7LP M}/M `C7 #K3K 4KpP u$K豯 0K⃵ hfh xT70P9$ # |! 0<x1( ! E#  *@  ;7'p0C &006 & <06 pp0d &006 &6pp ?"K2K*K0P|6x6"[   h6Q Q Q +> 2K"K= P2[S&000  ,夒 T5B@K4K 04K= P5  [^5ࠃk5  P N@`%`5T 050 0/0 e0nT0@5ᐇ  '壻$000+-0b10Xp4 h4@ Q 3X$3}.  <42Q$000,4Q#0;04  c3^ʙ03\`0@  03\000Ǹ3L 0Člc 0後0  0᲌ 0ᬌ c 08妌0 z20{ 0ᗌb 0呌0bY Q20d 0ႌ 0b}0:1 (0O  0oE 0"i0< 0b0312 P0À 01 P 00 01 0H0! 0A0 0:0 03 0p-0 0X&0 D0~ 0,0u 00l 0 R 00I 00@h>>>z>>+ "$&206t#(0$ 4 xD?>4$'j)'_eNa;@20*S)20S S S:9 -:)0: P0L4884#8 X -9L 84 0X -0"LR@ "8p 1?0c4X \804H \9<984T ;\tgfff -h0"LR@ 840X \9<9840T \9<9t -L8p04P T804P@T T`$00T 2S S 804P@U T`$00U 84P 0T804P@U T`$0 Q- L Q Q T0TT 00H0Q 8= 00 900) _ > p-PL`@U 8 04< XV V V\ph 804< XVph  Eph > -Lp0 6H804P@T`$00P dFN804@PP T`$00P 4N804@PP T`$0P d#NȀ P 804@PP T`$0P  -LMp,  804@PP T`$00P dM804P $ 08#804@PP T`$0P dMXʠ,0尐 -LM8pK@4P0 P T`$<<0P dMZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K 0-L84@7 0TPPU bM8047 $U 9  84 0T0ꘄ> 0-8L#88P814` \@@6MT 804` ,PT 0h&M괄> Qp-L@ plR 884` \PP MU 804` ,`PU L p804$p德̄> -0p69@!<L9∏6=6804@PD \`,0D 9_;?847 TL84< 0X8@4> 1X P 099@[h3S <0l$h0h3@T@\7S <0$07@T8047 T9 O|L@T 804@ , d Tx9OhL@T 804)$@T 847 0T >> -LMhP b0hPe 0 0@0@0/"-0?0b b0h#RO <0(pC\E 0p 00 <t7(r\ 0p 00 W2@x7t#<0x7(`V l $0  B< l$h+0h3 0 0@0@0 0@0@t7rW;x';Q;0h;š 8)4@0T -PL@p`xJ"0R  0iiIVT| \ \ d l t d 884#8XiI 0af h j {b t(> -`LP@;J"@1pR  T@IH$TUU* f U XU  -uIUpIU Ud 804(@aIj 804 $804h (@804b (@@t(> 0-@LP20" 0 -LM9`L P! ;  5R7ڴ2 0! 4! P0<2T1  l# H! @5L!PB P2 7@(K, KL, 0B aP0C ! K , 1 !A$Q !&L02L1" 9 0   4 04 01 4 0! LP -LM6P=@S` 9  1S l7p 0 1S* WP. 020h#Rn KgP007PPbS( 1S3 W 00 @0@1S0  BPr0CW 08l7)@04T061S W LpP  n 00S: BP  10R\!`!  10C1 00S: BQ  10R\!`!  10C16;6 0-@LGP9  G0h- 0-LM'P"t.0  @@RhC0<(\ p; B$0   7|Gx7lGhG8 -LM"P n@P7 "0 0 0 y<凁0g 1 P 7(K<(\' $0 <嘩( \,  0 00 < (\ 0 00 Z W90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9l> 0-PL@wr@P@T g7P90d90 -LMt34 Kɐ< 圩P<0\ ^ 2SD 0/"-0?0QbO <I( b\C 0 00 <p(\8  0 00 W11@㔇Й9<0C9(`V  $0  < $920 0)R1ȉ01)̉̉pW8 ᜩxP4K|} (K"1 `R@@  V 7SM 9S0F0 0 P 20 0 Q31 A0 1)ȉ0 F99 9  8   20280 :S 9S2024KV  2022:S 9S) 000C 0 0 0@P0@6 0991(K<t 0-@L 1P@ YYYYBr0 -L M80 "Kp@ `4,\- R" H=R %<=R >3RC R@  Q =8 26 R. R  R R+9< 2$R R R R `@ 0 `@,0,P; L /(K02*K0C"[ :6@KR020 0PK} ,00[S/0[S.0[S-0[S,0[S+0[SZ  +0[ 0+0K<7w'2 4P 0 <0'0 9@ 9)mQ0R 3#Q0C 3#Z0 3#*<w>  0 P) 巰<0'"t8804 #$0!0@2 SL $ᝰ!02909""咰A<7pt'2 P@ 偰<0p@T 222 ^95 2W   49L5 2H9A 45 2B5R1 &R=.R R8R R3 A G4 2+85R R&9$4 2R R  <$囮'=0?@D0 0@ ,,P 宯F <>0) 0h4 4P P噯<0 )0+< >0  0 P 偯<0#8<)3 P@ k<0@T8 1y><0 0  0 P@ 0N@\@Q <0T<0$804 ,lB 804,00) Pp2";2!x"1P0!<A,1P P P0,18 ᶅ9 ,  0 01!21_@"2!1t 0̠VBT-  h z }804@Po T`$<<0o 2 S804@P T`$0 9岮 "0"2|DP#xT0t?4K<ԅ>>>)$n(n$>H>>>t>>xpx;@6x8xT|@xT *>> >8>\>#! !"!`! 8  > p-LM8P4D ,;!8#8  +2S><8#8; 0` 0 `0 9" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`/P @@z P 00 @  01 0 0 T -LM8 8 A4 8<8 80) )0i0@0088#8#84 X)0K 84P 0T8@4 ,0\84 00\8@04P T998P,  04 \8),04 \p'8P,0@04$ \p'8,04 \9h84@ 1\8@4 0T84D <\8@ 047 T* :8@8#84> X8 0L 4\"41R )(10S= 84 1X804P`C Tp$ 0 08 46@0;6@9:9Ⓟ(K\j804@P \`,7 84 0Xt? -L`P@pD00 @0@h=@ꔇ> -PL@`p@t1T4 d1T \1T  0Pz@4T @0CT' 0T61 @8 N @@0/}@4T6@@?"> 0 m@608#8@6 0 RP@@ @@i 5i 6i( -;L@@`84< 0X804> (p1PP P`PpQ, 84!04< X804> X%7P`  00 00  2`9  "``  804H \ _ -@QLPppU@=pW?`0OOP$ 2>AB?iPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0 Ai -,0L8l02 0 Ai0 8 A0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ(A@n 0-@L >04 00P T0hm= -0㈠4p0  LT64 Qi  $  0PT  0T  0T  0Td$?@T T! 0  T0Sq S3!1!3!(3!43!\3!h3!3!3!  $ P7 P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000c E0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY Q T <  'Plf 1 R0  01嵩Q000pߨdQ ب000DҨ<Ϩ4̨0@000~m  $0 r0$ 0440 0S0 =0 @0 0 00\W@nĉ>@!0(!T>>$>@>>؉>x>\>Zp(A8n'> -PL `p@^< 0TW@DD0 @T0 T 0T 0T 0T0 T $i; -LMP@pP 0`P  0<<0< 80@` ,0 $ $0p4n0AZp@n(A,A<n$A 0-LMhPd0d@ @0P @0S000,0 0K0ho孨@n(A4n<n $A> -8pLW`4@P t0  0@#00C S9!9!9!08!08!08!08!08!08!08!08!08!8!0@2Ÿ 0i9 @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0SY p0 Td< $ 0Td< $0S2 0 T0 T 0T 0T 0T 0T 0T 0T0 T $<<0 pT$A<n -LM@`p:}^PU 8< $  0 T00 0 }^PU < $  i):0 @n4n -LP `:p $  $@ $: 0 @n4n -@L:t0  0t09 -PPLL 0RH 8p:@堀`T Q):W0  t0 o90 0040 T9T*tt ` x p0 0Rp0x <T~ l0  2@ 0XilL< -L M80`S4P删  $8 , 8  $@P 0  0, i@q0  , 0  , t0 0t0| R,0HGq, ,l0"20  $J  $p l@ 000 <0SV 0h<x t0 0Rt0x )  $p  $0T *p@0T@, 0 0 00 T@T<~(K0, l0 20,P 0 00  Tt000 008l0 20,fi -L M@l90pPtpx0p0t08<<0W ``U 0p`K@>z>> -LM!p00AP4`pC9t0 0(8(K|0Sʤ0 0 dH0S t00t00 0H0S H@TP0 00 T00 T 娐KR #H PP @ 0@ TT  A -LM#p0`0Q(@0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@姽|0@P0C|0 DWApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T A,>i -LMŸa48@, l ሠpPP(K0 [P`2Wh T2W4 @0CW6 42W I1CWd ;1CWLP 00#3000000?000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0 Ai]t@yt ktzt lt - LA8P4pt0`  0  l0 20 7t0  t0 0t0 f6000 T<n{ Ai - (LM(" P4 80 0qW 68P@U 86tp5p% 0 px   8KPI6 , R; t0  ,6@(K$ $ 0  0 0 0T 00 T $0  0tt4  0S ,5@\$4 ťtz@P t  t0S  ,5t@́t*p3 0 0@>KD>L>T>\>d>l>4> -LPp`@@1dT ? ,PdT ϕ 4%#61 \1 0p h蜜0t> -@0L @R < )0 @ h04 -L@pPP1dU$ ? ,idU ϔ49 \P1dU ? ,0 PQL萋> -LPp`@@r1dT ? , dT ϕ94 \h%갋> p-LP@@O1dT P dT8p,`@0 @@Tp̋>lM< 0-@LPsT T$ 00C0S 0h0 p-`LPZV@ V@@l0 A QR@ ?W/,0ϕ80W/\p0 -LϐPT 0@\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0ϕT 0\0?T , p``WFϕ@AT 0\y0ϕ0T \p0`VZϕT 0\e0p`ϕ0T \Z0?T ,, ƇO ȠT 0,x`F\E0vϕT 0\:0ϕT 0\10ϕT 0\(0ϕT 0\0 -Lp(  à  AU0 Ƞ!H,Ƞ.P$H P= @Em 0 @`@@ 4#T0`PEMP 4*U0@0t -L@0J#`P00V0SRPF0t#E=0Qp1p#S,4n!pn!n!l!n!m!0#,3!3yDp V ""2! "48S 88S FV  F /? ,@2!z\ $"t"p2!k#)D e!!_1!Z#@ U!P1!K#)D EVL! -?P!:L1!5#@  . 1!)#)D #0V    0!#)D  h -4 80!  -U0TN<N -LM0S, + `P @0S ,?(pW $0, ?$O001 0 !    ` Q,0(\  $0  B 0,0 0(0$000(K -|px1 P  P6L=6`V 0ϗ` 0\O 0\ϗ 0\O0 \ϗ 0\O 0\4sBoA(kCgTV /R 0000$( -P3`L p?S P K#000}ϖh 2\O"0l \ϖ"0t \O"0p \_|"0x \ϖ T2\OH"0 \0BPϖ @\TO0 ϖ1 \5 yϖ 0\O 0\P  hl(p h8p48S0C 6 n0~0ϖ \? ,ϖ ,O 0\ϖ 0\60;@064(R   B$ >00Dx0 L90 -PL@`p8+1T* 1T2 1T  z4P@2 *X10SL1T; 0Yd@4Tn*@606 0S. 6@ @@  [*@ J4P@48S 6A0AS@@ 2<*0gd@06A0ASl64@Di i i ϖ1i 9@0 -LOM`00@H! @   @刈P 0p H!\Q 4! 4 48S 0<1 W6 P$X 4Q QD8S# S |6|&xƟ 2PT1 AC @ 0,A 0 @P  T00SR6PU @P0@41%l05 0G͆0540C ,> p-LM6`=@SP2 x88S1SS W|P p2 .R{ʨ1SR Wp@LP  8O K*@P dP  ,O Pe1  060 Q Br0C  BQ 1 R[0G@T/0S*00 dP  O P x 1ASq Bx 00S:A BT  10R\!`!  10C1 10R'|'  70C700 dP6x;6   xxQ0 0 0@0@x6 ;6   xT($ -00LM`,0 K @'0qJ4 8< ""0"(0 ϖP(@T 1!0#0"B,0 ϖ(@T  $0  Bϖ $@Z@,屡P@ 0L0/".000bA 01(0Cp3Pj\B=@ 0C  00  04 8  0S #00S|0 R40 \0 R`0C  R H 0009;9,(Ko(KX>hT$ -0 LM`, VP P8@080   048< ""0"(0 ϖ(@T X2X"0#0"B,0 ϖ(@T  $0  Bϖ $@@,Q@1!/!b32Cc@1p0C(3@jt1\P 0C  00   048,+ )' 1JpP(8 0(80 0@0@0 0@0@s(8 08(h0Q40 R`0CP 0009;9,(Ko.Q(K\4*TL>$ -LGMϐ`( ,l4 h4b `$P00U8 <1   YPP +r1 ϖ(X  $0  Bϖ $ϖ ;PP, 0 - 4. 8< #8/ :#: 0 043 R8 ?D ,?@@ ,PP0F͆  \2l" 0 "0 n0m0C 0CF͆ p-?L` ,pP Ppϖ 0\O0 \9@   @ ϖ H0\pj -@ L[@Q \00HS X00 0R B0HSQ -PpN@L hhhZ #T!4! ! !!88pg88HS Q' (R' R @8s'   88pB88p=,iVϕ8 0\ h(}i. p 0-@L$48PS $ }0hhh 0-PL$88@S 0h#0⥟ -L@)~4P 6A0AS 4@2 4 -LM0S ϐ(@T  $0  BϚ $0Ϛ#"B 8? 0@T/ 0S' p@P0S  Ϛ(` V $0Ϛ $嫾 pQ ?0 S@ o4 -LM0S ϐ(@T  $0  BϚ $0Ϛ#"B 8? 0PP0 0S) pP@0S  Ϛ(` V $0Ϛ $N0Q0 ?0 p S o3 -0L$M<  $0 0(0ϐ`<P#BB0pP  0 P 峏# (Kϖ",0K0 0P *,P 嚏ϖ0(,  04Pϖ 0P P $倏|0<,  0 4Pp <Q4 0 1OP+U 3;!T ϖ0 @ 08 1@PJ8@@@0 40<S00, 000  -00.  /00 1O00 040P 040 P 0 8  @P  f(\e  $0  B ]h  UX PHK8 FȌ>>0>>x>>>>T> -0ML@ 0(0$000,0 ϐ#bB0p  0 PP Ύ(Kϗh!,0K0 0 *,PP 0嶎ϗ0 ,  04PP ϗ 0  PP 坎噎0,  0 $3P X`ʼV ϗ 00 0 PP` ,r$n PȌ>>0>>x>T> 0-@L7f 0P 3fG|~X4!BA(C0 -0` L?  ؏d d? ,ROZ02p#J0 4@0 P d B]P P 0A(  P C  P ڍ  0PS881(8 04߆d چP@wH1P2.UN>0@(1(!9|! 1 !x10@!0` h⾆Y{0|80 20"2 yF  X0D 0 D0C @<0D BD0tx Dē!!,>0>,>L>p>>u -LM0@S  # 0 30 S(\  $0  B 0 0$0 -(LR0000 000CSԢ!ܢ!!!̢!!!! P P@7P,@nPX@l`0 $H0AhSw!!!!!!!!ؤ!!!!!!ؤ!!!!!!̤!!!!!!!!!!!!̤!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!0 0 R Q Q0-L@P    0@T  08#0`08#0@jPj`!X!h!X!X!X!X!X!X!p!x!X!X!X!X!X!!X!X!X!!X!!X!X!X!X!X!X!X!X!X!X!X!!X!X!X!X!X!X!X!X!X!X!X!!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!X!!X!X!X!X!X!X!X!X!X!X!X!!      -L@8Ơ#Ȍ0 Ƞ,<.L p(8H#8""l$H"X,Ƞ.0@P`p@ M0Y Y 06 04Ƞ8,Ƞ< * 0"*#"#? ## 0Q @1 0 0 @ ("<8 #8"(T-0, I Y Ƞ ,4Y 0 $8000P0Ba21C0aX  Q  R ,{0 0 颋.@PH!@!8!0! <>܎> >>>-0 02 \0^  ^J@^Z@40^  ^V@^d@@@0 -LIM4! p p2p 0CP  B  ADo, 8Ÿ  00 `P|2P "z?C`,!1I͇ 0! 0140C  -L M0pS0 0, ,  , P @0S 0?(`V $00 ?$冸00 0     ,0 Q80(\  $0  B 0$0 0,0(0(K -@LQ x[@Q \00HS X00 0R B0HSQ(R}x 0-PL88@S 0h0ǘ 0-PL@ TR08 R  080 0   0   B  0hx- -`eVLpP X0QP 0@S 0SPTP p-PLi<0`Q 0@S Tph p-P@L0`cS$ l-PP F\\ 00 0 `0  0Pp0cSP 0-LP # E-@P 00 p-PL00`Q @WTph` -LM0S ϐ(@T  $0  Bϙ $? #8ϙ  0@T. 0S&@Q`0S  ϙ(p W $0ϙ $5Q ?0 S@ o, -LM0S ϐ(@T  $0  BϚ $0Ϛ#!B 8? 0PP0 0S) pP@0S  Ϛ(` V $0Ϛ $ٶ0Q0 ?0 p S o1, -0 ML8  $0 0ϐCP0p`P  0 P A( (Kϖ",0K0 0P *,P p(ϖ0(,  04Pϖ 0P P   08,  0 ,Pj 8P0 0JꪶP+P ¶;!O ϖ @ 04 3@P0 C4@@@0 80R,00-  .00/   00灡0 PO0$ 04  @P Ⰷl(\k  $0  B ch⟇ [X⚇ VH╇Q8␇ LȌ>>0>>xtx>>>>T> -0ML@ 0,0(0$0 ϐ#aB0p  0 PP c(Kϗl!,0K0 0 *,PP 4Kϗ0 ,  04PP ϗ 0  PP 2.0,  0 +P X`ʼV ϗ0 0  0 PP` ,$ PȌ>>0>>x>T> 0-PL^ 0@ ^tQ@AA@$T0E 0P  *04 -2"LQ`B 2QB 0@2"9|!2"x10@!0` hcRt1!181|(2!1"2!Yr  X0<1  D0C!@<0D BD0XA*48 P 40hD Yp@$Pop0P/DU=0@@ Pap0P U=0@@Tp0@W.T=0pm$ >><u8>u<n -LIMϐ0 @! /0 0@0@ 048<0#,## 0Ϙ(@T 4F 00 #<0ϘF=  ! ?  a F=(@ 0C` S0Tp 0C  @0 0 48< @<D1 F0P<1 +^ 0-LP?*,ϕ ,@0 00P 00 00000 0@0@S  T⋄0 0@0@P 0 00 00> -"`PP6L=6 Vp08?*,ϖ80"\?*,ϖ-,?@*,ϖ8-\?*,ϖ0!\?*,ϖ0d!\?*,ϖ04!\?*,ϖ0 \?*,ϖ0 \?*,ϖ 0\AAPU0E W /R <@00 00,040l4h4( -9L@@ 0E 000( 0-?@L*,ϔ` ,h(342 8P?Q*X,ϔ0 \0d0 -?PL*,ϕ0 \?*,ϕ0!,\?*,ϕ0!\?*,ϕ0 \?*,ϕ 0\<1 p-?@L*,L`? ,ϔ*,_ 0\p! -?PL*p ,ϕ0$\?*,ϕ0$\?*,ϕ0|$\?*,ϕ0@$\?*,ϕ 0$\?*,ϕ0#\?*,ϕ 0#\?*,ϕ0P#\?*,ϕ0#\{?*,ϕ0"\l?*,ϕ", ``WF?*,@ϕA0T"\K?*,ϕ0"\<`VZ?*,ϕ!0\+p`?*,ϕ0!\?*,ϕX!,0#26O8*#x,ϕ!0\`Fv?*,ϕ0 \?*,ϕ0 \?*,ϕ0P \?*,ϕ 0\p4 p-L` 42 42 42    E1 Ƞ@!!,Ƞ @j?.0 { 2 8HQHA #800Ml0S!<C<0Nc0S <C<00S /0#@0C00F]S P00C0K 48#(R0  0S0=@ 46T0PFM>@P00@8sP 40ĕĕ#U@p<=> $2-@ 0 ?L/  W WJ=!(0P0PU ?*,ϔ*,`P Up往4:MP嵀L1pz 04嬀PAA !P'PUl0` P 唀PEAAPUZE @ &P 0PU  hv\r0D@ B$`!!>><>>n؏>>$i! p-L$8ϐ@*` `,?H ,?P*,ϔP0 \p$0 0-?@L*,ϔ-,9V ?*V,ϔ0-\0 -@0 HLDP`@* L,ϕ0L \?@*H D,ϕ0 \0 0 -@0 HLDP`@* L,ϕ0L \?@*H D,ϕ0 \00 -0L0@S S ?*,ϔ 0\?*,ϔH >\?*,ϔ 0\.T0 0-?@L*,ϔL ,$8W?*W,ϔ0 \0P0 0-?@L*,ϔT ,hUp0 ? *U,ϔ7 \0P0 -O0LPȠ*p,h,?!,,D ?*,ϕ78!,\?*,ϕ0 \ -?@L*,ϔ8 \?*,ϔ0 \?*,ϔ0P \?*,ϔ 0\1 h,04 -L@p`PPdU& ?*,ϔ ,PdU ?*,ϔ 4$61, \1 0ph~0t> -L@pPPdU6 ?*,ϔ ,hdU% ?*,ϔ49 \PdU ?*,ϔL ,0P B~ =~0> -L@p`PPbdU ?*,ϔl ,dU ?*,ϔ(04 \ h~0> p-t1L@  `(`) = R% `?8* P,ϔ!,Ju I00e0B S  QPU  0PpQ 0 R`Bu0 :ut0 8# PcP0AV0!P0R01P#u 00ԧԷ`PP00 0-@L48PS 0X d,000  }0hUhx! p-LP@@dT 0@0SddTte}ph`@0 @!2TFMGm>@`@T Q  p̋>TP< -0pQHX@,`8` (P`L P [ 1 RW 0 P`1  `h M L1 RI K V X  # a b?*,ϔ-,0?XX*,ϔ0-\0 d0   Q L0 R 0 P`  0 R  -L@0M`,?p*,ϔ-,?P*,ϔ8-\ [ MW?*,ϔ0-\ -L`0p#i82P  \^22PPP \ 0P0\0!àA0 S p  { PA u0 %ob i e   _0 %YL S O  J0 %D{p 0SS Z  ^0 m=S< -L Mp07 ?S P {$K&000F M00P { @000_B=*@,ϗ0X&\_L6*@,ϗ0 +\_6*@,ϗ0%\_5*@,ϗ0%\_E=*@,ϗ0%\_t5*@,ϗ0L%\?*,ϗ(5 %\?*,ϗ4$\?*,ϗ4$\?*,ϗ0$\?*,ϗ0h$\?*,ϗ<$0\0d耆?*0,ϗ 0`\VO0  t?*,ϗ0#\?*,ϗd#0\@@T ?*,ϗ #, Tz ?5P 6l8h(Bp00\?*,ϗ-,48 SH 6G F?*,ϗ0-\M0PK?*,ϗ ,1 @-BT?*,ϗ0|!\?*,ϗ0\!\?*,ϗ810!\?*,ϗ0 \?*,ϗ 0\60;@064(R  H B( > >4P4 44pP4 4 4@T4,444X4lO<000?00h4l4 0-0p 60LSP0CS006 0hPd0y00 @0@0,(> -L@Vg4P 6A0AS 4@90 -PL@`p 1T* 1T2 1T  4P@2  X10SL1T; 0F@4T @606 0S. 6@ @@ G @ 4P@48S 6A0AS@@ u 0F@0⁜6A0ASl4@Di i i ϖ1i -PN@zL ph QQZ '!!!!D!88p88HS c'2(R< R < ^0}NQM  88pv88pq:QV?*,ϕT ,?@*,ϕ4 \(d0 -LWMhpQ@0H \1 L  g L}jPB 0\@ Q8 8 48SK 0\D1 O7` V@$X@A p0  <  780LX1  8@ X@0@!@HR$HL奉`VLrx٦7@(Kpq('800200\Q8 8 48S6 @ D!  \ \\  h l lh!6b0Ɵ,1 6oP,1 BAD@ 00A 4 @P  T00SR86P z?C@?@8&0 I͇ %0 .bdTXi`04> p-LM6P=@S`3 x88S1ST W%P D2 R|ʨ1SS W@LP  0 Kӊ@P dP  0 0Pa1  060 Q Br0C  BQ p1 RE0G@T/0S*00 dP  0 7P x 1ASq Bx 00S:A BT  10R\!`!  10C1 10R'|'  70C700 dP6;6xxQ00 0@0@x`,P -LM(@p08 ;]  ϙ, (P4U@  (#!Bϙ0 (P U ,04 $0ϙ $8r  (@ @ 0T(@0C@ 0(@(3aCZ 80, P     A 4 ""80"(0 h0Q0C R40CH0 R <)0+000)8(KoQ(KP`( -?@L*,ϔ",?P*,ϔ ,u  p00p`0?*,ϔ0!\?*,ϔ0 \?*,ϔ0!\?*,ϔ0 \9@ +JD=6/*%  ?*,ϔ0 \?*,ϔ0 \0CB A0Ah4l4 0-LMP0@S /(\ 0 $0  B /0$?+8ϔ'  0\0Q ?<Q ? ,0Q8'' 0-LM@P 0498#,("(#8 \ 0(\  $0   P8 0-LP? , 4 " 1!0@ \00S 80 \0  S 00 0 0@0 00  04(8( 0-Lϐ@, (0\_ !<\0\` -Lϐ@8 ,$8ϔ0 \ -t0L0S S ϐT P0\ϐ4 >\ϐ 0\._ 0-?L@P ,ϔ0 \U ?h ,ϔ8#8:@ \?( ,ϔ0 \0,( 0-0 @8L4ϐ P0<, \ ϕ04 \0 0-0 @8L4ϐ P0<0 \0 ϕ84 \0  0-@L?P< ,'ϔ0 00 \0 p-0Px x0QLϕ``@0T \7 Ph Phϕ0 \pdh -$8/L0#@ 0$8? -9MpLP@l0T T6T8ϗ04 \1`V@R>Z.B4ϗ6J.02/\P>X.@4ϗ6H.02/\Q>Y.A4ϗ6I.02/\X0X ϗ08".\404 ϗ08.B\LD\T 0-0L@P ϕ*,0 1#ϕ 0*\0H?AK ,ϕ0 \0@ P " " " " " " " " " " " " "XTPLHD@<840,<>L>T>\>d>l>t>|>>>>D> -X9X)T9QL?' 42 42 42MxPP 4U0D@8(Q 48#(P`8R 0 88$8 87P 7 ' 0 48S7'000S 7' 0 B0?z'\+P`pO@@)0@ 4@0p 4W706` 0 S00Ņ60S060ŅRP'\9P`pO@@<S@ 4@0p 4(W706`000S00Ņ6000S060Ņ(QP0S  ` 48# R ],Ppo @Ȅ 00 p-LMϐ` !0\O0 0; PPU ?/,@ UCl<x2rϖ%0/\4Q0 L QH00ϖ+\O 0\x>O -?@L/,ϔE0/\h -L@p`P?,,  P* U4hk U ϔ48,\t> -LPp@@dT ?,,hdTxkϕ48,\@@dT ?,,0dT > -2"LQ@C  0    ,, zh1 !R nH1 R 0C !R? !,ϔ4 4 \x Op,, Fg@ >_,, 5V -.N .%F "'5$'' Q-L !0S0Q@@̓'<(0  `p@             0 0S  S 00SP  S@ 0  x@?   ?  iX Q-`Lq 1p0S01 1R0S S0-'<Q(0  -1LPh8p 8141/8@@0P3':ࠃ1A1 | ?o\p0 0 p-LP@@T @PTi<p`@0 @T@0P# 0P0P pO?C  RE BI pO P Q3 pO?C0 Q T Bu4>XW<"'`(p0 p-AL0`!S(ϖ0 \0!S) ϖ0S0,0 \M]@#P@T 0A0S @Tp g9 2ϖ 0\$'4'8 -L P? p Xy P @@dT> ~7M`P dT1  @@ 1d00T d730`0S  T0D@@  2  < -L`$,, @4 ?#,3 R 0C !R 4ϖp#\?d#,ϖ 0H#\<3<#Q4S@ 0 @&T R@ r0S) "@=!0@ =  Z h"/="0 A# B,2 !RZ?E/,ϖ0E/\1 Rj }0SS 1 R 01 R  1 Vw OpD1 !R0 R 01P00 9Z 2S +4C #P@0 @>TUx00S`0 S@0X00S Sk'"'r5vX<5''$'&'(')''8X< -pM@ L7 b` >P 7 b ? @7 b V VL3 RgR KP ?#,03#Qz R r2 Rm KF j?",0ϕ0"\2|"2"P|\L V?h2@ T2R @\r 02\r ϕ00"\2"Q@ V 2Q""0Շ0՗00.0  B'hRb KF 1Q: =0! 20 h1@ T1R@\RDPKP R ?/,?, V:ϕ00/\0=0! "0 RD ϕ0T \  V',"'r5')'5('(p0'VUUU 0-LP0R @P00T0Sh0h QqT@TT0h 0"'p0 -LMϐ'| <p Pp  0 `Pcϕ!'L,0K@0 0 *,`P eRϕ',  ;4`PJϕ @;`PDϕ(@T 0 0 ;ϕ0,p 0 p 0Z 00p  ϕBAD 0 0 0 ~  L@`P ̠ DRe(K(JeFe>x>\>x> -LM6A0ASp 0BSn`B"C"C"C"C"C"C"C"C"C"C"C"C"C"D"040 00228 {8 yRq ϙ 0 00t00S) 0SS  y S .4 >\>x> -LMp`@T  ?(PU $0? $嫑000  @0@X`01 11 -LM6P@p`\|!@@6F=6 0ϖ0/\[? !,_ 0!\ϖ 0\_0 0; ϖ0 \0@3 @T[$tW /R ??0?>' ' -LM`?/R P  bp?0?9 Rlϖ0)\?/,O>/\ϖ+9\O0 0; ϖ+<\pP5O0 [ I  0 s@ ϖ\8T@@dT ?/,0 pdTGbb?/,0.bϖ>/\O/7\ϖ+7\OP P; ϖ+<\Oh'0\ϖp'0\O P; ϖ00'\(GPϖ @\T7'Q-? , @@dT ?,,PdTv?ϖ0?/,O0}0/\ϖu-B;\ϖ&0\O&0\ r0wpP>ϖ\0P+O;)00ϖ0P*O\E0P+ϖ0P+O0*00zp^ϖ $1\O @0\ϖ P0\)UO0 \ϖ/0\O/0\ϖ($(4\@@OdT ?/,0 PdT ϖ>/\O0!.\]M?@P0A0S @Td3 A  QRE@3R 0,3S 03B 0TR0S0"001 0S2 0S  S ex2\ ,2d"Q\ T2"Qh(l8p0l 0r?!,!ϖ0 .4\$80P?OpP&ϖ,0\Ox1/\? X1 0P6;@06$( 48S   \00 \00 @21C! c. @T >'(> >>?xV<"'p0>(pp&'''')'('5Dt*'90@ -PL@`p1T* x1T4 p1T  -f4P@4 2<10S01T4 0 -@4T!@606 0S' 6@ @@@  e4P@48S 6A0AS{@0!-@0Ղ6A0ASl4@Di i i ϖ1i 0-0| LQP@AT@06 0hI<|_F00 @0@0'(>9@03 -LMϐp` 00 P`  0 @Pcϕ "(0K 0 0`  ,@P >_Rϕp`(  ;4@PMϕ P;@PG0, ` !P;@ ϕ @ @  2@P- Z, ` -00.  /00@( !ϕ  00 0  @P+ ^$Kh^\^T^7@(\ 0 0; >x>\>x>> -LKMD @8ϖ"0/\@(K$8 ^ 000Z0000$(00,#(2 200000p8s> :"0001 U20, 8 ,1 81 < s28   $8P<`0 S? $㰋PPDc7@ 0498#,("(#80 BH80཈801 ND1 R9+㪋11D><7@ \D4~"1l  0 081|!0t!0 0= K0L 1 D1JK L(1 $ aD 0DwD00 0ϖ   0@P ,,! #,L 0P! 0( 1x/0  ?P4! ? $݊7@&DQ Z <l\ӊ.xWd<e<j<< -LM6P=@S`0p1 88S+ 0@ BTX0S*1Sc Wߵ@Pw LP   Kp@P dP   ]P*|1  06< RR > RN G0T B0S:G BT  1R0|' '  770C0C770 0 i00 @0@ 1R0' '   8 80C0C 8 8 00S:A BT  10R\!`!  10C16;6' -LMP, t,?,"4 ,/ à8 ,480, 1!000Y0 E p01|0 @T * ?(`V $0? $0?i,00@ 0@010 0  00/"-0 ?00bAY 04 8, 0h 01P 0?Q, 0280   90;9(Ko($,' ' -LIM?P/,d6 < @ *00T@0D> R00 @0@w0Sp"p"o"o"81   (!0000S񟗆p"p"pp"`p"Pp"@p"0p" p"0  0  0  0l  n0`  j0H  f00  bp0$  ^`0  ZP0  V@0  R4TZ<)'"<$<&<X<!< <> -L MR0 P >@TM@2 ( H0 [0(S6ڋ$q , , P\0 2S P UZ%0. X0 0@ \@DJ0NS` 2"0 P`0, [0 S, (K20  @Hϕ0!0+0!0txW< -HLT`pPZ Wr"s"s"s"0s"T ?X!,ϕ88!\; 288p8S 8'R(R% R l}88p  : 88p88pT $8*((2! +(  EG48Sh88S S0g 0-?LP,,p@ P0ϕ,0\   @" %(+ . 0>      @    | w  / 0-LP@E4P 0pp 0 |" 20 2S Q : 6A0AS 0?0.xW<  0-0@LPE"@3 @T[$~40P  0 *-L` 哴Pu1 1RR48(80 PQAAA@PO-U | Ph P@PAL1P2.UN>0@!= ! 1)|1!10@1x!0` hPc#E0 |80"2 0"2 0"2 XC  X0  0 D0C @<0D BD0 0lhLW>&'u -0L M P`@?/@WdT ?*,0@s dTW"'`(Y>&'$'('<>>'n؏>p>w"$i p-1L`P <,$!$&lϕ0.\O0M/\p 0-P8L#8ϕ(88@"9.YO\? (0f -L` @p^ 0@HP`#H8 p-("98L!`#X ϖH0.\? (ϖ00X.\?Y/(pϖ8.\?Y/,pf -`!(H@LX"9.YO\ϖ%X 0Xf -Xp`08LP#8^ %XX0&h8@ #8` m -(L"ɠ Ƞ!`,x! ϖX0.\O(88#8 Xϖ00.\O8#8Y/Xϖ8.\O0Y/\f$2-Q# m? 2n/Q00& 1\ 0C`  /1R& 1!Q00) 1Q,0S00,0Sm? ӳ h1n/Q00,0S00 S0Ӳ0S00?PSBS1  ,00CS ꤂""`"|"|"`"`"T"0 ? SS% 0 \ 0 \ /p0Rl0  /P0R P0R@0  <0< Q 0  0P !S  C -L?_@p.\`,8.?_@.\`,8.?OP.\`,6.0t Ϙ.,0yS48S9Ϙ 0.\?( 4ϘS20d0 XC 0-@PL0 0 0D 0F 0h}V  0- 0PSL ϐ@ @0Q04 @ @X0 0h`0@-@^0 ^ (0b1 \00S L^00 \0S/^00S N/^00SR0 \ 0 00^  p-0LS Q ?OP.\`,4.p?OP.\`,4.p p-@8oLX#8/Xϔ%X0 Xp -@Lϔ8#8/X? ( -0SL`!x S@0`@PP ("(`hL ?_@X`(008#8  0-LH!(P$H 0h 0-LP!(@%(("(X%(0h 0-LH!( PvDHH$(0ho (-"(L@ey@ 00 0 -@Lj? P00C48#8P@0C8#8@((("(20C!804040cA0 p-@8oLX#8( Xϔ%X0 Xp -< 1!(S(L"8@ oS08#8Sp08#8ϔ X? ( -LM00ƟS,6,f, $F0 V`0p @P, . * & "0SD  W,("(  ("(dX--("(<4,,("(z ("(zcJ  ("(J,,("(~,,("(tJ,,("(Jj0S H{, ("(,] q?,,("(Sg, ("(I], ("(?S?,,("(5I,. ("(p+\? ,("(@!@5,( ("($+ +("( 0S_ " "B  ("(B0S&ʔ, +t ("(pd+0SB  6  2, .  *0S!B**("(B! ! o!CT  ("(8X,,("(8^ ,, ("(      jL}  ("(,_TLLLz("&+ 'U -0LSPp #0S ʸ>+("(!@ @w@Txc_M00:C lX3@T0SDcS8c@0 @ZT R c 0BS b@0 @I5T RJr .?2@T* . *tBt/p2R  ! L2 ?S,2   "h"- -("(Z  aK00 :C @Y TaALD00:C 01@TxaJ109C X1@TgHa K10 :C (1@TA 1@Tj@ Up Q M!` `<`? A =꘺Tv+e<e<@fS@>@OH$D@ H$( ,0S t h \ L @ 4 ,0h}P gfff  8( c31 0P @PP p-0L` 0   XU@0@8#Xt t0UPPh^* (P"(ph?(@[%X XX%X  0- 0LSP X@ @00\T@ @ 0tT0 -Lp@0P`  0S 8$## #("(X 0S3 X " 0S&ڼ ("(, ("(|0Su l, ("(L0S8 XN T C L$H=08#8T " 5=08#8" b/)=08#8b/ 0S> Ϛ4,\0SϚC/4\封04S;#HM- ("(l8X#P`0@ uq  Uc P?_@^ X`(08#8^ $Q*("( 4O~a'+ (-L`"X@p ,R00C4 0@(T"X 0 S R10lAC 0CS? 0 Cm@S@P @ -(?"(L*( -pLtP@`T@ @P P,@ TT 0-?@P0 L, 0 0 $#20 00!  r 3R0000088## Q=  -rL@808P00/$0R?@S000kN -Lp`!HP~04 4 0P(U"H -?OP`LK/\p,0K/ -?_`L@K/\p,@0K/ -LϐP`@!p1 $O\Hϕ@0 \0O1 0C\ p-8#8L 0ϐP8@#8B.X` 0ϕ48#8` XVp",P+@P P -@31CLp`PP PP@0AT  008#`08#L0Ba͚,0 R 08#Mb -0/,0L0ϐ0b1 \ -?L$ ,  P 0-L@?P ,XPPU06@  0L -0L L -0L MP@ (pK`A HD"K DD@ 0! Q @ TKL p-L@cPF2U  80(0PP  @ppTT -LpA`@ 0#0PW@ @p P@D   @0@ TT p-`L@Ph T  @ (,P U hp蠯 -@!XL<p#X`' ("(  ("( ("(y,s-`Vp 0\0,8#(\{L  ("(Sr--("(J -LM0@  *KD0 Wp`,8#H` C1PX`VXi0 ("(@FKTp pT0G8#xP@ @0 @4Tm?Y@D01.0D @TD[ ("( < $[$[$[ 10C1C 0C /?(KVpڨ SC pCP+("(4,)("(kb0 0pT -PR000L@`p T0 R EpPU00p $0 @ SFL> 0-L1LM @P$ 0!00C0S? A KPU ? ,U;3 *ϔ \ 888U ϔ0 \? , :0S; ϔ: \7PW -L@h* 0-PL@0h -2LM ARp0C"Q# , K@VP "04$`2L2<"Q$ 0?, 8?",, K,P?OP!\`,? 0!?OPB/\`, 0B/X10S S?OPB/\`, 0B/?_@!\`,20  0 A Pϗ0P \?P ,O 0T \ϗT , 0  P_s_TT\P 0-LM@`0 AA KPP ϔ0l \ P8P -LMp.?_@\`,9.?_@8!X`(08#8!1!1Qo"0 AA, KMP?OPl \`, 0 0l  ,7?_@8 X`(<8#8 CP -LMp`h Qn H2 \1S_t \ ,R00CP1Tc1@S1ų!QT \^@j@P&K0P8U#H2[08SL2[08SG2[08SBpt ^R0<08#y0S>0@``1@T  `P@ $D KQ0@11SʸDJ01,R00C41"0R 40`1p@ =` RPC`<0R4 `!4 =`C>Ȓ>P a<>b< p-2P"LQ`= ϕ0t"X?/(ϕH@"0X?0"(@8.#8ʠ",ʠ"$N 0R10$ R- R Cp!1P\D CpOT@ T0@@Rp`10\1P T1PE HCp01P* ,{Cp00110!S 1 !11!111!11010,@0pT@000 10!10 S00x0! 10l0110h 1L0!1t 01!Cؓ>` 0>P S d>>"T#`""A# U#L5#"ؖ"""l"9#P" C h<> 0-@L?>.P(,R00#$R *\F HB0R 0B0\  0 S 0 S9 0 S8  B0\ B010 ^0$ 0 *>R00#600t0 $0l0 1G.0!2P0 $0r01s01t0 2>>8h<8>\>f#r" p-X1LP`@% P 414!Q pQà 0e010   0S  R }Bp wBprBpR 0e01P0  A (X0@` 00 0 RP 000p8 000p`$CdXh<Ԕ>>>l  -LMP@P 4B,K)K  2[ S 2B 0S 0S;*P B@? ,\2)[P"0@2[ϕ B08 #H,2[ SX 2T  0 S R A@!1 B @T 0pW x1 `! t0CW@/0"0)[0P`<>PVCt`<8>\_X`>d>>> p-P@?L.,1 01?@`, 00FApϕ,8\?,,0000V (0 R )App>ܕ> p-`L?P.,O43.\ϖ.,0Sp@@2dT @ P dT@<p> -@L?_`.\p,0.ϔ0J/\?.,ϔJ/,i -@Lϔp>.(?_`.\@,7.0S1 01}1 01 -LptP ?OP.\`,0.?.,@P0@T ?J/, 0Tg@<'> -0LSp?_@.\`,7.?., u1 01 -LM8K`P@m  pE9#[3[,K0K@P ,@ 0P C[" 1R 8#H2[3K3[CK3K zL(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ 8#HT,0 0@,0 0 00  , 1 B !H, 0 P  -LM1p@0M/p1RI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KP"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 F$KZ 6P`0@0 0H p-PLZ88`S ph480 S $@00 L< -@0L <4,4!Z BpP]Rc` 048#8#$0$("!888 S L23*:T^Z0ϗ!04!48#8PNX0Z`E/ U50 $("(04"48#!888 S+*Q ^PN104 8< O #<\0Z`EU  l>\> 0@>0> >謖>(>D>>l> p-L!@`\PP Q !TPPp>p >pЖ>> -P1Lϕ0C#q.4A\W`ϕ <(4"4!<Y/\` W@OL.1,qa\ϕY/9\O.D1\W@`ϕ <(4"4!<Y/\` xW@ϕJ/0\O.0\@@cT ?J/,`V T`><?J/, JP >>(> p-LMRP`@"iT 0 $(, <4!4"<NS  =x0S  `@=x H0=x0S @ @=xx舗>ė>X>> -LM1/pRJ (!?OP!X`(10! 0S6 1@1 0S< mO(K 0PK6 6 03K02K 02K@101)1cP`P*Tvl v ON K0  s(K0Sڸ"d0RvM ("(v/0H=1@01{zP D> -L P`A 0pp P #=@ 0_ P =0 O?.,1 S 0XX <?J/,P 0$ <UUd>UUx>>h<> -L;A S """"""""""""""""""""""""""""""""" =ؘ>@ @@Ԙ> -?PLpx!,@ ϕ`H!8\@T< ?!, T1 @@T2 ? , T' ϕI80 \? ,ϕ0` \?H ,ij (L<c E<>> 0-PL@Iϕ80!\?!,\? ,-?., ϕ8.\ϕ8 \?p ,6ϕ8H \?0 ,0h&ϕ 0\ p-AMLM@ K`jPP xmP ϖ04 \ VPx  -P!`PQ Lpv}? !,ϖH7 \? ,ϖ 8 \? ,ϖ 0X?.,U ϖ1.\000ϖ1.\000 -p@L[X\0PW`#!*`X ]0@PWz: u`YX0GjSr"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""pZ p $; pp0p4> -L@ ^tQ0B S0$/x 0r!Sr!0"\'l""''HP p`@Y;H> -L M@00 @K -L M$  0@  KlT - 0 L48#H P @ @0!`"100100cS 03DC 0S ?P ? ;0c! 0bS03CC 0S 0  $("()=?0R0CQ`"h"p"x"$: \> p-0@L!X`- ,0/S>0&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(^"(0S)48U#( U :p9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0U08#pp08#p0   P98#48U#( U`008#p U 80U=08#p(p=08#pt> - 0LSP E 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`p&:P > p-\0L`JS\@P0S ?$g00 @Tp\T -L!Ȱ`o59* =R?006$ᔠp9 91 B0 0P/d0d@\$}g Q 0F Q$09;9蘙>tT 0-LP?.,@P]/ ?, 008#80$!00 @0@9 0x0 -LMp0(`\P $ $0  B 4@T , 20 !p0/"-0?0@bV4`pT p-p0L ϐ0P` ,J$JAϖ1 \9 0xppT -L`0p@Q00 ϖ , &00R0S R @ T T_8 T ϖ800 0\@00 ϖ ,  @u T <8 T j00 ϖ 0\ 3 $0 01R=00@P0PS ?$f000S E00U@S>ԙ> -QL`0p#3$001R=40@P0PS ?$TfQE?U@ XY/h0JS\@P0S ?$.f? @TS -L Mp 3 $0 0PPU/ "100R=ϗ000@`0`@  0 P t 07U R=,0@?`V@  u (KZϗS<00@ 0 P P f7 P@U 21C:ϗ00 `0` 0 P ` K7U J@?` V/ 0>$>L>S -0L M`,<0(\ $ $0  B 0(@40P0Pp@ pO@U@(\  $0    00P KpT p-0LM @P@/@@T  0`P  l6x(\ P0 $0   404 0@xSlTTt>dT\ThT -$300"10` LM0p/(\ 0 $0   d0dP@ϖ 1 1\$OϖH 0\SSSS -p@L/00S& S? ,P` 80UaP@獅10凅? , a(0PPP `@`W8`@2R 9 2@8@008#(z*10  ! *K 0pW4000S40 0 8(K)h @P *K 2, C41Z 080 @BR ?F @ C)(0R  -4 @0 @80 *K,Z)(C l08 0088@#()H *K + C08` 8 a -LGM8 8  4< @ P0 41 {, p 0! u+Y pqD 4 "  2,07X1 X4X$`V D$h@P0@p0U̅p 60 40C  >TT>$>@> -0LSPp`0@HP  H  (0"(0`SP $1  Hd> p-LM `K@P)02K01K01K01KS0t _P 0S00  0Kp -L -3LJM0 Z0pL H! D1  D (  0 48#80$S("HPP  TXp000 @0@ ^0/"-0?0bL1 S (\ Q B Q B#0e0 $0  B 2 R 0eŸ0  B P 0 0@0@|"0e0 50+a7P0 0@0@,K P)0@  00 >\0[ ,g< 1`V2  048!#80@P10<1hȗ 0p|1 p.0@,0C@10L1^00 (K0NK C,A 8 4 f [@H?0P00  80KČ Ƞ ,Ƞ` H4 W4H= PU0PPTTTTTT4 -`0LpϐP ,J$JAϕ` 1\\T 0-PLy88@S 0h0> -@RLMP'^`P7@ T@+=^; 00ϕ80t03  P3TqB6 !0g0`   A,0g`@ Z((\ 0 $0  B   0 0Ct +]]TqB qB? g $SPPPT -@RLMPp]`P7@, T-+];㇥ 000i@0`, 萟0 ((\  $0  B 0 0C @(K+];P Xi0 0 ϕ㇥ @P $]PPPT -LMpD$D4@;m18$0P 3$00APPU# "100R=ϗ000 `0` 0 P .U R=,0@?`V@XY, &  cX RM@PP #3jqU (KZ.U @?@T`,  R, " ,P3$001R=,0@`PU x2 ϗ0% 0 ;P@ Y2 "l2P& ., @1 @!1qT .  B@1 @x!l1qT PP@U5 21C:ϗ00 `0` 0 P -U J@?` V @0 @ 0pT0 x0pY @@TU  P@ `- @00 @ 0pT A<8<̛>>>> -L MP@` 0lP- p$Kϖ 00 0 pP l-t t0ppϖ pp0pP0@, ,Q-?8< A<@>h>> 0-0LP@U ? $ϔ 0?$$ϔ  0 0h0pT p-SL[L`@dP0S ?$0 p00@T@0S /0$0 0o000 R pRM@PP\ L D0 o00U@<@P 0 o00p A8>$>>L>p>> -\2PLP H"00+  h1eQ2Q Q ,!1 !0S1 0!0 01!01 0!0C X0,㶿@p2S2<*&`P6@T\*<`P0"X0 R0 `V( 0C 0 0 & `P +d; }+ZþT`` >#T""|T"p"#"T",#">""H">Н> -L c -@A  L[@Q \00HS X00 0R B0HSQ.A   -48LS@  ,}hhh -pQLP- 9@?!(RM@` Q Q  T0W0  Q( * R o`V@ϕ0x XQ Q $Q=pQ W W Q Q  0 R  . 0-@L P U0P0< 0-6 @LP& ` 0S 0CS006 0h0(*00 @0@tT> -L M6P=@S`0 (KL3 0 p140 4  0,#0Q} 00CQbs B88Sp1Sd WO Ph 1S @ 0 S]@P) :P, LP  , K>@P dP  0@GXP ,0P ,Q 70 0@0@  0  S p`\ 10 40 0G@T?0S*0,0  1ASq B00S1p 1   &f,  $ @P] X ,70,0  00S|:A BT  10R\!`!  10C1l 10R|''  70C70,0 x X6 ;6p((tT 0-dP?@L (D0 ϔ0 X0Q $0hH| -0LϐP@p` ( ϕ0\ X0 0 0 ?/p`(Q 0Q-` 0hPH| -0QL0@ 0 0@0  `RQ= 0R^ ^ ^T 10 h0)(0 0HPnDT\<4>48 p-1LM @R ` 0S\ ad<<S  B$fK!K1<S  B$R̈́K!K PK R00L 0\00L00L  \ 0A0QS 0\Q00L00L Q00L 0S PQ  sQ |$ Kphl0R=00 \ L 00?00 10C 0`\<\@8?.#8㱽?@_X`>@8#8?. ii(P L>b< -L,Mp "JKT n!RKO3"ԃR0P0  *Z"3Rd +#R@ ("(R@T``S@ ("(Rw<#@18#8S!h1P1 T ("(R`@T<8P#X/ U0"8#h@18#8 S11T<8|"#X, ("(/"42R $[=(K+"* "$[ $[*#[5$[$[$[0"[C"[zR"[ ("(RT P0ϒ/X *K5KKK0KCKzK~TK?/(RP r00 2KT/ϐ`0X3[P  5u2[  z@P ?? -L0M,0pS m((Qe'x I?h'(X ?_@D'X`(98#8'@7.0D@T@D69<0D@T?&(T ?/(P 0S?zp ("(z4K  03K0 3K03Kzz 0S 0 ("(0  ("(z ("(zsz8#z 0S ` @ ("(?OP/X`(:8#8/z ("(zm$0Sڴ0 ("(0 ("(h 03K03K 03KY,0S RX ` ("(R9CN ("(C/Z-ZY.VX Rq X H8C8DQ80 cqu0tZǡǡSPӚS<K8#, /C# '@2.0D @TϘX0"XOT0"XϘP0/X@p2<0D @TE0 ("()("(0SU@쑟PLK` 0 @TPh(K蜑@DLK@T.  0SS) S' SS9 `@ ("(`,("(䐟@LK @T0PWC ^-,("(@ ("(zD  o)`<`<0`.D@TГ@D>Ka@T?#(H ?#(Ϙ/(D 0Szz 0 $Ϙ(3/X &- ("("* z ("(z'zL z 0SwϘ`"@0X X"H"` ZCC Z-Y. X'0#[Pz"[ϘH0!X@0 @T0S70 @T@D0.C @kTL8HC8DQ80 cstZDZL0:DZ(Kzkz OTSϘx 0XϘD0/X?OP/X`(:/la< a<??0" -LX :00SڈP -h&) H00S<  & 500S %"-XP 00SڄL @`%T0 㣤X `Pe  x @Z6-Y$X 00Sڨp $ з00S\}$ @$ 㽷00Sj $ 㪷-XP 00SڤOl t@#oT0#TZm:`V\3/R00000#[[@43@(K/B00 c 0Ÿ ST@D0Ÿ6C @@TϙP0"X0SHd 50w 0S1 00S6?_@"X`(88!a@BPK @ T\ X (Ko!H` 0ϙT0/X(KϙL0/Xϙ\1 !XuH 0SIx& DC \ X ` T  0T0 `0 0` ?/(0T ϙ0/X0X0 \0 b@8#8?.Z ?OP/X`(00/} g?S @0P` N?_@/X`(;8#8/ l@0P` . -0L L -`Pz,pL@U! 88p P!8S U%  1U0 U  ( 0`  8'l|0p0  (R R @8s}80 A(1jxTh>L<T -@L)3+0    h  -L$MP"FK`y0A?L%(ϖ98#8(%pX?/(r*Kn5Kj`KfCK4zK0RK,0K 0 C\ϖ0/X. &x "3[ $ 52[#z +#*#09@ #[[0@ L$H, ("(l ("(L@H$((9@m(.#0a /"ϖ0/X$[*#[5#[`#[C"["[zB[R@BK008#8 R2Ktϖ0!X0 #[#["["[#[#[  $K! ("(t/!ot1`"[ ("(<b2[L! (\4!X TG#[((M3[  Gt XKTKPKLKGxKC#[K((P%3[X  <x) -&`L>pzX ("(z, 0BSOR 0FP  !??`aˆh@+ -0LS`p  4$Q 0$Q DP P>LU@5N,,("(504D2S 00S=ڸ2S ϗ0#X0,("('*("( # ,("(5 d ("(5] ("(]0S{ &3+0 ϗ2/X0Sd  "0SU  PBK2S u y P P# 2S` [{ } \yz ("(zp  2 *!2S4 ?_@/X`(?008#8/ϗ/:X D!j&,e!$!a"!]# !Y$!Ur] !P Zp 8 Bz(P ("(z z ("(zQ ("(Q !P +j"?0>c7~g p-0LS@`  R RX L  R8 B RRvPPPPPo R0Rx ,0S 0S0,0SE3#Q "3R,0S RT3  ("(R0S03 M .#0SM/#00Sm"2 A 00S:sy ,0S; ?|"8S? p00SXX"qLL"mU @ ,("( a z. "[0S/!T0k GY,0S!Bn?|!8SO! 3TGL((ph*6<0*&("(6iG+  c ("( ("(> "("(R5~P uxC02)> 0-0Lϓ@.,  0S 000PU -pLϗ`2/X |"& 0 >,HBP PLDU@Dϗ/:X0S A2S u By >P :P# 62S;  ^2 Z2SK 5`!S&3+L2SB ϗ</X* !>2S 0  hY* 'P Zp [{ \ z 8X 2 &,"?0=<P ˆw -LMH 00 `P@D ,K , <(4"4!<S  X R,0 4 PpL@,0S  X RH@' HH  BPPp@@< (4"40 !<0D <(4"4 !<0 d(K@ p-LHMQ@U`p 1S 1S= 1SY 1S Kp RR R0B0Stg0\PKS0#@T"!Ks?pP 0!u0DP  0A 0\PKS00@!!Ku?IP0!p0P  RR 0B0S08,q/uP 1Q0\PK@ !Kw?P0!i0Pn p\PK@ 0!Ky?P0!i0PT S(>>>О>ܞ>>8>>> -Lp>( lIP PP3 R0C R ?OP#\`,20#PP Ϙ.l3\PPPP~PPPP00 Ϙ0 #X$f{0SϘ0"XOa.9XϘ0"XO|"<XϘJ/9\@1$PwϘ0 \("@T?C P7 T`o?OP!\`,6!Ϙ!0!X 0q@h1PP<@TH1PP81 (1@P3Ϙ !P0X P0}? 101CϘb/1\Oc/4\~ 00000I p(d$XP_P>VUUU|TTTl>>> 0-0LS@1tPP 0PP 0S) BPPPPPP00 000ϒL 0X 0( ϓ, -$4LMP$100!0#0#?A3c03@ 0C @@,     (`P /`Pd3   `P`P`P`P3 Rp(K31C01A=$0@ {`PQ`P (q`P2p R`Ph2h"|1x!`2`"1)  0Ph<1\,B P00 AC4R?Q` } 0S㠀0h 008 N@pp12.Wᰀ@OH :2:XT1  0@!088810@((N-B4(2^|1!"1!2|( Z  X00  oD0C @<0D BD02T 2   |GAMbTH0*##"P`<#,#,#p>uT"xTS#)#|)##+UUԟ> p-1L`P)0@@0T0000000X 000ϕ0X K101p0TTT -QLMPC 0 9@?<1 R(L @ `1` R0zO 31C01A=$0p( KKP (C0` RZ  9@=< BQ@9I9@ D0@k?K/,`TL -LP@P10SAm$` P ipPwO0 vD `(!00 1 R1 ZP9X@0;90@' 48S*  i@?@,T ?.,]/TX8  T1j pg0> -Ls -L@4P 6A0AS 4@ -PL@`pϨ1T* 1T4 1T  4P@4 L10S@1T1 0@4T@606 0S$ 6@ @@@  4P@48S 6A0AS@0@076A0AShl80p0h(4@Dp#vi i i ϖ1i -LM9`@$K?J/,p@ ?K/,p 2PS M@(`<0PV008@LFtp1 R6 d1 R2 0T0U  $ <1g0HT48L>`>TTp> 0-L0@Pt0 R @@A $@0@ Rq@^Ǧ p0`0S0S<0S<<   <0CS,<00-,000-,000@-,00@0@<0000 -0@4L0 0 0S 040 R000 - 2! 0020208 $Q 8 -80L0="R  ( -L@ P 0h@-4@PTp 4`  !00\;0 #;^0 <00d<00 0@*\# 5 )\  0;-R#;  '\v Q  Q0 00000v 09000 0-80P@L H0 < X@0h譥 0-PL@K<0L0h补 Qp-L`P @Vp p-LMlR@`pt2 ` l” 0pXd lRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 ;0"2R0CB200. -0PL4`0pSS  4@0T0 1* **P\^Lh p-PL`b0 L@0U0 0 <SLp00 p- 80RLP` 0@S  0@4 ph=p p-0LP` L@0U0 0 㳦<SLp00㫦 p-0LP` L@0U0 0 㖦<SLp00㎦ p- 80RL@`P 0S  080 Q 4H0Sp0 ph4 p-LMPL`T 0< kKp 0KP   ,0 0  ,  ^ @< p-LMPL`T 0< ` <Kp 0KP   ,0 0  ,  ^ @< -L,MPD L P T0 @a 0%  <  4 0 8 8 (K00 40 < P0 C _PpQ08#h H V0(0(00 pG0|! x1Q,p  ,0@ "@ SG,,p i `0 D <Q8 8 444i0 079 @ < @0pW, 0 0 00 #J(`L^@P" D, 0`0@0W0 D P w_PH R 0@P k_PpT0L ꄠ> -L MP804@`Tp <0 0P0  0$Q  R 0S  0K  0K$K0$ T040 $0 0 <0 0P  00 -RLMp, R@@_g 0PkP> T`; U  0"100"P V `^U$`00 `V$ vP  V1@`F4hV g k,0<4P|`Ԣ, <4Pr @`, <0@iT褠> -0Lp@40 0 Q50>OP`•40\ PP 0S0 0 ` VPጢ4g i;i肢 Ƞ> -04PLp`U@<0@Ti@<0@T\<g iݲ -0@Lg ` P p 11$$00WW@44(40@T PPT1Q@CRJ40wPU@DZ4g 㧲㿢@P4 0  ^ 0@ 080< i 0-  LP0 0@S P P 0X1,00L1,0000S##Ĝ##0( 1r,0 0h0,0NP400,00ho0,0AP4 kP@450aPD4+@0 80P 4@D0dA|AAđAܑAA -LM8 @ ^,+0P4 < @ Dp4@`8  0000K  ,0KHPc00, p00 80H <% (@ <04 6Ǡ-0 0b 80< 40f,0 0 0 D00%0 000S 1 100  0 0`p8 `08 0š80` R 8 r<S0,00\ >0R0 <2S 00(K8 dl@ ,X00i# -0LSS@ P 0 P0! 0:0::Q:\   lP0P&h -8 L`P=2pS5X2S00h!R, Kp@l18P R 050 Rᔠ#40@<xd 0რ&@h{0 p@lP8DYp>> 0-L@P0hY-80=\  0 `\0d hPp# 0-=2LSPX20QX2 @JT<SX20CX200<0"Hn0 )Hn -QLM` Q l–Ppt2 P l2p (l–@pt2 P \2l–0<8#8 pXd{l–pt2 P l2p (l–@pt2 P !l– (1"(0p Xd㭡l–pt2 P l2p (l–pt2@ P 41l–008#8p X 20l–ppt2 p l2 p(P (  lBpt2p l–00p XX l–pt2p I=l–08#8p X0$> -L@P 0h> -L M80`P=2S00 50SJ 8@t1 <0  @ 4`,@#V, p0 F4000 0@T4@ P B6t:P0p8@4 <0,0<0(KoX(Kl– pt2 0  l2p (?<@c4> -LMPpQp֜l• pt2  B l2p (W0`lB8 #h`pt2  B l•0p X@l• pt2  B l2p (20#0W@  T00W,  $ l>d>t> 0-LMlBP pt2  B l•p 0X@WdT l• pt2  B l2p (@88h`ꄡ> -L Ml`pt2 ` l2p $lB pt2 ` l˜p 0XS@T lBPpt2 P l˜p <T ?pP|"0lB0x2pt2 P l˜p 0XlBpt2 P |2l˜ ,0p0 \PP ppp p@P Pp00LPP 0@00 p\\@P 0P00 pLL`Pv 000@ pllP@P00TQ_0$00  0 Z000 HBB  x"0 Q0 ZP@ L21lR`L 004 lppt2 p l˜ 0p XlRpt2 p l˜p 0X$Kmk iPPR p$Kp4 0@C5 HnD#LA>̡> p-LMlP pt2  B l2p ( 1@P% ?! <S x``` ` `   =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2xء>>>@> -LMl@ pt2  B l2p (?h -LM`0Vp0P`VJ=2 SlBpt2 l2p (? \0S 00h  p-8 L`P=2S04  R40 BAl@@<S0,00>0\0庙<2Spp p 0-LPP@0T0 -L M8 P`@=2S p0D 0%00080 $K 0K_pP K$ 040 $  40S <0 0  40Sʴ<@S0,00>0\0@R<2Sp Ap -L@.P 0h 0-80L@P="R 0P<2S00 -L@ P 0h -L M8 P`=2S  K4@ $K 0KP$ 040 $00  0  嘙pa<S0,00\ >0R0 <2S @@ۘ<2S l@^ -ꤢ# -L@P 0h=2S<2S * -LM=bPVM|WJ <0@ `lBpt2  l•p (0 0S 00 0lBt2p l•p (00S 0 00 0S oo 0 0 8 @X20X28 X20CX2o[ -QLM`P\ QS Q i,+<2p0<2l•pt2 ` l2p (h3lBpt2 ` l•p 0XlBpt2 ` l2p (l•pt2@ ` @l•H$8p X2<20Cl<2p<2l0<2ppt2 p l2p (l•pt2 p |2l• ,00 p\lBpt2 p l•!0p XlBpt2 p l•p< TlBpt2 p l•08#8 pX*lBpt2 p l•00p XlBpt2 p l•p 0XlBpt2 p l• 0pX,2<20C<2i>z 0-LMQP 4lB@04 pt2  B l•p @0\84lB@04 pt2  l•p @0\80 0 0-#204S0$0 0A>0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P800="R$ 0 000 - 0p`L80@ -00@pLP8`<屖 0R 10PS 0S 0 0 Vږ0/-000b10# BQ#4@0mN -80`L@r0SS000p090LP4 R P40S ḕGX@0( 90 i訕꧕iZꀢ> 0-80 0$(L0@<Pǽ0h葕 -L@vP 0h Q-L \ \ 0S 0 0 0  0 먢> -0L0p@P`U0 0000i 0-0LP@40h 0-0LP@ 40h 0-0LP@40h -@QpLP` p`@`T`  P.P @$pTp,8S.   0S`(8S $$0SpnĢ> -LM80 `=2pS0KXRU;T1h!R7 p@leP8<є0908 [l0@8 ᰶ0 Ẕ], 0LpU$0S 0P#>S@ lX00090ͼ,o藔:p@l P8ῼo艔DYp>> 0-L@P0hs p-LM H`T  X@ 0 8040 0aYKp 0KPPP@   ,0 0 ( (@ ^ 8: -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `\(08 04p090(Ko譓(K<0$(Ko[<  (KoU> p-LMP<H`T 08 0$00jᅓKp 0KP   ,0 0  (0 ^ @8 -`80$ @RL0p4PP 00$1l00< @0, 00 00C 00$@202LP0040004 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<^:#:zc>0PP4*3 S R N`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 4N@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % 9108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $`ڒ00 p04lB pt2   lš0p \0S <2S p(Kl@< o  l ,i(0# p-LMP㜒H`T 08 00Kp 0K5P   ,0 0  (  ^ @8 -LM P=b@Vp7 0SP32,0Pn Y0P P, F 4,0p 0P  4# 800 0pS0000Y <## ## P  1,01,0  @ Ru 80,  PP& ,0S  P 4(p,` "k j( l0r,0 oP0,0o@ ;蔒AAAĒAܒA A 0- 0LS@P YP 0P 0 PIP0-80=\  0 `\0d hPK# -LM=BT (KX20X2啑(8,X,H40 (HU'Y P$ $`V 0SS liP8@0S 0C0b20000#s2(Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0@ᓸ^0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000̐@W"90S㿐@JN080 Ln0 Ln 0-L@cPPK㋿0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00Y@ᯏ$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0K?R 2\8R 0R 0V8V!0NPPS񟗊@################P# ###7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SP`###l####$###################### #^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pde=2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  (JN4S Sr S0.Ÿ@(U@1@# @8 C4  02^/ 00l— pt2   l2pH ,O`K@' 8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0KlU00U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e <T@# x6l 2P P  .ݴ# #$AOA >6A?AHA8> -L@+P 0hB -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!7W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0ネ$@0hԌ -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"{rlV@IX2V0CX2 lB pt2  B l•p 0\4 04 0l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`$[@`lB pt2  B l•p 0\l`P80P8P`z $P(`0P8rꤣ>x>d>H> 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJt=2 SlBt2p l•p ,4 0S 00h -80L="R<2S 0-LPᕳP@0jT0 -LM80P=b0V@  , 4@pP7 $`D00%0  0 0R & 170<0@ ,, 00C 00 2p$PL@ 004p090]<2S a ( -L@3P 0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@㶋(0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S <2S l@j 9# -L@ᷲP 0h 0-80L@P="R 0P<2S00 -L@ᓲP 0h P =2S<2S  -LMp0  R0 0Q6  090QP4 1 0@9P02>U 0 <P@<0E?01P E 0R904 0 @RJ1?P5@TZ 4  8ʶ~A ҚPP 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ HdDlBpt2 P l— 00p\d2lBpt2 P l—p 0\@ wl—pt2  l2p ,@ T$-@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\*lBpt2  l—pH ,0\lBpt2  l— 0pL \,@ Pl—`pt2 ` l2pH ,@ T0@@ 004  HHDHlRpt2 ` l—4p1 \H 0@Ln>\Ạ>@%I$|Ah#> -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@~l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DilBpt2 p l–p 1\> p-LMPPl• pt2  B l2p ,d B`0 @`0P 6T <10`2xV0`2x>z> > >4> -QLMp`G Q1 Q i?><2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2Ƕ<20C<2lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\^lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\ߵlBpt2  l–0pH \2͵<2 0CD(<2L(H(il–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$0U0U 1303 22a0S100 010 0-Ql2x"@P@L p,l”x"*0 p:\0800="R  0-@LPH6S\0&\0`0V`@0h虅 p-0LS`P d@T S0d@TS000p 0-PL@640F0hr -`LQPp 4@T0000 L008 S 0-PL@6D0F0hJ -L@/P 0h p-@LT` `P Ul0 t弱\0\0\0S `Pd@Tpx\ 6!x2 x0ᤱ\0S -80@PL`孅80p0C80 R ah -@T`Lp\D 0|\@0P0 ;0Cs 80 0 , $(\LpC 0b\Q 0PhY p-T`@PL\ 0ND0 D0T\0HPDD@D0 SH@P0\000ph7 0-80 0&L0@AP̬0h薄 -0LSSp  # @T0 P` %40S5%((4@0(`bT 4 <D 0  0PS"888S@P@` +%20# 0 000h苬@00 p-0L`PCT0S@9U0D000C! `0qp 0-=2LSP 0Մ@0h* -pD< 0L  㬰0$ PW D  0o蟰@S4PW D<@ 0㑰D`0 ㊰&888 lR0006 0 y0POoL -8 Lp`=2S0S S 0S R0006 0 lT8P+h R0006 0l B8P80 R" PU tl@  01 0t0 0  0(dPU06ဥ  0↼h輫@T tlP 0 1R11t 0d@T\> 0-L@ P~0h_ -0LSSP( 80 R% @T- p`tl  0կ 00 #8;#;S c 80#8Ѱ0d@pT`0000i_0 0SD$<$4$,$0@T p`tl 0㡯40S01#.#8*"*8 #Ƞ00Pp`d@Tld> p-0L @R`P p80 R t 0l  h 0 lR0006 0 Z0P0phdt 0l M00!RS0 00S -LMPKl2x"p ,!BP x0S QE\P*(0KޯPk~p`4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ }lt 00x0\0`0d0O KP -LM4 084  40@S8 0u 08 ;0D $, %0  R,4 , RbP0p0P MUd,0000040 N;#;R8! 00 00 D$!03S030%0  000PP0E 0 030C104 .0^01 B 000P4p0W0 0  P 0 <0` 8,嶐@P8)(K]AL -L$M L 00H0  0Q$D , 0 Q0,  Q0,  4@=P8 @ Ս0<0 P40 00 LP@ 4 U@@d0 0P<0 @,4 0:#:0i0>0.S 0 ʠ!,ʠC6 0@,0 04 00 Q04 P 4 P^@ 1<.0 R*0@,0Q `p\$pO@0H 0@ $040$0D (0%0  0D :R:0D0@%(0 ,0 <  8@0< P, @Pv@@ 19 1L _(K0, T -p0 `8SLPf=2So<2S^24 1@A 0CSW 0SN POr80S4K 2 P0C" 40!S\ 2A  0S00h001&0\0&\0xS`0`02d^c !\8004806@0&0` 6$@刀P l2x" p, -L@UPhr -LM`FT 4064 v040P K?*(0K✭PpP(0$ P,@ 8(0K<0@@Dp6*W40@&P -LMpD < 00 % @< 0, @@1`1 F00  .X08 80T2-6-0P4 80   ;p30, Q4 <!4 PP^ T<00 np>800c S@1p301 :J$JJd ;@`pW00, RP <7 8:#: \ &0^ 0004S804E I ;TP4 !4 W,0S ,p D<4 0` P(K0<90D4 0 ,P -LMPFpT D06D 0H0D0bK $0K⮬P`$0 @, à   P $0KT0X@\`6 VD0@ -QLP0 <0 @1p`CV`!MV@x"l•1@  p,/.00*b T!0,!@V 0 0 i: -L,M80p="R >,+ )0*T d<0@ %0& ('$RDڠ9R (ڔ9RY Lڣ R 9R 0p9R h9R &R R RT00g@~(KA?CR 8R RU0008R PAYAbA4A#>> -L@NP 0hV -LM p@="PR ` ` R0  0SP2`,0(KP `2`,0 Q{ Q Q,  \0,0 P0 7 P` 000, 4\d 0,48\9 0 P001; 8;!   T0\?0D 0ㄨ00 R񟗵4$X4$5$4$,0S SL!, 00C0S>4`(`$1v,0`z| @ {`{ 40`P  k0,0b|@ {`u ,  04(p0,0M|@ {a0 40`8040Y(M`UꤓAA>Aؤ>AAԓA> 0-Ll@px"0\PdU$  l2x" p, P l”px"0\PdU l2px",P0   00>̣> 0-@PL l2x" p,p ? 6P00=20l”x"0 p\X2\"0 X2\" #+$X2U0CX2 &00l”x"6 p\ h0\X2 0CX2="0 PPPꤣ>x> -Lx"l@ p,6h p-P0UL`0@PUJ^=2Sl”x"p ,6?0 n0S p00ph -L M8 P`=2S @  K 0p(K $0Kp@P @ʢ(0$ 0 5{$0S <2S 00& 6@P@zz<2S l@ νgC$ -L@LP 0h -L M8 P`=2S @  K 0p(K $0K@P @r(0$ 0 z$;0S <2S 00& 6@P@"z<2S ?l@᧾ vC$ -L@P 0h -LM80,@P=2S+` @ (K P@n pP@f 0040 ,p h408 % 4 0f1<048 0, 0 ,0D40, 05804 000OD00%0 !0Px1004 0  4D<4p匀Fz`40S <2S5 00& 6@P@y<2S   @ᮡ0K  ,0KH@P0804 90004p00D<}l@  ἼUC$ -L@7P 0hB -@PL =2S <2S l2x" p,?0hl”x"p \ -LM=BT (Km.0 *y , l2pBPxb \p,@0 D 0?00 P Z,x0(KoAD> -80 pL=2`S@0P0S X2S0* Q 00 @0!ı0iy0PS R0006 0 @lCP8ixOy 0R0000@06 0 l)P8x\T@ 0\@00 ;0CPU D<@ 0 D@00 ;0C4PUIy06@V T 0\ 00ᎠiXx00At>\>L>_][ 0-L@xPQ0h;x-80=\  0 `\0d hPsB$ 0-@LP\T 0㬤HD0 D0D0 SHH \0T➤0h -00`L@pxPw0 ?00h0Pn0 Pn Q-LW QO Q i<2&0R`<2@6Sx"l2Q@  p,3@0Sx"l˜@ 0 p\6Sl2px",l˜00px"\@dT 4l2x" p, @ <20C<2q`<20<2l2p ,w2l˜x",2 0p\&l˜P0x"0 p\6S!`P6Sx"l2A@  p,=SPx"l˜@ @0 p\6`SVDl2pb@xR \p, 08 10l˜x"@ p0\@dTL 㵦l2x" p, @l˜x"6p \2㠦<20C<2il˜p 0\2㎦6S@6Sx"l2Q@  p,=S@x"l˜@ @0 p\@  |>> 0-L@0PPmW9KUe"Hv0 0-=2LSPX20QX2 @T|2 6S m㴻6SX20CX20 06~ 0- 0LS@P y&P 0?P 0 PiP0 -L Ml2p $l™xp ,l2p ,N0`2 PEE0S& l2px", P(L$4L$K$ L$<2奏 *0ᆣP'0"0R2 2 !Q l™,0x"0 p\e 0YP â (Kl™p 0\ ;2<2#j>060 <07 ` @40&@T dP?"e_ ።@:!0=C 0Lp@Dp @@@\TD ;0CM`@0P1T*pD 0 P@PD PPLp\T/T"P@Uf:@TP!0 @P P :0@00 @0C L0T\ H@D@D 0Fl™P0x"0 p\m ˸mxφl2pR@xb \p, 08 10l™x"0@ p\@dTJ פl2x" p, @l™x"6 p\)E "P001"P PH <  0Pn>A $>>> -08 S@L D0 0%0 0<0 0S00hw -L M@80$ PR`0S cD0 0%0 0<0 0S00TKMD0 0%0 0 0<0S00> $K 0K0@{P$0 0 Cu p0S <2S l@ D 刹00& 6P00~tC$ p-T0L@`TP @T 9S  @Tpn -04 10@LP  >00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0 0-LP@@T0PE?  0-@LPrt 0 0 9@)0hs -@4LP R00080 0 4P0,0 0$0(0 0-PLCtIT R0009 0  s0 -LtɐP@`pP/ 0 0@0=00000090000L)04 8<@0@t0x@<08H04@:< |0h10,0\  D ` \ H00H0DYp 0-9L@| 啂 -0.@L 0᠂P hV$̥> -L M0 4 L, 04 8 P , 0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, 04``p4 `00p`pL998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@0> >> 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0p>P> 0-PL@n00P0@T0뤦> p-@LP`rP0S @ 0 0 0 8 80P8 phr뼦> 0-PL@rP0S q@ 00@0@0  0c> 0-LMP~@# 00  0   l (00(0 ,00,0$00$0K0@t m / >> 0 -L4 8<ST> 0-0LHPT JT LL  IP00 -*LR@ TQX0X0X0:TX0*R*R TQX0X0X0 :TX0*R*R TQX0X0X0:TX0*R P \ R`0`0`09\ `0 с PP Q00090)R P 㸁 -L@h| R0S0S PP 0S00 㔁 00n p-dPL `R@ 0S0S  R  㵁P00ppn -LXM@ %㥁,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8&,(Kt> 0-LP,0U@  T% 0h"z>xD?> -L@x@0 ?0 <@ <0  -LXMt@KpP`] I``K -LM@p`qt91XPU UV _pt)1L)p 08`X`p 0di+F KiHpħ>o<$ 0R1H <7 p-L@Pp`Mph.p 0-0PSL S 0T0 *TX :P P0S 4@0TP0 3d@T0P00T RX0X0X0:T X0   y> -`Lpp Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`T0:X0*T`L:PJ 0@L:PJ 0SX0 Qio 0RX0 Q$> p- 0"# "L@P@p0``9H:UH D0 20l#PP0`9oqpPH>A -*ML 0E; 0SR !9 -0LMPU. $@K& P$ xW! \iV`V P0 48<S@T (< P@  KzWTnUn -LMp)(0!@ *P 4"`+#8 < m 21C0a1 @8K < `0004 8\ > o  P0 48Q Q| Q> ^ 0 $ (,   048 < 8  uP[0 48<@(0) *4+8<S(KO0 0 PP0   [0 $ (, BX 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPx>P> -LM Ly@W ßX9 "10 0 0 P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@0 0 !" 4#`8>Ĩ> 0-L@mPP 0d90hDm> -L`P OVX ",0( 4;2( +>$0"` 9405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K )?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ <" "202 0-LILPL @+08 H 0 48 <>D> -L M4 LYUp, m00a 0 0 /0C 0 B0C` 0 B<0C 0 ` ` `4 !LT9' 040'U)(Ƞ 4 V90 0'4W)!000(0C "#567@0`1`2`03` p4``````````040pYU0@ :  p`D PU# 0 (0,@X h  08,H 0$ (0W TPU4 p9S  0`4p0S0 @49Ix|)(KV`p(`0@S 0 @T1T! p-\:`*D1D!|:*<1AL> -40L@ܳ8 PTn -pILT p@T `hP GP  0<O @pTW m3`>(0 S-$0@L-`9S H:S hc p- L0410T`Ut@H h9S L)p :S0(0phQ00`00%SI 5S@ +(S *SPp*M0(00 S S SP PS S SS S SPPPPꤩ>> -@L1`9S H:S hР -@`LPiVp (0S0(0(0:S P% :S$T0S! TT RX0X0X0 :T X0 0P (0S 00 0:S hh Lg0 0 |Щ>1 p-@PLn`xk0T0*TX PH:ʄ0CH:phk p-n`PLkJT TQX0X0X0:TX H:0H:kp -yPLHzqk> ,0 W9 * Ʌʅʅʅ ` x@\9\`0)40@ 480<$P屭`W|$ 0-@PL YU 09 Ac 0 Ky)> 0 9Y @9l@9 P R080S880z --LM K00,8 0^. K -dL@{P , P  >> -@QLp` d:S HT +^L p FP JT +^(> p-PQL` L)@0h 0@ @@ppXU OL p P ZU pO(> - LgM`0h`p@@m/K0\PYP K]K 1 S h d0  0K 0RSK 0 P`0 @T <  R !SDYpedA<> -@L`p  PwPL ] X)R|F  0Txp)t R t9 RX9"100P<Vp #Ppt9^ 0 S0 S RQ  PUp)R t9 Rp 2T!   wPP (̔A>`> --LM K00,8 0*- K --LM K00,8 0- K<0 0-PL @P IP0 Un -LMS8# 0 8,K EP`XI 0ĐK:0 . %0h0 0, 0h!0 P` Lp 0|0 H D P P P H0 0H00 bZ #0 + 0 S ?04X@ `p XP1X#\   ?04X@@,PxB(K 00P@K00@@DYp>> -L(M`Q 0K 5@T +^@T  pPP (0 @(KhVL +^L p rP jV  X@@  wP  @ L)04 8(>4>>P>l> 0-RL0 0h" P0訫> 0-L M@P90K0 p-X9PSL p  AupI`TL <)tp\3@T \ 0Pԫ> 0-L Mɠ@P 00K0 -L$ML L00 H0 u`P 8K LpyW D @ < \q L 0P048 L2 $(T\= pWD0SZ  <Q| Lp9Sx \pq $0( 4L8T\^ L Wt9 X [ \q0p pL 0P H11U% $0&'48<@ 0D0R0D0  8K 0@$4(8 @ 8K oP; $0( 4L8T\ <  U < ~}T{ UW@)t(K UkHP@HD@H4@(H @marc>CRAM>X>><> p-LM`R@P !@ P $88#Č@ a@0,  @Kp蠬> -LM0 ! ' 9SH S W(KL)! 0"4# 8  t@X RpX0S pW` 9 p4p`X R 7AX0S3  RL K 0 ,KvBP  S@, h1TP#,h.K0MUP Ch1 ,T,7?0 ! 1 1 S L KHA(PK0 1RS L KSK 0Lɚ@P 00@2 A LK00  R@P L0K QQ R ! Q U !DT[0 L K<Pq AQT[z/K NK0@TPT[D0 L KP !PP A0P0T0SVL)000000000K QLK\P,0 `0L 1002@3 48>>$>̬>DYpedA<>P>t>>>>(> W$>> -LMLɐ 0!"4# 8  tpX0SP  qX0S  Rp (Ko}PW ?00 sbVF 0S`V> 0S> L)0,0 p h0_KbQ@ @4 R 0 S@RTQQ 4 R 0 S@RTQaT 0 vxY,h ,0(Kos0S*b0P@{s 8(\ P2"0CR202 0S00 qtsHaD>h>A>>U -LzM\K 0pPP P  HI@(K ,A@,K@@P 7@d, h1SP ,o=P@ h1, S,d=h,.K0fSP 1 S  h 0 (K (1RSWK 0 2@ 0@T!SQ  <@K3 q \p,0 `01 hBK!00p(,!041  -8 sH0 X ^qa  m0 0 0 B0 /0C B0 0C  02  0 0 000000000 0 000@.4.(.,L..Ƞ7>90: ;=?@ p0123456!"#[@8![<  !1H0!X qL2PX99 \Ʌ pt pP7O2r"R= 0S02029r@U t P  p pZ  p h1,Q,V<   d^ "hp@ >>$>DYpedA<>4><>H>D>P>> 0-@1L PR "RE HT P0S J0T0R R R 0 0hTp)R \0S \0S R`0 l,P L)p 00h6t>>T> -L4MpPK@`P 0Xɔ\048 L1 $(T\ n K"1   P X\L1U0@K `0` P 0 4 8,R* R R 08304 80 0 @00 @ @ @X\ r04 8,P00 marcȯ>̔A>CRAM>>D> -LvM`! N&((0"4#2 40  $,KB>@P h    .Fo)Bo(K$P, h1PpP , ;A A A h,.K0 Q@Pc ,h1PPP,:1 SQ Q Q   RoP t  KoP x A~KXYQ Kp<W 0S&40$ $,K! =PX, h1WPPC0!P >A0 48Lx1 $(T\ X,h1 EP,: h1,=P,:q q q m1U L K 0!1P @,h1 "P,z: 2 .!! ! J 'F #11 @ (n@ n  0! $0@H>DYpedAmarcCRAM>>>x> -LM0  80 npX "10!PP4 piV0` * 0㨀00 ,0 40 \ P0\X0048 L1 $(T\ `V X0S\`V)$n4  n0(K0U \ 40P,0S \ S00\000  An. 8IL  @0,0 000 ̔AmarcCRAM -RL,MT `N Mp0@P0  nT0p900p APt0\@X0, LK 0,K<P/ ,h1 ,OP- h,0 `0 0S @00$@S p P0sP T0pW@P(KP0P 0P0 (&0P0 ,e90P0 DYp̔A> -L,MOp QL P0 E mL0S7  m0\9X fPH m ?Pb/0p #18#hV%@ PVP  yP@ H@K 0 L  `  eP `(K  7pX 7 " uPP2 P PPp@ P L)540647/8 <S ` ` ` `? I2Tʘ0\T9 x9|I @ P0 x |&- P R0 0:(>*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @} p9S 3#& 0@@ T T0U T * 1A p .`P ``TQ&-PaL0ST9V L) p L)0^\IT x:S P @TXʘ\l  P0 Pd `#V#`F h` X`L `@ 0  lL p hphP9`SQ 09L `~@  kp QL) p hm` )P/ , 4S PL @p0SP $<$$$301 20@L  pL9 p0 nL) p :}Nj`kPp PL  L9 p0\ YL 8>>>d>@>>@>$`$L>Ȳ>>>>>>4>>> W$d> -P0L 8@`pl!D1TK 81T8 ,1T0 $1T) 0H0/ l0T/ 0T -P00T 0T 00S0 0  B&B"B!B$%B'B(B)BݽG=0 @-0410^@ !40BS <0Q 1Q - 0@rud@ -LMH{P@UL ,@ 4S 0S ,S  ,C ,P$ ,#$0S{0Sx  Rqs  k`P $0, P  PP,c L0@9lL8 $, KL;GlP,c U,0S 4S `0S $S,   $0S$% $0&'48<04 506$7(,r{ 4QP'XPU$  㦿PP\f 0S `0S$ RQ$ $`U 80X080X ,0`P\ jpP   5406@ 427P<01002@ 423<0! 0"@ 42#<0 0 @ 42<0l43S0P0 40S  0SX RQX Xp4X4s P\$P`0X$0c   0jP<    0jP@  43S $3 $XP$ $|P $0S jPH  $# 0P L(# L K(H0LK\0 h(0:98T =<ČT>Ȍ?; ,H  P (#LK09=8< >:; $? (H3 L \(@,P( 09=@8<>Č?:;P|H Ȍl0`4p(H3 8ľHLH H0hLHO0X0jL"RG 0SH0L202k$XP$ s48 2K㕾0s0S   }P 00h0  CR <#00@3  @0 QPZ.S8A87L 0X@Q0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L <K0p 16K   ` 0CSu PL#0@JjL382K0 L0Vj88 XYV4cP@XpT P $Ph hU@ h`W0#R @P $Ph hU@,@T P $P}h yhU@,3S ,@ ,C lhT<*fh@*bh8(K0Q @  ㈽P0h0 $@T  }PP X@0S<*JL#j@s >Xn\>>hnij>>>8> p- LM0PS0hh0`+`(hbP 0/3<00, @K u#Sυ0T  忤H H0 8 ㍼xTn>>n$>xD?Af5R$ Unhn -LLM pL9`98:< =;P> $?(<L  %PX T < P (KP@K ӼT0T #<`0 "(T0h X \ d #4l Tp0 "|"X"4<tX..h.D`[J0KPKh[X0[OKp[I0K 0 HKGKEKt NKMKLpKKPKF0Kht 0@K㛼T R0-0K00K/0K.0K0@ *0K,@K+@K)@KOX0#,##0 K/K.K-0K -LM L  A0q=<@嘡0> 0?@堐Čp8Ȍ91 t:᠑ 弁壠xᘑġ q ;堡夑 ġ̌ ጑ 0O1 pǏO O cK \`e?K P`CႬO<@eKp॓ S ̉Q `PQ a ̡ koKa |q mKsKpWp l q 封 l| X !@0p1 lA 3 0 ATeKpc_K`P` p P`"-Bp2MPcK`P` p  0P c0`AQp `Kp4 0 ƽKx t lp劣X ̊( , \ x!1R `x　U`A00`= 00 $+ 0 `6 3Q,a(L)&&&̠))H)<0@,a[`(q[p圁L9 @壀妠᧐Č Ȍ89p:`< =P ̌h ;>@d ?$(\$  IKpZ_K`PI/K `pZ?KP`"-Bp2MP`ZK PIK `pPI/K c@`x!\Q0T0R _  0 _P[\A 圡9S@ M?K0@41 0A KKP`0PU`@p,q ( ^Kx t | VAL9L) 0!"4# 8̓ t 0X R] 1X RW  QP 1AL)p \X(Kta|qV꜁儑L)p c Ux!1R`tA|QT\尡 !""4< ",D1  8 @! RX?@g | 0#!l\pP lQU0>L>>>>p>>@-L)@ 0!"#48 <29 -LHM` 00K\0 @l#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T U\0P@t 0 dkVTb 0D @0 TpKP0 SOK \D0t !XQG> M-RL0 "(KL9R ? 8 9 : ; < = > &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko(> 0- @0L,D(0 :0 9 0X*T:H>$$ $$-0 4 8<S 0-(04PS 0L(0;S@R0 -LMP 00 P  p P 0  Rt K00 0pH0L)p W 0(0> 0-(0LS4P 0 ( R@GR0h p-`LP ㇷ b HLp" !]P g0@pPqIT P㩹 R 080Oe\@Tphq$ -2L@P 2S P P b"`pP P6"nb0S0 (  R(⤷00P2 ◷ -LMP0h0p 0d0 ` Pd 00000 ,@ $ bR00S40V80 ,"?110AOHL( 0d4p 0 0$0 008PU `(40,0  0 0$ 0K  D00K0 @00 ,@ 4P`U(K d0 d - 0-L0P  (Q Q@0hHQ0 <00h^f$ -LMKd @ P 0 g40 @<0EfP0(KP>$ -LqMP@P K 0`0@ ,@ PPpp0K0PDs@0 h1BPh0y/K0aCP1 S02( K01SSt  a 0~@P* p`,@T P PVa RaU@ )Ka0@V@P00S "h1 B0-(K 06pPp`405 6478<sb aa\`0 0@0@` \ p_ , K`,@TQS @T, 0 48<S CP Kp`  5P K~p`P Kv`~`|0,p`vP K|gp`nh1 0HB0, p`dP K8U`^ )`|DYpedA>P>>`>x>> 0-L \P@  S  L) 0!"#4 8<90q P02 Q " R+P0#2  P  00-P0 La0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0贶>t$$h$$$$H$$ -LqM`LK 0@p>_PP|,K/PP4Hş, h1AP? ,+Q p@ `01  `Z t P  ` .` _T ğ,h1 vA,+(K p _._ _ (,h.K,0AP1 S  02( K01SS  WPp@  h1,5A,+ Pp@Q  t@ _ \@,0 `01 h♶@P@PL) 5406748 <0@4P(@,P1 ⁶L 8ƴH0 jX _@m0a 0 0 0 /0C B0 0C B0 @ 嘀噀嚀囀圀址垀埀 L= BP 0 407 001 2 3 5 6  !"#89:;<=>?@.!1H0|!X b_(80LYXԉD  \S_t !  嘀p)l G_@p 8A_0008   B9\9 0L)\y)(0*+48 <0##Ġ#+)*(0P@  0j@DYp`>edAx>P>>4><>>D>> -LM<`KN_Kp@K\kF LEL p  ppa^\[(K -LzM@`TpP@K zI K肏K,9PU @ @9U@ -LMPh9i)j 4k8|WN@ P4K  K!0 " #ČNȌ@(`̌h ;p 4K  ;r ZPP P -L$M P P04 8<S S D$K<$0 0@ QH8LHhA.P  <$0]P  PYU800\PU 0d0%`P LlHK$ i $L)H D 98:p<= ;P>`?< L#?1SDOpPU! 3! (00  <0 ``PP0 HLp !]Pa0@pPqx(sqoĶ>>>>$ -LzM@`TpP@K z6 K肏K,o8PU @ @:U@ -LM@Ph9ij`4k 8Xp @P<K   (K  w]P 0! "#ČȌ̌h  ;p7 @P,P!0 "# ČȌ̌h  ;p 0hkIiIjI ( -L^M2@S S! ,PK`KeK@㗱㔱㑱K2S " RlP@,PK`KeK P 2S,PK P,P (0S`KeK`K P$P 0SeKeK P -P@ -LM@ (p0`0@@@0#@ !@"@^!0 " #ČPȌ̌ h;0 hkIiIjIΌ; 0  @@@ M-RLp0P`  K o\@ j\pO0 0 \90\IL))(0*+4 8<0###Ƞ+)*(02s- qP2P000) 22s# @$ ,$̠$@L9$`$H:? 9;=>@8P > -LTMd 00K\0 @(#X@ P\PL)! 0"\@4]#8D0 <`pい^<` 8p 8j,0 pZhp 僔_塛 jbYgQYzl H< K  LD @ t)XPD0 PX`P X0S4 k @@PPL H < K ` pT` Pp *Jh:lp\0GLpKL`PoT K pWXHp$+44@0 ,0 X@p\D@ @9PJ PU`d@L 0DK@ D @ <K0Q@@ R%! d@ 0SD !& \@t9 XQ4HV4 pL ULpK(KWD\0@ D0 @@ D0TKY!\P,L)p )ds4>> p-L9`] \L^_  hpd upL9!] @\^P" D_# H L,BD#9p@> M-L0Rp M(KL)0_^0\]LǏ] \0^_4 8<4@Ps`   7,#@$,#Ƞ#\$d$x? 9:;P=`>p80<@(Ko(> 0- @0L,{(0 :0 9 0X*T:T>$$$@-L)@ 0!"#48 <9 -,0LS@P` 0(00  L |pyP0S ppPL8p e 0 (0 "\>>> -L M0K!`lP. .  8   0LIPty40 !0 "# Z00P1X R#T+ ty 1X R02I )(KLI 0! "#48Q8 [02A  000 K  P  80Y! 0"4#4 8<S 4 L)p ڵȷ>Է>> 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S= U%%%$%%%\0<' \Ɏ$ K0\0<&p 0?\0<\0< p 0()$0K0h蟎 >P>o<> -LMP@`;It)q0X@T& T %x%%%%%4%V V Ht)0L)p 0PV0X`p` 0d9+b KidH0FSV ViV V@>o< M-L0R TeKL9',&&Ƞ&'D'X? 9:;=@>P8` 0- @0LD嬯@0  8 p:09X*(0( T:* 0 :l*x>$$%$$% @@-BA 0 0#^0 -LM`V@Pp  0` WP 0 0(K `P  - 0L!@P`,0S (0  L pdippP L(p V 0 (0\>> -P@Lp5H`0S 0 H8 50H08h|GP H8 j -L(Mp`t< !PX 0R80 = R4 9 1R  0 X0S. S@,@ * L)S! 0"4# 8@ @ 0RR 1X0S S S@ R0, 004@9(K , @4@  IPJ   7Lɗ 0! "4#8@ G 0! "4#8@<T=*TT ˠ < PPLɗ 8 P   P K< @P @ @< P 8  P  -LM`p ʭLɖ 0! "4#8) @ TP  0 tɖX\ \ (Kˠ PPPLɖ 0! "4#8<S@ -LML 0! "#48pW t P`(KV 1 XPP Q 0P@`U 1 XPP QPp 98 =<0$>4:8;P?@ (A\L 0]^\l h0 P @ _@ČȌLK@ ` `P@$(hL0@ L48 l pl0G L^<NdkᣄT 45L@VNV\\ X0 K\ K `P d@ 0`Pt p Q{p㟲tp p ` p0Rd@tPT`h 0@l`t0 , !!,H t P Lp u0`, pp@p < !,,X<8P 4` `tK  D0 < 4` T  P D` @ K Dp@Pp@P8ʠP@ K p P+ 00 0 0 0 0Pl K K\pKX\ >. @   0@ 0@FT*TX :P[E] 00H$K~ 0  V S840L)(((̠##H#<0@8p[p4[夀L9 @Č壀89p妠  Ȍ:`< =P̌| ;>@x ?$(\  }|PK`pKpWP`P`B2MP` K 8cP`T`U 0dpK@0@Sb PPTP 9S_0K@  LPK`@K @ < 8`K0K`pd0KQ8` 4p  RL9L) 0!"4# 8<P`UQtə0X R^  0X RV 0@P1Q:L)p TIX@}P T9S +P" L)p (Ko/0  n}$! tp ^$ڔKpKpWP`P`B2MP` K c0`p Thd`P\ lP0>>>>L> -LM00K0 @%@ P0P`L9P]!\ "@ $#`(^ _` L ZP 0`KP PP0@U0@ 0Hh d 嘀dP0H 0c0C  x t h R 0 8@Qᄛ4X T0 x0K0 @ H0 D@ X0K0S@80 4@ h@K0@P@@ ܸ>> 0-L ML@! 0Y"4#8 0 K00SPtɔ0X RM1X RI0K! 00P00 R- @R 0S$0SR4U P%4%%|%%P%\0<& p 0\0<' ɄK0\0< \0<p 0 ̯ʯp>P>> -LMP@`Bt9q0X@T% T H%%X%%X%X%%V V *Bt)0L)p 0PP蝯VX`p0 0d9+ KiBVħ>o< -L9@] \L^_  p@> M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki> 0- @0Ld/`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*>%<%@%%< %%%%% @-BA 0 0#^0E-Bl pA `P (  0 8 , 40<`. VP n-\0\   0"  P1 0<0 nn 1 0cn n-1 0 n n -p`@QLU   QP 8p8 10!  \@ n nn -LM`, V@Pp)   0` [@P# 0 0 Y  QP 0,(K P `P   o - 0L @P`,0S (0  L pdUppP L(p B 0 (0\>> -`@LP Ap0S  U R P H8 P H8 0 P000 H8 0H0 iO@ - 0L0 0T0 *TX : 4@T @T -LM 00K0 @L-@ P0PL9娐]!\ "@ $#( ^_尐 T ZX 0`KP X 崐0@R0@ 0Hp l l0L 0c0C   p R 开0 HQ<㣔4ˉ|0 0K0 @P0 L@ p0K0 @ pKH0 D@ 0K0S@8 4 @0 <@ 凔ˉd ` 开>@ XBP K QHQPK  p K `KK`VpX ?Wgd p K H K h d  8`K`Vp `80K`0 \@ \d Qʏ 0hK@h d dW 0hK@h d A \1K8BL0 @4+ 0 " | 0##@ K D0@S(ڨ 0tx t0 @ 1X R02 V `0S hY x t @D0 SG  J  .)90hKūT  -DP @PhY K  V T@ˠD @PD@_Y X@ @TX@  0OᘀK 唐 T T HX  v PPq  Pl 7h@Pe T 60T ? K Kh @PPL` K  @P> K @ PP1Th K  yP  `@ K  @hP0P @ K XPo 0S` ^(KW@$ `0S\X@ hYd R@d\K V>W<FV`| @0##ഀ` \ H\2 @x t hT K  HX@x t uP   0 0 0h V{`0h@SsjhKT圪hD@0 T K @@ @T@ˠ@PqDX0@V & `^( h\+ T;  #0~ K PND0O\ʷH^V W `^\P h\d^t@hKx0@:Ÿhx 0@$@ E PT唤 K  TK@aP` K @ PTPD\I0@V* `P, h R/ x^2 T+0 !00 0  K  -PD0O\=H^:VW `P\Q h Rd\ x^tP"HQH^H\5=\ 0 0@ 00T 0*TX : <(⎩$>>>> nD>l>0> -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V 2%1%1%D2%`2%2%^0>& p 0^0>' K^0> ^0>p 0Hک@T `t9`X Tɩp>P>й>>> -LMP@`<t9q0X@T% T T3%3%d3%3%d3%d3%3%V V '<t)0L)p 0PP蚩VX`p0 0d9+  Ki <Vħ>o< -L9@] \L^_  pHL) 0!"#4 8<0S039@> M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki> -L@G00 TP0  H p:09X*808 T:t*000 :*(0( :l*$>0%4%4%%8#%!%,!%2% -LM  0Mm&9% -LM) 0Mm&9% -eL`Pp< (00p04S80,0d0804p 00 , 0@07< w&((0"4#220&$ 04 @ 0iA,>8>WEV9% -P L d&@ pP` 1TJ x1T) *`ῄX1T* P1Te/㺠`010S ` 0 э`P `P0T% 0 00" 0`0 eK@ 0be/删 =K 0T %40$ ( `,irdAhdsd edAk~gd9% -DL!88#!~P1 很p" D0020p(P00`t4Q!800@aT@!0   H4800d<0;@ }Z: o 0 8+0@00 <:@ loH:H ,iAA 8 8-#TLL%p)`P 0@" ,i 8 8-#L@( PPp 0`pP ׃0S  0㠈p0 pP,i -L@p0⢍x;%0L00 - ؀L`p0p!KP$  J@P P00 `(pPp 0:P,p0X@P00 @Z i*(,i1ji\>TnD>d> -L넺> -L넺> -L묺>800S SP 0S@i -0L -L@\p``h# 10 0 P 0㱥W hԺ>> 0-PL@0 00hĠ -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T QP0@i 0-d0LP\T 0@ST0 00 @pIT0@i 0-PL@ IP 0 @ P00S0 0 0@i p-1LMQ@P 0Q 20Q 0Q @ 0Q 0Q 0QP@Kp0CQ*0Q(`K 0@P{P  @40Q ,0Q @ B&B"B!B$$B%BB*B(B -T0LPD00S 4 40àLDiZpi -X0LPp@0P 40à$ L  DiZpi -h0LPp 40#D"B ,0S 0P DiiZp -$0L0S Zp 0-LPL0@S P0 T0  0Zp 0-`0L @R PHD0>G-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝh0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝnn jh<1s s0<0 0<0Xihi@-;@ 0$@@-:@ 0$@Pკ$0 -LKxhdwo n1 ^2p* K<0PlD"[0R  =X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0P0K |K0Ph `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@l(4 K0T0@0TV ^< t` D06040H0D 0  H0ti0PsD@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S"$@DP@ L T pX 9LG PG=8jHt !TN8jt0'< tD060<t X@(0T04 K1@P>V UF40H0`1@0P 04 O0tlt H y\@ ;pl0PL! !Pl0*0 t04PXP 4h 0K 0Pw T0Sl*7t< q PD0\@ 60 < te @PD060pYX 4i\@ pQ< n R0S  0G- M0 v~ L1 pW0@  Ѝ1 PN1a@E1 0LOBd g@  e g  0P n0R @ABA21C 0#!B0 031CdQ ;0S9@0U5:0S\ \ 0S 0S 0S0P< R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KnP0 H00@PQ -L4M  $0 0<0 @K;   1KB Kؕi -L4M0@ $ @K <0 3 K訖i 0-L M(0@ P b$p咐!0S(0 K0S   00 $ (0!Z(0 7? J p-0L@`P5 P p⥎0p0d0p0|000pp0P d0P |000pP po0p0d0 |pPd P 0-@LP9 0h(> p-0L4M"`@0Ph +P 01`0D "P <LK( 0P H0 t  Kp0>i 0-L8M @( ,0 xP!0K H 0@ $ K0[S< L@KLK0L@KH0 0H0 (i8i p-0LS@P p R R`d ЍP0 <0p`8ōP0 S 㻍P D>8>P>0 <#<0@0  p-0L@ S h%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% z"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ W$0V0$0000p\>7?/n/n -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\؇%%%%%%%%`%%%%%%%%4%%%%%%%%%%%%%%%%%h@`T   0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`帓p@`d0\@`0pd `㰐 ዎ@` pd@7?|>/n/n0@- 0P840 iii>Ȼ>>> 0-RLM@Pq 08@> p-``P ,  0 QOL 0@,0   $( Z 㛉BZ 㖉 ep 㒉p -LM`BP`p0S00 `| -L  p,`P`B 0 TP` 0 ` 9 4$0`R:$0 -L8MT`$, PD p(K%pPPڨ5 Up @4!0@@ p W@D 0FpPh0 l0S00 H < L @ 8 0,K/;XpP,0H@ P#0SH S S< ,P 0,0 dY,P 0,0 < R 0 DD Q0DT0 X ` p,PHQS  K 0 {Yw 9 t30`2pLQ, <@ L ,p H0Sh0,8@ H ,p X@P ገ@ P @ 4 ᄈ@0P0 @0 |8@0P@ 0 K0@0p Pg 0p e  9j3i@<P 0P84<  0< 4 P 0P" 4W44 08 40<040  ( 0$ , X00 T00^@L`D    $0 X:($0D` Ph 2 0000# Q00000@SQ 8 P@" 08 40<0  ( 0$ ,@0 0H\ T0`4 0 0C,K0/8Pp ,0 HPh0h0  ãh h ,h 0,0 n`>h>l>p>c -LM`$@p(KK p 㠱pP$0 `RP K Z 0>pP@0,0 0C(p 0000pP@0S pP  KspT h 0 #40Sp*7P $0; 0SP xp 04!P / pd@ZB_OPZ ZGYO Z Z? Z  p : ,|y 0PP 8i p- 1LtM1haPP0@PP Kp K/PP 0K$P PP 0   B  10h@P0 00, ,`"DiDYpnxjnt>>>vn -LM@ p]PD@`00@<000   ;tx 800  P H@➆P 0S S 0P@`UVP00 ;00~0 $B Q0BP( w8 s 0^07<@`0@p P:0p0`007\0 (Piᾋp 0 @, en, P`>WEV T0s 0s0s40s@0s 0s l0 0s P0"$0s PE00CS`%%%%%%`%`%%%%%%%%%%%%%t% 00 H000d 0S  0%000ʚ;0d@/ - L⼌谼> -LMPp0d0CS<l0tS q T ` 0D0  Kp0S@t0@u`Pt0s8H圅t<`r @`00@`;00e @5̼>0d@ ;/0d @5/ -L@ -L@ -L MHd@P0S p K0 C1 0(K pP ('( H 00S@ 0S0 S%*h0" KP 0S0  R*J(p(0S0 S*[ Op<5"[00b0"[000"[00b0tn -L@ h! `p0PS` :` p`#NPdchsl -L 00 , 0^nP`U TE*Ap1 @f0P  00,08 0 (KT-*. A.0P@ @0 0Y t4 00< 0S0c>0a00 , K@@@d>00n 0, 00 6v@r0%%% -L M4p`@P K00` pP 0SK -LM@,0  0B+2` 僢 0PP'22 Vp!@!P#*@ @T!*0S P 0P: *p 0PP  N* J*(Kp PA* 0R P0 S, WPP -L0>0 1! `\i>Xitnۣe% -LMD  LP 1 P 倀 K3pP@`V p@ l(,00@(K4!0 pP@(0$ 4!0 pP @04! h@K 40pP{P5[S p0  [(3[@RL 0P}pPc[Vq $q ^  0S!!(0K!  1R01  0>. 00b>01 !  z *1!0@ 0` DR0`a S(K1 0   0 !.  . a0 S1Q>2=12>30300 5V* 0! 1 1 0K$P PDȡ `! 00\ . 0C0b!00`D  ! `\ʼ#[Rp`   1Q8 1 `0R1 `000 40 Q\P  0 c, 0K4K ,0KP\:00\,%* , b 00b$1#[0,0 0,! R:0Q*"!B00  000 #[a p a ! ,  ۣe% -LHM8QD1U@$0 p @aV $K 0xP3P  &V l{ K0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00  & ?{>tn -L@P 81S<@ -L M (18 @ `@ 0SD }P 0PSU *0 S   0 S  R: (K00@ T T@ T T TpH@ Dp  0T0S  Tp p T p@T TT D H 08#8;00 0 40  8  4! 0  N ,',K.w,'Z0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P (1 0(1? 0& @< ? N& 14:0@ 8 (10(13 04!" 08.z<0S P @? %P<? % h 04! +0@  T4 8 j 4 8 ?0(1,'0.,#'+YP@ 0 00 S S0 S S S H H00H0 0SHD 0, 6 04! up>i>tn -LP P   }%P`pPU 8] U@1J# ڤPp *&% p-LM R 0.>0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P@4  0P``0  `P  . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW x P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P \  ?i$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0$2AC `oy 0P  ?!$`p p-T1!!1@@Q(!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp<00C>!00 cc!(i%0hDYp0hxDYp -0LHM,0 0@ L0 T0$ ( TK BP T0 dP P $ K@>4> > -L8MB 0R<0 0 !K0S 0`0  a 0, (K01 :0 0*@P0 `_PUh1PU,Kuz0@c 00 0`Cp0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp jP& P gPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ Ϣ<` `F<K Ǣ(K,B($xnT> i>n>>`> -6崖LMh|0U\w&`\hxY'( `(\P4 Q \D6 R0 0,6 00  !!D 0(D  !!` R0@a 0 ,0E00S 00400 4 0S000 0 `0  0  !!$ 0,$  !!0)0 5 D01y LbU>4 00%7脟8( 0A R4@4@@ P  kp@P0@0`x @0FP`pP`pX@\Ph@lPp`tp0T@`d*1@@@%4 L!

(:@ PHA@hp:ZHß,K 0 @@P,0c3 C  0S 0 "gJ0S0@(_`20S P ~ŸR$09$0 0 @Pm lr 0c!0 @ 80 80U 80 @O1`V P>U |@O 0 0@PU`V 1~ P@!1w P7 ||1p P. hh1i P% TT1b P @@1[ @P4?,!00Hv!0HIX~V~T~R~P~N~L~J~DYpnx'nn$A0on\pZpA%n8"nTn̽>i>jԽ>vnunnD1>n %>$%0>4%H> 1\>x1x>$ixn>>>>h>P>8>$> >0X00X   PX0S0 0SX0X00P0@-@PT! x0tS X R x0S\ RX0X 0X0t0St0SX@0X0X@0 0-L@PX0PS00 0U 0S0e00 -0LS@ ^ x x0Rڭ00C0 0X0 X0 0t t0S - LR@ X0S0@ R0SX0X0 00S0S z  w -L P 0 0  -L  P00 0-dL\0PU @ 0$0$GPU 00G0hꜨii@n p-P@L`0$ 0CR0 S 0S  0R:0\0p G0\0pzG 0-PL@,0@0 p-`@LP,0ph 0-PL@,0 @0 - L M, (@, T4 Qb0epP , ,(0 S@0P 4`  "100 0c4 0 @X 0eP00e0,0p(,Q40 0b0(Ki< p-LMR 00t:t0@T PF0 S$ `D0 H0S!@Tx蜨i@niȾ> -LM`@p#$0S $PP0 H$0S\@000,0hо> p-LM0@SxPU 0R: `  40H 0 BQ *xhؾ> p-L` 00 ;@ 007@PPp 0-LM@,0P00x0S h0XX [H0SD R00 0S008h@ni>i -QLME hp0OO$ Bb!R^V )ڀP@pg21C Pp, (P! Pn0S 0xx H0Sd X00H RPpPpU {{qni<@ni>i>> p-ZL" 000X00SZ0PZ 0O Y,@`PPppYp `0ST0 P0Bc&0@0@?Pp0YAA@Bc p-L M t0Ϡ`$P ` Al31C0R D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` a>KpAHnA ADn -LbLP0 LS@hQ RP L N 200S. U 0D  EL00CSL01SGUx00x040 0@408@0UL0 D0!0D00S000iTpD0 7L0,0CSL0p00p0D!R/$0 0@$0(@0L!0HzL00CSL0ʴU T0S t00t0,00 @L,00@Hz0 0@0 @<0 0@<0@@DYpRjDn\nHn 0-D0L # 0  !D D !X00CS0DP0S T 000 @j0h 0TnHnRj Rj -L Ix0P l l0@@@\0\QT00S{<<0 R@hF$y1'LnRj RjHnDnA AXn> -qLhQU $0"  1 R/ H00CSH01ڂHXPP30`0SD G?0$1S p1 KP0  !$ $ !(11 RH00CSH0AUNH$PP 0@P `a0S iH000 0@@03 A?0 1S \0JP0  !$ $ !0DYpHnAtmLn -D0L 0  !D D !`00S0 H0 R m 404 @,0(  h TnHnXnDnRj Rj-A" J1S 1 0<S RZ020CQ^1S100S^0Q:0P(0 -L@P00 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p8 2028 (("800 0-0LS@P P R000 _! 00C0p0n0n p-LM0`P}@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K(00(00 00KP 00CS 0 00KP01K(00 (0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -pL2`0C8#8S2F P@U R 00 0 PU@Z@@0S#0202S' ' P8 P58P  @P  <hKo' 00202S`n - LdCm`@,H00000C400 20  2$`nL> -LM8,0,0 'HmPH oP) P&,0 2j 0SOH0 `Pp@0 0 0  `o o o o,   0@S`S  0 `S@ R 0s 08C8SK 0`S@40s 040< 8 @ `cVڃ ?`cVV0' 02@r 0W ' 0@' 0q A0 qA`nL> -LM` 1R/2P 0 p!, 0' @A 2o dp@ (o dvp0ST02, 0R0(K000 02Q0p, ' 0,P0' x@p@B@BA  n,0! d?p@@B@@A Qn d0p00202S' ' p' 0 -`Lp_PP ` 0 S  S0S<0 ``0BS 0-`$@   `K -LlMPp(@P ` 0匀K0 0  0`0CS 0 V  KhVP0` l ǘ` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLLPHT 0 @n00, @n0@K0T>0n\>`nn -P ph` LD0@03P9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 + R 80R  DYp -LM0 0(00p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? n2@`v`  V1@K0 SSBC  c03P< }n2@pI00(!0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$A -L8MP pPy`Pk  0 S"&\ &t & & &\ & & &@& && &@ L 0SHK $P堖Px3[SK #[Rj Rq R 0AS 0P (KP@0(! 0@X0 T@ 0TP6 Y*,@ P, KP. 0CQ  Y7P0 000 ,@0  000000  8C80C 0(B80 0d%8#8  0 008#80 0@K("( 0  P0PH 0S> P00 K000c0 0SR {PL b0$8C(R 00 m0S P0`0iP ` ,1  0 P0 SQX SNd$0< I08#8@000  P0P 0#8#8 0 00  P0 *HK $帕P3[S #[8C8SS S R@  H0KPzHK  0  0  !D D !L@ H0K@5VS @@P H0K@@ -LM@ ^ 0(  @c -LM  0Y -LM@p$`KU' ePPxx1 Q+@$$0^$  1s 01 !0  ! 0^ 00C0qP0  #1 01L 00 g0(0 R 0S00 0$ 04 00W00X$00 00 0 0S0n$A?0nn -@pLaPV3 0 0 0!$0Q$1s 00!0 ! 0U 04 0CU0h@0 #1 01 -PL,`p@ 0T  0@S* -PL,p`} Q@@Q 0   @Qh~ p-P@L`P P ,@XtPip 00 0 -8 L018 s0$<0  Ĩi80$ R00 0S008$0 ? S $0  R,08@ R0@0 0S00$ 00@-0@ 0$@10S 0<0,j<P,0 0 ,0!P 0-@L Pc R 0 0 00  0 ,  , 00C00h 0-<0P@QL 08 1 Q000S00,0<0 R 8 00CS 0 D0hg0< #4#0@1 8Cn p-@LT`P <0 @Tp0!8 00CS 0Pgn p-P$`Ll ii0*O  D0H@T p -< L0`SP<\5 0@ #4#0 1000`,04@0TLS*0 c4 8!pg4 `!/i8P  4@8p08 1000`,0@ <01<@ - 0L@  h$0 09 0 0 0hY| 0-@L Px00  0@,00,0   0h 0-@LTP@T <0 P ,00,0@T0 0-0L@@P 0h#,00,0 -LM, 4$pQ8 1@0T `0PS`, U@4Q<Q q @ 1@0T `0PS`" U@<0S,0@$@ 00 0[<08 00CS 0 <=fP<04fP 8n -L$P @pA@ `V { 00 0@ -QL|M`   h S3 @5 ?L3c 4 0 ,0 ST00 O㜠  0PI @pTOQM 0F0 00,%9 0S74 00 ,0S @Kb=@pK40KW T R40KLK80D LK cPRL H D H0Sl$43C" cb 4@K>P  0(K0吀K0 P Z0K0K $P  , 00C0Z@ @ R 0 0 00  0X l , 1= 1H 0> ,0 $ 0,000C0YJPT 冐 00Qp0 ZP唐 R00 000 8Y40j<0 P,00,0  B 00 0 @,00,0  B <0 ` p0Z. 8  <"!B$20 j[00SHڈ!43C" cb @K<4pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R 00 g[s a 0#SP ]@ ZMbt>A?BQ -LM0`A8@|ZszJ $3Zu 0S} pP - 00 040PP#(*80QU#PU 0S!0S 0,0 , <0  ,W 00CS 09 p0 U^ 000 4 0(0 <0@ P'(  ,0 ,00,0  ,0 ,0@ R0,0-     ,00,0 <PpP @ .4.0QUPU 0^0S1ASpaP  8p@<0@00 04 0@  PP p   o in -LM0p2`S" S PK 0@(P(0 $@ ʌ14K 4 K,p P 3KP, h0 08, 1[/0@ 0$@@ R 0S000@0 -L0MH L PD  0S < <(K 00 0P 8@K P< D 00CS 0DH@D Q$L0$@0 P Q"!BP, ܍P< ,\) p2BAD:$@@2H  P Po 0@S@ 7 0P4`92 4 0 0 B 0 ,p\2 l1C0R 0@\L  D 00CS 0 H0  ,K< v,0L 0z< DH -LM`p,@$K( KrPU  K$0 $0 $0t  l`@P$0$`(004 R4P$ `(00(0$ 00CS 0$Wꨨin -@@LB  00C0i p-0L M `Q %0040O$KBCd31C0A#!B !_$@ P  W1P 01  @(@A@@KpiiMb/& p-L M,0@ 0P ` $ ,0 14\0O$KBCd31C0A#!B !_$@ P  @AKp7Mb p-LP4`P( D@%0h V  40P wP18` 08#8 1 40!O 0$@*00!@00@Ppp p DYp 0-@ MLDP 08 @}c( $D0 @ucK0|>n>n -LM40@`8 Vc>0p `0`0`,K@0 @P0` P 4,Jb0, ci -LMp4 8 @P 8K` 喌P*840 @10@0!0P,0 P@8 ,K ,ōP8 0,0 B0R,0 P8  oP'00K@ (K4K  aP`@Z`J,K ,坍P0 ,0@T0P,0 ` J IP'00K  ?P -L$M"0(0, 0 p<`P Zr Z `l8` K(K00 4! `P(0$0! 0@;00@4!0`P1 I 4!00`P0  IP4@ 00P,K  `PW`P;, 0h0b 0 R`0PA0P41<  Z Z (1#208`0 @S00S 0S Z ` P  0S* `r00 4!\8di``Z$1 !S`#`3R0 0!( $0S Vj `hDtnTiKB/K %K(q Dr q q 8r 42 L!  pPE<,J(1\ Tr @PPU \"P , Rt 0 TT2pP0T2 00@,K`d 0` 囊pP00KP K(1OQ _P  X `" 0P\ _\+;偪L? G 0  !X DD ! t m$ RTr \B \BPTr 0S 00S  ?  TRT $?  (10(1 0,(1 , TPp PU  , R 0 ӋP00@`d,K 0` P00KP p~?W|pzpx: R[! 0T"00 00100\00`00!0S00 p[ 01 L! !ռXH!<. | H1D!0>0>00a#6l0@! . @10>00a#6 p0t 01%K>0#6x08104! $PX"08Xe A4! 咸P= T(>Q<^P  g \^`" 0P\'7吩L? V  0  !X DD !{?P\ p  P]T@ H 00 L@Kb%K \2$P X"4 ω`PX &0aX^0P@`1dAha `T0XS0# 00 L_X2V/6X004@PP1XT40E@0!!X0D  D !!XD @ 0!!X0D @ D  !X" 0 !D 0 D  !X2 )1` R 0  !X D D !1 0  !X DD !` 0R 0R `v` 40 0 X"`2P 0`00<X"D0 s0@ 0@\d$0@0@0@H4姨D\]`"P 0X@,0S %KP d2%K (X @PX"D0  q$L ?D X01S/ L R,  S (1 +  1S+0D 0R %K 1X010  !X DD ! PpH (X2@_=X21C0 \  lq 0R/ 0R+0R(0!!X0D D !!( P' 0  !X D0D !`1`  40`01 0`0,C 040 P4  `V,L < K4K V@@PX/8KP%`" 0!8P'X8 00040@4 00408 40$ 4(00(04  00CS 04 <u4  , <k4 8ni< p-L\M0@ S`  K\0lK`+PP0SQ K 㘆P 0S Q lKP ㍆PKpP 0-@L84P,0S00 0040@4Pq0h*.,i8i 0-LMPx@T  00@T 0 R404040 P᩟$0  @ᘟD0 bO0  !D D !   -8i,i> -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 000!L0S0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $-W@ $pD0? S=C  !D D !H R   W@$0 3h = l10CSl1N P#000հ<bl1S@02#J.l1SD0 | xy_9, @0S  00 p 0  !D D !b l GzD0 ^!$0 l10CSl1,0S.,0Su 0!!D 0 D !!("([? D@ 0!!D 0@ D  ! 0 !D 0 D  ! , @,r6  Wh0Sh Yh0 @, R 0Tp 00,h|0S  T zPp ;pP l'$  b(*nn0oĿ>>+n> -L  -LM@Q K00  㦄P u   l@-88 @2 1 0!0 c@RjQ n -L@ R 0 SNPyPP0Q  ,1S 0S Q 0, R n(*n -`0L RP 0@@<\@P U@P8"nRj-00  0 0l14000,_E7L ' 0h!0DYp -0LD @ h -L`@xpVP @ZD JJY(! `0004P4D,1 D Q0 D' ] 8' 0' /D0< ' D0D<DD@ɌD Ȍ8DD0p R0 0 P] 8= 00D0<  'n0 *n -L$M@ D0 ` #>!S  = S 4!<8AH)nx'Lt4<"n$*n*n*n0o@B> -LM  0  K -LM@`0,(  0@ @KT& p-LMP0L S`@Kp0 $K0 $0 0 嬀@P($  0 @P`@T& p-X`X0@ TL  04PSP0 X@TpPi\"n p-d0L@`TP p  P $ `P@0p)^\"nPi> @P- p-@MLK`P 0D/@ @P XV00Kpn -L 000@0@0h` -LP  P P  0-PL @kW0h  0\ aR0\X0SLL 0HS900S 0C1S0!S0%5\idixi`i  P-L>00 -QL@M'0S S -$K0`@KA< U W<  0 @T   0 P P pp0 0V`P@05f@ ;\_WPU`V0 0 C"nhi`"n@> -LM`x@0, K !6P$ K @& 0$@|0 @```0pCADp0@P@$U<`Ki\i0Rj"nXi"n"n"n -PPL3 0  bB&!0`xG01 SG#0!B  %0#,iM@F Tڲ (0&i="n"n"nXi -1L$MP`(!31Cp Y>00, Ã0ʃQ #0@S00'0,0T0a(K )V }\!>0 C6 00 6P@40  04 0P @@@ҜPP" ,  Z0 0cC61᱀00@4 0jj00S00#00!P0:\"nD>iXi"n"n|> QP3-L@P`p:P ᎪU hf  \>000 0 h10S 0SDYp 0- PL@U0h0 Q0B0RR&00 h R 00CS0 DYp -0L,!,M10 `h  P@p0 T  0S (K&@ D 0@0 8pK 0% < 0T@ D00&<0S  }&#E&P DYp4j< -H0L h  R@0 00P00DYp0 Sh1 000DYp  0R00  ]0R  T0R0B080S880 -LMbp<0 P @2Pp8 hp (K)0 H @P2`00Dp00@P,P0Sprp4P 4 10S 00<000 00*  4, 0 tx00S88080<0 8PR00,K  `pPA,0SH0O 8000@ 0H!F&00  00000D,P0 0  00; @pWpW<8  `0b 0R0@ b0 @ 0@STRe,,0H0J40S4 pDYp,rn!Ce>P Q 0, RH0 @0 P,0 S,0 S0P*n*nT0 L0 P 0P ,0 S$0*n*nH0 @0 P0 S0 SP'n,n -@LT )0S0) R Q  @T - 0L,1@SPp ` 0S ,@T$@T ,P 0SD0W00000CS0$@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 0Q h,Qt(n,*n - @R0L00 ,0S 0,10,1 -LPp`P@P' ,1T\ V QP u ,q R000 ,0SL ,A0S0 00P@VA 00 @P@,1  Q0  !D D ! `00!@ R00!p  q0 0100V 8P0PS,1 000t(n,*n'n,n p-0L 0 !@PT`@T 0Sp) @@T P0@0S0`p@T 0S) pD)n'n -L@ 0@T @X> p-1L M`P ```) l1@ZdAdQ0S 0C) D1N0H)n>'n>+n>*n>,*n$>t(n>0,,0=9 =0 0,0,400400D0 00004004000S 1 1 0\ 0S0S  \41 PV/0 00P0D  0"R001010 0-0L,!P @P0 {?P00,! \  qz -0LS4a0p  dzpT  ]z@U  UzW@T@ -0LS4a0p  AzpT  :z@U  2zW@T@ 0-LP\4 A\*0! zP@01 00 -0LS00  0 001 !O\ O00CS0N*n 4R4!000 - L L00*n 0-L@` PkO000 0-0LSP ` @[O00P0 0-@QLP ,1 P ,00000, Q P 0,!, 0P 0 0-@QLP 0, Q yP 0,,!  0Q 0,0000 -PVLP@+=LTp,1@ 0S V0,` 0h0, R C@P P ,1, P @\N0, R DP ,1  Q@D0 @,*n -@L0|,PKphK,1` R P 8M,M 0Pt(n,*n -LDM@?pP`Vp(KhPK hxpP0@\ l0 vN rN8#81@0 , !D D, !l -` L0pS4$ 0S 0S PP@\ AN`@0 , !D D, ! -P L0pS42 0S 0S 0S P#`@\ N0S PPPP@0 , !D D, !^0U0U -` L0pS4$ 0S 0S PPP@\ M`@0 , !D D, !& -P L0pS4> 0S 0S 0S LP/`@\ M0S =PP PP@0 , !D D, !Z P A>0U 0U -@tL`4Q [ 0SX 0S 0S 0S PIv 0S 0S 0S P9pP\ .Mt@v`t 0S2 @P0 , !D D, !t P xt 0Sv 00Qv 0S tv 0`S -PuL`4A Q 0SN 0S 0S 0S P?v 0S 0S 0S rP/@p@\ LuPv`u 0S( P@0 , !D D, ! u 0Sv00Qv 0S uv0`S -PuLp4A` W 0ST 0S 0S 0S PEv 0S 0S 0S P5w 0S 0S 0S P%@\ =LuPv`wp@0 , !D D, ! w 0Sv 0S u -PuLp4A` a 0S^ 0S 0S 0S POv 0S 0S 0S P?w 0S 0S 0S P/X@\ KuPv`w p@0 , !D D, !u P w 0Sv 0S u@- 0p 0^0@p   p0 @  P`t0@P`P`x0@  ɚ;6e -l@L 0 0xpt -L M` @08@ 4P @P@ P@0 , D H0  S0 @ @ H @(K(1( R1! 0O@0 <@  0 0@P  08H@ K 4X% 0@PD0  0H@DPT 0,@@ K ! 0@PH  0HHnʚ;A -L$MSp 0K< KH0K<KHPK`00K(4`@ 0PQ/N`LaD#b $K0K< Kb,n R0"( t p-L@ `PphX p-0QL@P`h0S- P J@T i@Tl 0!pS s pP I 0pP IpP >K 0-LPMdPK@ PP BtK0 -QLMP0S ` (q 0S * qP`(A0S \ @0S@J(>0(!@0JSܕ&Е&Ԕ&Ԕ&Ԕ&&& 1QE 0S= Z  1 ?Q 00SZP/ Q '$ 0f `. .  7x0 ?l0 d0 0S:0SPP 0` fQ$AAtili p-LM@(`KP sP SKp p-41PLQ \0R00S0D!@TPDA @`T *@T5p00Q \ p p -0LSPp S# S P7Q  hP/ PP @T ` @`TV0S41 h0 @T `@T 0 R ` 0, *n0 S-L@- S SP6P D(^)^ 0N00S41 0 \ )\ 0 RD1^ࠡP P P )D1^ࠡP0, *nNL0$Q0,1(10\PVQQ 0!Jj< D0 Q D0 \1  D0 \!0q03> Q D0 \!0q03> Q D0 \! Q00># D0\130#0D P t0P P0LSP0R R ,000S #00S !  D0! \15 P -0L/Sp@Y0x!PNTY  0 R /R0/S .S0/S XI@`T:T" T' 0TPD/S 0u/S d@@e`d B@sGT*0/SP @Pt =IPT0S*00D d BVG`F IT<>@> -LD01 RN x1$Ql1Q( d1Q \1Q" \ * H1Q- <1Q 41Q, , N0CQ1Q0CQ1Q0S0 0Q 0Q0S 0Q 0S0S010# 0S0X Q00CSf f@ht@{f@i$mt,D>}frtoB@m @~f) -LM`D@; S  K\13V  RV00S W( VW4 V6 P .@, 0Q@PMpWX0S 0S0S0SX0S 0S0S0 S XW WX XX X X X X XP> p-L MP. $1`t,7M0\! $@K G0 $0 ~!  0\1Kp  > -LM`D0P@ \1 > -LM0PD`@ K<K G T, (@ Q  (1R 000 0 SR  0R^0\! ' 0 0C#XPp 3@P rL0S S tjLh "$@\aL0SpXP$   >>> 0-LM(1@ S& A^KPE+P(\1@ $Q- Qj (!Q\1   * (!Q Q*   K0$!!RW $R9  # (!0S 0FP \1@ $ A*&R :R}FP uFP(!0 ,1(! ?O  dFP(!0 ,1(!H FP 0(!\10OFP FP  FP =FP  FPF @/FP{(FPu #FPp FPk 0\1DFP XFP^ H FPY 0\1>>>4>>L>`>x>>>>>>$>0@-(1PrP3!@ 0, !\!" \!, !(1#2 0 , !\ \, !0DYpDYp0 , !  ! -@L 0@Rjp-n0 , !  !-|!X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|x-n -|LX00,X0!00 @dd0$@d@X1  0-@MLlTP `0 P@}P T8@0( RI000K0QJ@&nRj>> 0- LP1`00@ Qd0`@ T@dAK 0h90&-n -,`L hqO@+0)0|`P0  !$ $ !_$0`1S$yX1S!yX1S .yp`1S 0@)0?$r\!R 0Q404040\!RDYpt-nX0 R 0S P 0S  R |i p-LM@KP`P0p R R 80S@0S xx 0-8P@L7000hI p-8P@L+`V  09ph"!3@ ph0$!-n -@L0pSP` @ P@ @``  I$P w!8DI ,d"P 0  -n&&>>o< 0-PL @jl0p 0CRl00p0 0S008 @!00CQ 0h -L@ ID D00CQ0000S00h-n|i p-PL @-l0`S 0 R0@p00p@810@ S00l00l0phjp8 8R P8  R P@ @0@0 @80S@@00nS 0-PL@ ^x 00@000h6T0 R 00aS0 @ 0@0-n|ip@-4`@V0P S ^ R D0 T $00Sp0 Sp S V Vp,!, 0S D0 0S Vpf0 $10$1 0 -@0!0Q0""!A0 !!Q0 1䀩i- 10 P P P0  !     ! 0  "!   !  "!10 !@-X!0 .!$ $@.! ,0h@!81 -0L0@J 0P > -PLH0`Sp! PD0  0)0@ H0S WL00CSL0LD0   D0    -Lp`PPLWi W0  !D D !.!D *D  !@0TL0H`%WS @T T $0  S0 !$ '$  !)  BR&&&&&&&WM $0 W0)0ĕ!L00L0W |L0 0L0t0 s0  !D D ! )0S!L00L0tm p-0L`P , !$ $@.!V0l 08#801  \a0S  IP` ph40Sꀩi -1LMhA @0P40 0r4 00` !! ! !\!0CR80 h!d, `1, 80 YQ $0 100  0  !$ $ !X!0 ! 0 , !    ! 1U01 0!10101\!0R000`1\1d1h14  018  ,0 00  0 (K(KoKDYpi -@`Lp P>T`@00 V06p0 0 -L ML1P @8p^@ N?(KP 0 0 0 gPT (`K gPW  0 @1$0 SN?"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 Eg@PV@ ,pK f@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !|0 WhaX0@P `0S 000 0@@0.nLn -$0`3P0# DLp!0@3PN = @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D ,1 R8#8[/W0m @aO D  D  !0@3P@R 0  !  !B D D8#8[/0[/B0W) @!D  [?P  @0@ h0  "! !  "!0 | DMꀩi> -LMpPD`R0 Am Z @  D5 Ay 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss )0@S Sd S`n iV (KoP Q005; H0QP  !  !(K0 1 10,0 1,   D1S0D1Dž ,1 R 0,0 0  !  !j$3h!R 0S  RGP RC $  1 P92 (KoY )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)060  !$ $ !`12S201Ņ$0 j 1gP0  "! !  "!k00SH0Se $0b  _ 00#!001 00#!ꀩiDYptm - L mN i Pp-L`P @T U  D0 V@Tp P-L@oP  h S-pL ,1@T< P,0SD0 h 0S  P X*@TZ# R& ?P& @T @T P,0SD0h P X   0, *n -LPp`P P U 0 R Q 0S U U U  hlP @T0P \ 0S U U U @T U  -@L T` "R"0R = B @PP  0S  PP $0s GP  T r R 0h.p 0h$ b0h@B0$10CS$100088-n 0-LP <60J/@80$10-n 0-00L$!PR @0@0 -L M88 t0@ $J 09K.n&>-n -`L00@P" p9 0@#P1 ^1010  !!!0 ! !!0P1N 1P 0R 10P0耩i -$0L@S ?0D   10 P Q$0 0  !$ $ !X1Q 1$0 v1|1!D iQ 0D   10 P0  !$ $ !!0 , !$ $, !$0 -LMp 00 0K 0 p9PP 4K a`PE,1PPO0HL 1`Q5 0D   10. P +  @0 & W01 B0 !   ! 0 Q` K 4b`(K00 U#V#J 0 ` 0Aݍ004P/1,ȟ@Y P`v0S`PxPBɚ;Rj>AA -0L@T D0  0!!D 0)D !! 0 1  @T *n -LM@PDA ~`01dh`\aD0  1! 11  (Ko !0 000 @ 0! 0 , !    ! !00V1 0!10101(K耩i p-L`P0S @ T0p @T R0000 0  R0000 0  -pL@` PP W` P 00  00S00@ P0-LPP@@@T: 0P T 01 R0D00:>> 0-LM0PS Q@ R  R 0A@S0@ 80SK` `P  0 B0 00 0@@ 0 @8S0 -pQLPT \Q 0 0CW . \, @ R W`1`!P$0 70S( `^ 0 f0 0 0pf0@ fW0 @P0S  ` _ `DYpQ -L@M0P@00 ,@ PL #0S c@T0H0 P LP0S 7P@PTPHP \ßP  qD#P  j(ß@$3@ß`0 @ "  2@`Vl pAKA ŸR20H g"1<2S7|ŸP Pp37, X 000@8 @0$0(@H,0 P0408@<d0Hp0TP``V! @ 6T0K @ %5P A @0 BC  Dh! E FG@@;W$!00`C 00L(KU 0pW L P P`6, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPQp`WD4iUnUnP>$>-P  0S 34\^ 2_Q0S :P00 (0DYp -@LPp`{6T  0R U T  h_  M-PL0 0S R K P ^ -PLM0  0S R  P  K^  -PL`p @ 0S:PVPR00S P0 @ ^P00  h'^ -LMP p, 6U`&,0 SR00 SU0 0S @V  ^P00`,  ]000V R S  Db^P`@A Y^P00z> -L MP K -L MP K p-PLP`  0S@U@R00S P 0 "^P00pp p ph] p-PLP`  0S@U@R00S P 0 ]P00pp p phl]@-R @ Q\ 0@- 0-LMPR@@ KP0T30%K00 p-LMP PQ`'0@S)&<& &&&&&h&$&&&&&&&&&&p&8&&&20S KP 0Kp20S6- 2_2 RxŸ 0`Ÿ 0H2H"@ 0@cFP0 P]2@FP0 PR10S  +10S-10S-10S- 0H P`1`!à0L  P$10S 1 :"~ 0 0b 6s 0 6k 0 e 0^ h0X$ Q0n/ni/nDiixi0o0n0n/n0n,Un@iiZp -LMQ`@p E 0B@S񟗗&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&X&&X&X&X&X&&X&X&X&X&&X&&X&X&X&&X&X&X&X&X&&&&&&&X&&&X&&X&&X&X&X&X&&&&0BRS0&&l&&L&,& &&l&&&&&&&&&&&&&&&P&&l&P&0&&& &&&h&h&h&&&&&&&l&&\&<&&&&&&&&&&|&0&&&&&&&&&&&&&x&L&&&&P&L&l&&&&&&& K 01 0* 0# PP 0R`9`9^ L9R@ #K 2(  000QY@备@T0 @A  0&Rx8x8\ d8R 0 Q~V #NK` [P070S0000 00  00KOrG@ PyPi00CUSPc0S^ @_`pd 0!0P7P'ODǟ 0G(ǟ 0{? ǟ 0s7Ɵ 0k/Ɵ 7'F,K , ,P,0 CRS0A 0}- HƟ  6Ɵ 0/ş ş L@ P00R00S 550Bn  #>K0B ,R ( Lş 00ş 0 5  4` 4w 7ğ ğ hğ {LD@ PPr0So 0m-k 4d ^C0(K ( b(00Pß L@ P00R00S? l3;`C K, @P0 R- 0S$ŝS 0 ,Q A 0=O͠ 2  2 A 0`Ÿ A 0Ÿ PgϠ 1 0 0 0 t1 \1P 4   0h$~^ VnVna0DYpiZp4Ai8A`sn -L M0@SpP (`K UP K`H -LMP\pP 0`  .L @ K7`0@KU ` @ 0t03V0S@iani 0Rj0@-,P@@40T @0S0di0@-,P@@(0T @0S0di0 di -X0X@0LSL }?’D0?< A3c 0 0 ALiMbRjp@-RRP` ڔP`0Q @0p$0@p rP`<0Q*0P`Q 0Q4nLix@-P 00$\  $0(@Li -L(M@Pp Pp 00@PT x0H`K  d 1 d, @D0T  0  @(K`iz>|>XF? -L(MĐHKP@`p m,  0PP (K%,P X0@T @T ,P@PLi`i-Q00CSX'p'''- L0 800 0 ^RjRj -"LMp`D@ @0<0 @`T*@匒P0l^@`  @   1 P` A$ 0@ V 0$@ 8K0K00@R00 ,@  8PK`U0 0@0@Q08PK`@P`8P 4` P`8P 4` (0@cT@PTP@DT8PK`(P,`,P5쀟0@8PK`4P8`,P`5q<@0^@  0OO$[P`% H FX%`ృ(`< @P0H 0 @P@04 00(KdiLiRj@Bʚ;PiXi$$ 00S0008RjRj 0-0@SL  0|21C 0`0Q U! 0 0@ RP0R 㗑@0 0R 0R000 $B0?0A`iLi0>>@-HpDP@0$ 5^0`@0 @0Sdiʚ;@-HpDP@0$ 5^0`@0 @0Sdi@B -LM @0,0 @ P`p0 c5F$0@X0 @  , R @0SW0@ di -L -L M  (Kox4 厐0 , 0POᓕ"4 P `pPU` V00pK@p0p , L 0pKpWp P$`(Ko URj Kdi 0-LP \ 0Q 0 P0@  0Rj -LMp,K,0K  P5 0`@0K@B -LMp,K,0K  P5 0`@0Kʚ; -LMp,K,0K  P5 0`@0K@B -LMp,K,0K  P5 0`@0Kʚ;0S P(0P 0Rɚ;-R \D0\\ ,00\00Q?BA   R 00R0A -L M4Kp 4PK`,0PU`0`S!X0  V 00(K X0࠳0X\P 0@P`U -L M0Kp `0K(0Q SJS T 0$KSP\ 0T0SP 0= @ p-PL`wP 0 `  0 0@= 0@  0f P Fp  0 lP X7p0S08/p 0= 0 @ 0@di -LM  0  RXP`P` (K 4KP`0`1P`PP`0P@`=9@P` =C0 RP`4pKU V  R U V ,0R  R 0@K,08 @K cPR@ < 8  ᏲD0@Q_/4KP`0@=9 =@ < 80 ?B -L$MP@U`K@pK 'P0 L 0080 , 0@0 <@ 4 0 U  P(K4K0,0S (@K0P% U T R 0@, 40 0@  ,  0P cR4 0 , 0@=9 =4 0 ,0 Q,  0R  di -L,M`PVpT@T PK O0PHW  ,K(p ,` {0P>T0; DKPPpK8 PP4V4_On8KrD @0 <0S ԱyD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0<N @ 0?Bdi -L MP&Z  4K& 00| `p04` 0p | P, #4K  OPX P (K4K OPXP400,0%"O04@`00@=)@ -40 0@ , 4n@B -LM@pTP $`K0P K eO0PU0 0P$@K N0P0 p-L M`U $@K /& =OPV   5OKpA -Lʚ; p-L M$`KP@ %P00=:#:S  = @ @xP  0R Kp<0<@0$0 @ Kz Q  NAʚ; -LMpQh+'$+'+'h,'x,'T-':#:S!= @ @DP  0S $K`3 `PU`\` l0P``0t \0P@`1ÌeȌ`6̌ 0P`\`j1Ì0PeȌ@`6̌``2 `PU`\`^ 0P`\`0P@`1ÌeȌ`6̌ 0P`\`.p!0P@`  `Lq4KV0,K 0 P0S, (0 : 4 K < 80 (0P<0K` 0S@40 0@ b`04K@ < 8 4 0 0P0ŌP@kɌ` ̌`0ŌP@kɌ` ̌`NR40K<0 8@ DYpɚ;6e4nʚ; p-L M$PK@` m$ P wMKp p- L M0@R`)Kp" $K0 R0$KT Q  R  Q h);P 80QU 0R  4n>/nD> p-L M00q`P%T ,K LP U  K LPT $08K#!B !,0K0 80 4@ PU  0KKp`A 0-L M@<P K0 PK kLP0Sk$0$ 00:   RTn4n00  p-4L׿,b\I  000cSoSb SA400!!Ń1у10000 0bSG SA400¤!դ!Ń1у100000cS- SA400h!h!Ń1у1000 0 bR RC400$!$!Ń1у100\phsRC80#< Ń1у100SA80!< ո Ń1у100SA80!< Ռ Ń1у100SA80!<` ` Ń1у1000 P000@>LtpiTnPn4n -0Lp@P `<0 00 $  $0@$@ p-`PL@T00 08@ T Q:phT  X8'( ph=4g& CRQe?'|>> p-LMP@߼ R00xhļR d '0 S ` s@0 l0S᫼( xh>> -Lp( `/PP @Pp ` @@∼ 0 @$0 <' -@Lh}<'|ii -LMx`hQ@pp'!$ $p p'!`0!!$ 0 $ !!DYp -LM 0P A0pK 0h , !$ $, !@0pK `P $(0   `P@10@C@ 0 X0h , !$ $, !T ( 'DYp>'00000C0 -@L00C0p@-`R@P 0 .! @.! `R p@p -LW{ -L@P @0D! 0 |0S0# Q!|D0S 000DYptmLXp p-0l @1P0Q0@L@00APl0 0CSl0 kl00CSl0 8tP@ph6p 0-@L @0P0$S$0#@011S1ԅ1ą0h4 -L MPrha0,K%,@K0T_ Q0X00S $ 0T cR, ( $ m0!,0K\0@! \l(QTI 0T30  D0 , ! @, !jV0)0 000T 00| KP0U $0S00Si0T0@ SS0%@k) ,, ( $ DYpɚ;6eXYp0oLXp 0-`0PLhQ 01 1) @|W000H0hz$DYp> 0-D0L hA1 P1) >000/0haDYp -d1d!`0VムT1L`L1@T: DYptmLXp0 0UnTn 000Tn 0S0i0 , !, , ! Q-L@0Q0P (0@ @-0@ , !, A,, !Q  0 @ -@LTP`p" p@T $0SV V$pW V V V $0S 0 @TUWp""T>0> p- 0L@P`~0S @p@p p-L@[PaT`p04L P PU ph0 U PV php 0-(@L0P00(0P(@000C0 RkTn -pL@`TU@ 0P$ RU00000  U@Un 0-$0LS@P  P 80@ P0  00h ""Un`>> -LM0bP,p0S 2 0S0C0L 0P 0S P bL00S0| x1 -h!0S@ @ @0S W0Q4 Q0(0BS0A0 R 000  0  01 Q0S  1S R D00000 R008b!Q  "Tnܭi> ATn>> p-d`@ L0P0 P $0SRP0 PpTn -LM0p@/P`a 7PP` 0 0( @0S* 000l! PJ$p @RTR 0pP> T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ! 8!4!0!(!$0T  !\>>d>$>>>>> -PQL 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SD A -0LS@`p50S&0S  0PS)0U 0S P  %Pp0S00S0| !0p? 0S X9 p0 4/  i' حi>>>$>> -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000,K4Kb Aحi@>T> -LMr@U0S 1 0S001X] 0 QP @V ` 0,0 Q0S00P t@@00 PXJ D Y   !0S  0S V 8CR0S00 S00 0S u,0 /p00CS0T PԵ(KP 8CR00GTnܭi>Tnx> Al> -@PL` pP  0hZV 0!i? -LM08`, J|pP4 ( 0 $ 08JE00C8S0P4K08Z,K耍A A p-`@L PP  0ph p>820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;@0$TP7p"p -LM80PSD`= tpX98Y (@Ġ 00 ,0 4o 00 ;@ 00<(K ymP020P`00 @$"X W Y 4POT 8SD4K80XW0  0 ,UnUnUnQ S 8Q20 R  \  \ | 0 00|  | 0!|  R  R | 00010|  0001| 0  0| 0< P0S 0 SPi -LP @0 R 0P 0P RUn -LMp/`P@TP (KP=; c0K   00B0 S=?( K Q02\0A0@T (0 0 S @ eP) @TX \ 00 =P0.Sa0I0Sa0B0SW0BXUn"@z>> -L MPp`( ((0"4#220 $04 D,KP 0 @(K, h1NPh ,0輢P 0t ` ,h1 H,堌0<  h1,9,呌 p>DYpedA >> p-LM(PK PKp(0[S  00C0 S00•0S@`Q @@Q NP10i 0-0L~M@Kx Kd0kPP0^K0 @@0@0  K0XS QD0 Q<0 Q400K0JHxj%dL0h>t/?L> -PQL`. 00S`S%p0@T@T 0S PP00SxP020$ 0440apCWPE@Tn -L@P T6P0@T @T 0S$(@T#>Tn>xD? -LMx`0  P@T $0s (0q @TU 8@K k\ P RR< ,?((00((0000QV ǟ0#4PP0 7@PK$88@#D0a'$B ,0KE@P VPPpT00S 0S V 0Sc 0SJ (K R 0S(0 @ &P0&0T0U0SxƟ0s0Sh @pPP000  " 40 $46 020$ 040 0 6 %ş00a5 0TW 0S" |$ %0#(("#4@!| ,40T,((0 "4#Q r  <0R05 p J5 "88 #$0a0""p 84 "88 #$0a0""UpKV 0Sx tp ܮ@?vP9v,4uP 0u03V0STU(0K@E0^*S@ ,K0 PP 0S$ 3\#   㤮@vvT=P X,0S] S7 ,0@"00䂟2TPPp,K 0NEPP McPaw 00K0P 0,S0 0\ ,@0 L_@T@T $0s (0O@TJDP , ((0"4#220 $ 04ă\0 l `@P 0dP@ P`  P pW (0 P @ P @VPP|,@ 0 \`@P 0P@ P`Un$UnUnjnxj>D>A>|jj4>d'>>xD?>> >E?>>z>@>>>>,>t>>>8㲾 0-P@LF,00S,0 0h+d -0LMp80 < 0,00Cs,0a 4K4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8ܯ *z(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` 8?B> -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0㘈  0㒈8ii -L~M@ 㣼(0 0 (0Kd0K$t KP(00 Ky(00(0 -,@L_ (00(0D> p-(0LP`F e 㨼PB X00  0@P 0 V P@$ ` P 020$ 044$0$0s  z@V\P ?P0D00S pUn,UnUns'o< UnL> -LMPD 8|8#@T"p 4 `0 ,  44"02,0 00(" $24  @0 a0, t8  R lV 0O  , t8 ?0 R0Q4O0@ @,|  RD VD0(2 0P`0p0 @8!@P0bh04KP  (`80d0hp,0P 0Hh 0h 0@l , (K80(S  ,04'?z>'>?>>>>>> -LM< 80@ S8 0 (0S- [[U) r 42R#<0SP<84 @ 40!+ )Y00p@` pP`W (KXYyᔐ`0@ Pp ` V, 4  4 0S0S004 R(pK0@'<0@` B!P <<H< <e/870 U|BzPUPU 0S @ P P e/WEVUnUn -LdM\@ <0 s  <( 4"4&, Pg< ,$ !$*,R^04!48#8S U20Y *00!8P#QF 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X " -0L@  0  00 R 0  0Xh 0 0S0 0  0 00h 0Un -L@P`ppP? DQ 10T' T\2 3:Q$ T \:T\ R000 W 0 00\*00X 0PSL@ 0R 00 p po<>> p-LS`P@/ 0 0S0 0Q  0S P0N0Q 00@@pP 0R 0000 6ph20Q  0S 0N0 00S00@@Ppph -L MAjl@ pP `@ Y4 @ Q  V0@<0 0S* RQ< 0S%0 0j 0 @ {:R  W3 #0 58 5, 50 %8 %, %*o0Sj < Ph>*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , >A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 d ]#> 0- LRP00 @M @T0@B0  00h߳ -LMAPU^, p`C ZQ  b ,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00   0Z0 0    ᲳP ,0@p @Z  b@Rj(>0Un0 -S0  R 0 Q R0S0 S0000 00Sa0 P00Vn@-@ 00bO 0$@P p-0L0M@`T9P 00 08 4   0K @0 ( < 0  , $` $ 0 @ KKL 0P0CS 0 Kp3Vn -L@L R 00CS 0 $0$ VnVnVn -@L 4 R00 0S00h6Vn -1Ls@ 000 <00 @0ʢ 00@ i VnVn p-1LMQPL t1Q! l1Q d1Q` `x 1Q+ @1Q81`  x0`00400  xj`P KQ`P@ R 00CS 0 00` x0 @aΡT0` @@xPL H 00``0000x偖}flvt~fwt@VnVn Vn -l0L RX@0 D 800000 0VnVn Vn p- L@`(A@P <0 S ypr@p VnVn -1L @P `p\ 0+O`P QM 000^  S 0El@Q@1@!T `P0Q 0Q`+#` VnVn4> - L P 00  0 0Vna0? Qp-L@`0 PAR  "x0 0 PR0 R H0 p 0S0SU RU Vna0Vn0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P((0S005:SPP( (0Q 0#03SP P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S00  -(0@S0(0 L 0x R (p

-L M 0 R,0 Pp  K,0K(0 0Q0 ( R0000 0  Q( ,0S: ႞ᓞ,@T L0P S$ $`K2 :@T LP 0Q$0 * >Pc, RQ000(0 0 , R 0S]00CS0,Q R000 00 ,Q 0-L8MP@=xP\00P 000$0  R00# 00$0$@ QA$M Q# L0 80C PL0 @T p1p!0h!040aSE@>K00001Q 004 0$00  0*lLK$@ P# (0X 0T:d Q00000$00$ $$᭝ d tiAPn>p<> 0-L M 0@02P 00#^ 0#^002(7x0S K0,K0hGd (0P8Vn>p< p-LWۚ0`@T! @T 40R_P 40R PU |0| t0 40 c R B @T 0=<ph3iixiAPnHi p-LMP0 K 0  2@T < 40`Rs00 V @@ @ <04 S`H0@ 00bS* P R0000  0 M PKp -4LЫ,0@T  @Thثii p-`PL@ߜ00  0@@ph远 0-PL囫 00CQ0! QU  0Sp埫@T ᴜ᜜@T0 0S 0 00 0S0i0Vni 0-@hLP|0hx -L MR0  04 0  80 0 00BQ0U800S@ 8 0Sʠ0l,0 < U< 0f8S8pLpZpj < 80< 0 0 $80,, @\ 40@d08 0` 000 P00WX 0@@ @(@<@0@4@xpH@L@|@@@l@ 00fp0T th @@@@@@@\Q,0^@0# 4140ڪ,000T0 R> !0S 0 00000(Koڪ8pL < T< 80R D Zʠ Z \l 0l8 ,0 d\ \0 8 l, \8 :Cʠ8 ,0 V,,8VnP<i4Vni0Vn>$i0i4p<- \ 0Q|  @ 0ZWn -L MtptP`@F ` 0 04`V pPKRjWn<>< 0P \|  @ 0+Wn -1pPP0 ` U00SL@ 00S@P`0U00PWP$A WW V 0 RU h0\0 R P0!PV  0U00anDiiVn Vn -RL\M !|  x pL L p h PP p%PP00mPu `0  @p d0 \ X0 l pp l 0AZS_,'''P'''''''h''''''T'l'l'l'l'l'l'l'l'l'''''''''''\''''''''''',''''''H'''''''''''''''h'''''h'''''D'8''P''h'\'T''''''p0Z0p0  L@W00 S} | z(K>| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x pM\`Ph@ X0U  ST  T d@TT dt `T @bTZ L W00 S 00 |  @DTXQ Z  L W00 SX@@ |0  tP @eTZ LW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh TP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) P `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ zP h \0PbU\PT T őd0 m H D  `  0S S S`D@H0?K0(@+@?D Ru Zg L W00 S  | i @0P? K@h TP ?0K\pd @ d 0d ǟ@xX P` P d @l ]d\ǟ P bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAL@W00 S |  hh PU):h0Z| `T @bT:Z L W00 S000 |  @D0| @D%0| @Dd ` T0@cTZ L W00 S 00 |  @DTP | @Dd Z[ LW00 SF |  X| V U) Kh %(0Kh0 P  %2h >&BbP`h (0Kb1(@K 0XT0 0dITQP` @Dh@ h (K00b0 P0@P`@]000L0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@H0 D@ 0 H D }|  @xQ pH0D@0w `Pj  P@ l@2A \@QHK<@00` !0@0^S!0@0^S^<,Z9 LW00 S |   !0@0^SL@W00 S |  !0@0^SZ| h~PT \P?T0 D@H0?K @I| DH0?K =^ Z LW00 S>00 | {p 0?@\0 p >D>h>`>p>X>> -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TPᣖ 0P40@ R 僖8~8|ian --LMP冖 0 e,0@ R dK|ian -@L褬> -L? --LM 0 7 K --\0LMh!D0 ,1 Q @@ ,1  0@KDYp 0-LM@< +PK0@ U+[P @ P> K0E? -p-LM `j 0@PP PẒ00 R0PP KpVn -p-LM@ `GP 0@@ @ᕒ,0 R0@@ KpVn > --xpLM0PSd0 P `AO L&P 8 ,@ 0@Lani>xD?bSj -@0 L( 00CS >i> -LM  0>@-0R0S  c1 #880S$H*H!D H!0  !$ $ !0tm -LMP`RD0#40#00S P!RT b1L!#88P$H*H1pK@ !P1[0 1K"P  p- @LTP`Tp v @P! 0T1 H!0L1܅đppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0 AiiAi, ,0,0Q0 ÷ ᰮiiian-000 \ 0   䰮iianip@-`-\PP0\ @3 0L0 \S5\3  T! 0L0 \S\ 00La L ^ W0LRA0L0S7 LTp/0 S a ppX\x\@@0 @-paLQP`ࠁ@@@a0L0S*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`0S'''''4h,h$h}hy A?4>88?,>E?0S400S S gd aꐮiD>E?@> -1@XUL aU_!00UCUڨhFaUʐ!2p<x8@0sJ `10|8s0Sd'd'd'0'0'0!0 Pq0 `@Aqh`@@! 0S0c!00c10 Rڄh|hph0s LꔮiiA> A>>>>AȀA>>AAh>>L>x>> 0-LMP@tMhd(X0 S S SS8KP008>>en> 0-L0SE Pz P@@ T 0L0C*S* 'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x',''''''x''x'x'x''x'x'x'x''x'''x''XV0S0OLIFC@|=t:l7d4\1T.L+>i?XF?D>xD?>>>>d>@>>>>>>0>`> -LM0 S S, C SA S?  R R  08 R R#Ā0S*8@㰐pChP08#X(0BHTPp0  78P#08#X(0BHT 8C8s , 0ꜮiȀA 0-xPLq h0 Q 0000DV0@40@0QTqT000蠮iid>t> p-XP 0P`SL @800@SP 00p蜮iiȀA? -d`dP 0\pr0L0 J@0 0S8P@C 00蠍Aii 0-0d L(\T=PPP0@ P *044 ^-00>aniian 0-t1L @R ` 0S3'''0'@'4QT(1 T0`!10 0 0c0C1 0S* 0h 0h0h@c@Xe0 0 0c0e}ꔮi AiAA>A>>>>>> 0-t1L @R ` 0S>'''''4QT"(1 T0`!10 0 0c0C1 0S/0cd0Z:h0h0h0h0 @dB"Pp0 Lw@@r8oꔮi AiAA>A>>>>>>> -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,*Y h00T 0 SW@@Aꔮii AA> p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S x(>> -LM R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`0 08#h(0BHTxP0  8P#800 08#h(0BHT0 8CHt Qs (K,`KNPs daꜮiȀA>H> -43LM `R#SP3 P8CxnTNT ?mT@;yTYTYTyTw (K(Ko.8C nTNT t$RT@h yTYTYTyTc@"2Q @P' Q 0S$ PZ` P0 s 08s 0pႝP] q@,p  0@ |!0 8s hqPC v08s@mZ0$ - (Koc(KocxX@aA00c10J0 0c10 B(KokP 0, P00 00, bL(KoꔮiiA\>xD?> AAȀA|>>>>A>A>l> -L8cY(Cx02B  $"0`S/ @P 0PS( 0CP0  PW WV W0S (B(00R0S {Pc0ISFL'@'4'$'PQ0SD@0@S PWc0IS''''cY0   0@00/|00SS P@~꠮i AAA>i> -LM`p(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 P,00aZ<f 0>eni>> A> -L0MȠLK8 LȠ`CxT #3 Q W ß0SأP @$0 @S EP0  $0PPS @U ,PKpa 0Pl,@t H# T0(i PKtKX,0sq aT,",p RP 2"PP@ PE 1U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0P0  %P0S S0WpT(KH@,@U0S @P 0S 0P0  P0S S0UP p0@S 0S 0mP0  P0S S1pTAꔮii Ap>>AAAAP>>$> -LM0 S SPpp0 S S P S S S S  ` S S `0 S SP`0S @@0S P P@0S@ T T`` TPz1 0 L B*R񟗾`'((((((((((((((((((((''(L((((((((((((((((0((X(0 S0` 0$KT ,KP, 40 T ,K& K(0K@P,"[2[A0@ T ,KPr,  RR@@ Ry840 Ti ,`K@P,K0@ Ta ,`K@P,d 0@ TS ,`Ky@P,e 0@ TA ,`Kd@P,@0@ 000 T*0@ q-=000 T?C e000 ~Ÿ"00s03S0W000 pR000 kT0@ fH000 aC0@ ]?0@ Y`|90@ Sp50@ Od10@ KZ000 F,`KP0S ,0A0 0B0 RS 0B0 RS Rt R R R P,00& K(0K@Pf"[2[,s0@ @P,0@ @P#, 0@ & K(0K@Pc"[2[,Q0@ & K(0K@Pve"[2[,A0@ & K(0K@Pfd"[2[,10@ 괮i>iiAL>حih>@l>>>>,>>>> -LHO<(4P(P Oh>>an>N- 21Ci 32Cid0 $\H0 \<0 | (0("404 fnQʚ; -LM0@S`p 0PK P KP P $PK P0p -LMpw0 WX0_BSeo1ǏF$8pW4P 0` 40K, P(KMb@B 0-,PLP@ PP0蠘P H 0R0000fn 0-@LP2 08#Ƞ0PP0( H 0@R" $0@ 0  !$ @$ !0hS`` 0 00D 7\0PP00)0S ᡼fnfn -L M< @ D H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!~yPP . 0,0  0 P  <040 !<0 0! ! 00CS 0y Z,0  ^, 0 <0 (K@p< -QL`MPt x |0 @c0t P0BZt [X@K L0KHKDK@ T`KPpK`0 d h x R   b@P|0SU  Y@PO 0  !$ @$ !t@ #T Tx0S ` P@ |\ d  P@P h P@ Y ! B (K  0㩕 0 0h X K ` p`0 d \  @PP\ `p 4K40K , `"pQ\ 13e8\0 \0@`6̌p\ P 㑩 l (20p0 0  !$ @$ ! ` t0@Pd0S` R% 4Ky4KVI W0B 00SO,0\ Vc\@ < 8 F<0S:8!43C" cbl z$0@ p 0S ˃@F0  !$ @$ !F l0尼@᳃T V0W,0\\00ӳ@ P0R@Kul 04 @ @ < 8 ɚ;fnA0>fnQʚ; -L M0@S`p 0PK 3P KPP $PK "PA p -L(M0@S`p 4PK P KoP,04K#!B ( $ ! (K p^ -LlM@Qp1 0 P  T  Tf 00CS 0 w (KT 0PK0  P< 0TpHP D@ 0 4 ,0 8 p8p 0S4W10p8p 0S+W) RP0  H KP80c,P`pǏP D0`0@,P0`D0H@00S  N80W pP }P #P -LM`@Pp "wP  0 0 0P p_K -LMpP` w@P  $0 ( 0 0 0@(0KP@ = K -LM@` vP PU @: f fnL < L0 0-PLP 8@ ^4 0 n0C00 }/000dUjfn<,< -Ll $:0 `T @?PD@HP@Pp<LP 0( 0$@( ,04 ,00@4 80@ 80<@@ 0  0  -$@`AL0LHPp  0SL0 p0u03R0SL0 pWQL0@0L0L0 p p 0 0b Sp!L0@0L0 -L0L@@  r}L0 D,0P h@0L0L0 0-@PL% L0P 0RL0 L0 0L00X P0SHPU L00L00H0'0h0H> fn -$0@$@@L -$@L`P?P0P0P0p\" Q6  0 0`SP1P! U P! ᬮ`Pe0 0S00`%0eSp0``P\U`A P00CSP0, 41RL0= 00b S-*L0W004L  L  儷`P`PP0L0kL0  00L0c 00b S:0 ⪸P00CSP00L0N k#`TP> p-PL@TP P0)`P v08`0 P00  p p,<<fn p-@PL@ ^P@L@H@`P 8@p, 00D0p -LMP@ p'`@P@P (K, < ,K8 Kx@PO0 , S,0 ,0\!$`,0 0K4 Kx@P400㸐0 0000$0 10 8 0004 000HH`, (00(0, 00CS 0' 0 (00(00 00CS 0 8K@ @P <8>q,q`<׎8x4x0nq,jq fnTi 80S j g -@$LPB%0$0 -LM$`Ppl 90  P0S T00 0@0000   0K$ -L$@P|A`p L0SI 0SF ` `  H0S& `V$3|000)| 0 `0aR R3S `@`xu000  0 `P h0R ! *  3S3S`  0-LM\@P$L 1\, 1\ 1\0 ,40iSR rSJ   0" K0<1\* 41\0#300 < 41 @ 41 D P00<<00P 0,< ,0T00<000,< ,0  K0h  0K0hz s@~fs}ff@s@ -LM$  0C% K -L M$  0 K -0LS0s0s S-p0`0B!`R?R? 8#L0 0CRdR0d08#8>gfff-\  )0h SS\0  gnfnR  Rx0x0'' Q Qx0x088 RA⮸ -0@(L 0 20Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qfngn p-QLM@`@00CSH9(9(9(9(9(000 Pޫ@Kp-@l0d0\0KL0 20{ @  gnfnfngnfn 0->L@ @0PT;:h0h0h ^(h ZHh VD00 8 P0$0 0P帽0gnfn;( 0-LP 0N@P.8CR0 -@L`^zVpH h10RUV hp t0`0t00H0U h10 XH z zDYpA`> 0-@Lzt0P0t00hy p-LM@zP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP yxi p-`@Lp 40l#"B PPzH L00bO 0$@H >RPPӟyp1P91pi 0-@@Lp 40#T"B P)z R00 0S000hvy0i 0-@@Lp 40#T"B Pz R00 0S000hTy0i 4 0p-#Lp"B @`!r r p<0P<0@`y00@4yp0P<0iدiȯi -LDMP(K|3 "  1ˌ\3ŠT"10A0 0c0S |P @T ,K`P@T 0KU P 0 ,0R:, `@PTD0l<0<K 0H K,PS4x2x0S40 <0K 0@P<0 8@ 4 @020S@0 mQv )0h SSp, Q )0h SS\0 L P ,0R:h0p,0 Q)0S㔡 S㌡ d1Z31C0!02d4@8!;5@><Ϡ.,0@lEnb <@K00H@K0 @P` VJP0 z0 ,0Rvg:D0dqP,0R:$0 hH0K 0@H0 D@ @ P.D*8&6pQl>@KLɚ;@>>>k_k>>|>> -@Lt0 | أh -.H0LS@ t0h0t0H -t0L@@ 0  P HWPt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HPT#0?0S 0G(\E(XG(PE(@G(\E((G(0r8#(.a0HS H0 `0HSsG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(pG(G(G(G(G( 0 .0Pc0>xpH w P``0O0@d  d Yw>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Ho Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHM PH>SB >fnLp0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CRvt0 :t0>%`(pKⰎ >{ PP ( K PP0t 5*0t u.8C8Ac Q.PPQJPUZLp<(> -LM0pP,2 8" `4r 0r Kvt @0  82$4C0 u02S  u#0h, R  VR 0H0S8V` V(ڠt#?0@ L@V; 0>H r .` 8. 0O0@d P d `l pʨ0H0X VRӈ 0zH0XuH0@X82~t0"0t02HNAP0`FpH0XuH0@Xuk R`1l#K P0 Q42葟S042 0S 10S  p0R>SV0B@Q Q QVtD c |0P` 0] @[00!W 1FT0S:  ㄠ  1@yP0  7  42S K 0(K   t 42 S ,2R#  0" t002 t #002 4K  002 iDYpLp;.t0._7phdtp0t#40#"Bp0t HQHP =2 (/ Q HP( i Q-L@ t00t0t0 0t0 0) P P A -Lt@  0R'0 t0! 0)P P xQ  p0̌#40#"BH0t 0t0 hfngn -| @0S00L>0 Q>|  00CS0 tXtDit(n -`pLpCA0 㨀s@=s  0@D  D 9@P ✠% !,t 00S t PWP|@$ k 20P=d t {RyW  b @h0(PTh ?R](0Sڜ0  P HD Pt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X*| [t p 0@$  $ h0 t@0  th0@t t    0R40,50t o pG0 $Y"   A0GS p0S P 0S 0SM 0S W   tp(0 h0S&  .H0SRtp  0S 0SWt W W@ p p(0 S|P@rPY W 0S 0S 0S >08#8S>>>t  N80SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi &W X?0|S W 050;,(0 0S050,| TtWtW   ^tɌt z Wx 0>(HxW 0S &.tWW9 tl 0W.tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S mtt/$ W   vt}\Wˌtx9op0̌#40#"B0t )W}p ^W~p  R @0SB&| zgn gnfnLp0S8\, X 8 8280S, ~8)0p{o#ppuopDYpAgfffiiTniC( -0L@  (0 P0S0 p-P@Lp# 40#"B `o@ $:o0 t0191p$0Sp191p 0Si 40 -LàLP@oAp&0`  VW nt0`.H0S` Tn M wPʤ0  `t0`i -LTMP x0 U`' J:U# :U J0U :Un F:U s:U :U 0Uu :U. p(Kx:0S, 0 S D |0^ @00 1F0S 9 )9@.pP 9U'0CU*0CU9U[ I0CU 9U_ 0Uot @  5,0t SnpH9U 9UnA? Cnp 9Ur 8U :80Sn8t 0S$0St&np|8UG n8U 8U 8UnH0p0knt @p0,#40àL<8t  P} X0S Z t0(0(SpJ  @0h 'D0 @0CpKl0 p H@ @ )ApP; \0b04!\_p \_a\KW(l7Up 87U!41 R x0A ,1 RuD0r l0'20 p 6U 6Ul0p0Q0CUU 0UDnt0p;t0m6U? 0UԀ,1 Q-D0* Pp 0Qp| p &0Zp pp  Ap,1 RV P|pPp , (p (p Wpmt0p;t0Gm@  P   | p5@ p`Tp#*l0S ml0T20x   pP   l0 mgpP _,1 @T0S Rz\ 00CS0 ,! 000,! 00,!| ,1 0 !D 0 D  !p1,1 QuD0r 0p ,#nmx08x0 @8x0  x07x00@x08x00 x07x0]Um0St0t000t0t0RJm@ 7lp(0Sq0S  pPyt  0    0t,@if@t@et(it,t(n p-@LPlt0p@ @` 0t0 t0N<t0kpR0@-P-  ^ϠR0Π0A 0 0 Ql` 0< 0C T   0T00>0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0hUj-H0P R 00c!0R#<0hUj p-@Lk`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@kp 0-@LPk0S US 0S\ a aR QPb0bU00S0 00hj000 0 -@L`kp^P V  0 PbU0Pbj 0 b PP 0eS0 1S00PS0eS0 0PSj p-@LDk0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0vjp -PL`kV@.Q@*pQ% 0S a0 aR@@ # q P 0ax0 0S00`dd0Vp@hQ  3j -@LP u> zP 0SBh0 S B! >z000 p-@`LP >zV`0 0 0P  pUB> z -pQLP@p1j Q( Q* `0Q! 0P ` `0RPP `P  0a 0 0S 00pe 0Wi R 0   p-LP@Bj `R4 R0S) 0 0 0P \  a 0 10 0 P000  0vip0 #0 00  V0cip -LMpi0S" 0S 0R Lip$K@@KP@K $Km/i00h! D0 ,1 P [DYp@-D0@ ,1 0S  0@[@ p-LM`PD , @T Q Q0 S 0  !D D !Kp`I[at -Pp LD0` ,1 @T  ] 0[ `F\` -Pp LD0` ,1 @T  \ 0Z `$\` p- PD0L` ,1 @T  \0 uZ `\p`p80 P0S0SPgn -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUgn p-`0LP`U @ T*$04@S  RPUphgn p-`0LP`U @ T*(04@S  RPU}phȬgn -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Km] 0-0 L 0P0S@ T* 04@S  RPUt t0pS00d0 \0 ªLL ᾪ(00hgn|iܼii4ionUj( gnjnlUjp(( ,0 S!0Rjnon@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  T0S   D00ccD 0b1  T0S  0  b D P0 0c00000 S 000-^\ 000 00 Q 0 S00 00C0 -L@ -L M@04KT` pU@ P P@p P U@0S 0, 40b0(K00Lq< p-L`@Pri @Xip 0-LPdi @Li0 0-PL@Wi 0n0h>h>P> 0-@PLP yh100! B!]h1P T 0U1:11 H1 ,i$gn@in 0-L@P@0SU 0  00 0PP 1  T0S. 0S P00 P-L P p-@LPh 0R* ;g`p`000gVp<Pp 0-@LPg 0R* g0000g0P 0-LPD@P 8g4 1 01gQ0h0@in,i$gn -@LP(T`p UtPP 1P 01DP,0P P0H L`X@T@W@ s@pP @ꠑ( p-@LP`. PP<  R'000 0P1  (1 D D1! 0D !X@T@1 0 1 p17pD 7p P 0-LP\ P@ L@0gD 1001g0 Q 1000@in,i$gn -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - DD0  0 P0 pP  P'00h00,0 Z  0j0   G0   P@+,0p0p -LϠMϜp0 zQ10 K0 a`Po W0,0 ,@K`DD0@000\|00W  pl 000 S0`00 WDV@ @(PP= Z% 00 0bW1! % 0S + QW1! 0  00b\! 0   BPd0Wp00 W,(K,ZX Vʚ;>>> -LMl -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0PP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8W 0 0g 0 1000HP% 1 Q PQA @@AQPQ100D00 0g0 `` p:`> -L@P  0 -L@LPLpL[n <0@T0hjn(A`i@in -@ ML 0@0< 0@x`夠p夀P0@ @#5 9 0n`0PU`$Km0>@in<,A8>onjnUj8i0A@> -PLMp, Z ,  0Q`%,` PU0 Rpc`P@P U U1Q   P@` PU0X#@gT@!  .0X P X`p0S P P0gX@cTPP P, 1 0Y9PP XP  1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $h fb _p>>\>H> -RLMp`0,0 6PP V`:,K⼠,0S PP2 젠 jR",0S W gpZ @1@! @`d zVPt0Z0 c+1,, 1:1,on -1L`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4x`X  `V00S 0 X@1@!  d 00dS 0000 X  V00SR`` &pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc` x100 2022RP0S0SP00 -LQ@ 00Q02on - LR0@0 0S008 R0 0 R8#82on 0-@QLP 4T R(P P@00on> 0-@ LPP A0 -@Lp`@T PU00002 P02@T P7 -LMP, 00 , KP@P P P T0PTP0 ,pRW \ 0`g 0%`gX00S Z,00 0(KX#VfWf0PUSUX  0 `Q ,0 0P@, R  0 R0X7\pfDX2PP00X00SU% `0,  0 0f 0 00 P 00 000P0@,0  81o @PP  P0 WU' ,0S 00S VU 0S:0f 00, M 00f 0@,P W 1g 00 00 0&A ~B> -40MLh @   0KDYp0S R$  0S$ 0-80$P @P @$P0  191# 0#R 00 40Q h0 ?SRP@-8 $3O 0$@P 0-80@L$P^ R00 0S000S<0<0h] 0-80@L$P^| R0|0 0S00|0S8080h] 0-!80r@L$ r 0P0P<0^^,  3,@03]00PP00<0<0ꈲihixi 0-LM@C^0P9@ %@ 80 h 0@]K0DYp p-LMP@"^@0`h 0 @n]KpDYp -LM0@P`-@ K^0p 0  8@P]P,0Ph!  0@DYp -LM0@P`-P K]0 hP0p PP 0S000VH 0V`< 0V003 ] ] `DYpii -LM`P@] p0 @\K -@L<@ D0xh\ -,LM^P` 0S \  0 (K*0 V 0f Vc ?V` V] q*x2V"0CVA `4pK⶜ `@2 P0O 40 0@ r2 ,0 Z1V\ U0V= 0V 0 R] :- V @V V 0 0000CV 0V 0Vh 0  V  V0 00 0 0 X 0  0Sy  Rv  Rs \p 0 f3 003 0 V Vm 00 09M $AA -LMXp`40 P" 0S \ 40K0 0 @$Kd3RO R} R  R  R *@U  R8  R R_ U@R R RUT 0S%0 R00 0000 0S \ 40K0 0 @S5 0S00S S0@82hq@P Rk2R 0S  R  R \ 40K 00 @R R R@S 0S0 R-@U 0S0*B BQ@@R񟗛(ܶ(ȶ((X0Th@h00T@00 \LP 7@c0BPP@u 7@SPP\@m 7@KU 0 S0@K MP!@<00V X VU@1DYp!h -P@Lb 0S   -L -LQ@ 0 0S P 'OhEpn p-LMPW0`BP- 0K @S 0 0("8B?BS 0( ,1 6F!@P 0S 1h  0T@0,00VKp@T @T  @TH0 h 05@P SA@>DYpH> -LMSX1hq0 @ y`VK 0SH 8CT)@ (KR`WW , 幹P0 0$ 尀 "l P0041   4 0 44,@p@ `@P 000,}V,zV00P+@DYppn -@ ML  0@K\>pn@-80$ 0 `0aR  $  1@91# 3S@ 0 00  40@ ?S @0@ ?SR -L$M ,0 SR0 D @ 00`p`W0S   ,P% R! (KD0S  R000 R 0 0 R XQ6<0< 0#ZP0:0zV4  A3S: 0   00X0 U9<8 #8*  0< ᝍ@0S 0Pb0c UP00 [S<  W0@4U( 0 Q P:0O0@/Tʢ 4UhD R, K8  ,@T y젠PW0Y0 X00S[ +1T 00S ,0S  V@KdD ;D0P @8 P, 000`pVM0U0@:02 h<0 S@0  ,  +U0Z,0  00 X00SR B00WjV X00S0 X@@ T @Rd ,0 s 3Z R 0d000X00S ,@8P TuT뼠P,@@rU@SZ0 R U00R0SO  J0G<$!8#8 ,:_0:40TZ 0`pr , `1p01k 0 R 0H0 , 101^0+aR@@>VT'#TT 0<u4T#DYpjn0 000R33    00330(0 (, 0 Q 0\  0\30C3(Q,0,0,00(, 000 30C3Q P0 \540 R 0 Q000ᠲi0@-0PPL@ 1NT: PL31CPhP%: 2T0TD P0L20P000P00jnQ@inUj P-LP 7 -LQ@ 00 0  c 1SS 00b00,C 1P00c0P0S 0$0 0 -L P U`xkppP U+.1@ @  p 0 P[pd> p-@LP`P`UP? QA0Pa0a0!RR 00b00,C 1P00c04UP` R$ p1SS 00b00,C 1P00c0P 0S ` R 0S$ pV ` 0e  000e0!RR00e0> -0LS@ 0S -L@000 -PL@`pP 7PP 7h0 S0h00pS;0S\` p-`RL@PR 0RU  0 R 0 `0aR R4P0S2  0 1SS 0001P00S 0 00!RR 0001P000$0S`` $`pp> -@QLPpc 1 `0VXR 0SZ !1RK WR 1 V&@ @ 0p00!RR 0000!P000!0 !@TX+ W0 101V!1R0  00 0 0  1SS0 00$0S0$0@@W 0i׾>Q-Q  1S. S' 000!RR 0000, 1P00000 0R$0Q ! !101 TQ RQ 000!RR 0000, 1P000$0S$0Q0 ! !101 # -L @0$0Q$ R 10S $ p-LP@>R`(4 040 Q0 p< ph} 040o -L@8! Ƞ8 0,Ƞ @FgP 03>400@40 3FU>0 00L000F -0@0>L065:h9 -0@080L06&+h* -L MP L32C0bC^ (K#0 0Rx  P 0@0 @10 -LM @S 1 !@ IPK C 0-0@@1LSP S TrP 0@A000qeP -L@ZDP  0S 0& 0  0S -`;0SpLPp3*U@ +I17p P npPV@0Pn -LM`$ Kp@P $ $P0  00CS 0$_D9@ K(K C@P $  00CS 0 c  @p0@P(0I@$1D -LM`$ KplPP  K(K PP $  00CS 0 X d$0$@&  Pp0PP(0 P$C p-L M0@ K` 0 -PP* 0S* $K PP0$ 0K,PP Q $ R 0S R $ 0PP   00CS 0 PKp$P C$K P -LM@ `lP  CnP KPP0 SP 0Sp 0pS W  kPP   00CS 0 rC0 0 0 $0P7P+1W 7P p-LM@ K`PP x0$ P 00CS 0?Cx -L@M`, K P0 4 \ uPp 0@ P0 L@ \0\X T DP @P <0 HP  0SH0 PH00SH0 \  ,0R@$ @4K00KX KHPP@pPH0| 0c0Qp 0Pp8  08 R !OpPT80X0 8K EpPJQ0 X + 4@TP$ 4P 0X05 0305\!mP P  +"@0TPX00P0Sp T0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0P4P(K\,|BH0S wW| #Wy -L(M`p>kP0S @K LP02(K `D < D K8 (@ $P 4 ,`  K@0 ,l -L`MDpKP` #@P (KDkP28 P(@P㄀K"0P,0 !< @P Y 8 !] 0<`< @P <` n@ 0|^8儐K,l@ -L4MP$ K( p.P`8  0@\4 D0 @@ L H 8 0p <  0S<0  R<00S<0 \Q (K 0`PQ<  R`$  00CS 0 (P K$A,K0`P ,llP7$0,$L K(0 -RL MD p@ 0K PP, KPP (K,K,0< $@ 1  : 3S PY  00G ,`80 \,K4 KFPPU0 >\@ 3SO\4>?,?\0P<J 00CS 0 l?3SP0 0F6!勃PP <J 00CS 0 904 0005 5#03P<uJ 00CS 0\6( PPN |H, 0080, 00,0! ,0@$PD PP00R00S(U W\4>,w?f\@Y #P5P,08 K0, (00(0, 00CS 0 40 000@P,> 号>pi~f> -LM 9@0 @K -LMP0  ʠ K p-LM@ K`PP x0$ P 00CS 0>x p-LM@`gP ,5iPKp KPP K0PP   00CS 0u>0 $ P  -LM0@00 `pXgP ,hP$K,[,K4 Ko[0, >,00 K0pi~f 0-@PLP Q 1S 0 SD0 R0S0 0C#1S@T0P\)@-@Q R (  0S0 (000(00(0^xqn -pQL`P@0\PD 0 0 0 B 0 00C0 >U@tqn -L Rh r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( J @T@T1& 0Y `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P r@TZ@WP=@TPZ& X00$Q `0 R0 lD@ Q 0Q@hqnnxqnn4i(P 0S  0 ꤲi -L M`4 0PS x2R P(K Q 00\@2@ <2 A0!/@!b0SP0p1k X @í+u1_ ` ᷭ lX  @l&@T 0X0 Q 0 0@Cp0PK 0sE 0sB 0SSC , p 0X0 0,@D000  1  ိ04<\,K , ` PW,pK‡@ l, `F 0V0C 0,00C0  B sPq X7Pk` PPf`P$Atqngfff -LM8 040 2 P Ah 0@!q#W< _ 0X400  0,0 0S Wi4@PW P0@S$0Sw S  ;Po W ,NYWN40@P`0 <0 `P!  000W@B M?P @VJ0 1P5;@TZY(@@ ,5Y,YT 40 0,0 000 (@,Y, , Y0 R  xW(K,XA ,0嵬4  @@80 @@P 0 W B A @ M=@DYptqn00S SPP_ 0-PLU 000S S S 0@@0@P @@0@0hH R00 0S000000 0-@LP0S 00D 0hV0 -@ 0LR )  0S S S4ܳ00> -LLMp0PS/@ (K iQ0@0̗jQ@h ׫P 0D H0 D 0 BpKp@ h0 l @P l@P\`0S&@ "@4!008@PTX 0R)@ 0 / 0=@P  t P  041  $ 41 ( 0 ,  0, t $0$ t0 `@ʚ; 0- LR@ 0T00#0S 63Pg0PP80 R  4V0h0h.Vtqn -LM0S@80C hR3PU/P,`hP`* pj0p 0 R 0 lK00@0 l0CdP DP h0 l < PPX@T TDK8TP !@#0P$KP|3#@K? 00 0 ˠˠTXKD K 7PPX0pT041  $ 41 (0,@ ,@8 -0LS@ X0S0S S Slh0h P D UP @8M$0$ 7>iiii - QLPp`5 @W@ Q00S0v03Q0SQ<))))p))X)@))l)X)h)) )),)))h)$) 0S -W Z  - 0Sm yY # P V8_0 T0  02@P  80@ 0$@80<@,00@( @ 4 00 @5T'0(B8SH S& S$ ֱ0S S S ͱ}{P P0` 0 4p幱Pk0 0P< T@<RA Pt`0P 0 @W@0Y0K  HX 0S80 P@QP 0hP7X>@W@0Y0P90 PPp P p(>lqn >>>i0030000#00( 4000 %0 00300p@-X0X (@HPP`X \ $,@LPT` (HPXpsn|qn0|qnA-400 C6pǏ(#"B00 P' 0Q 0S@0@ R$0$0$00 $0 P`PU``0 0P`XP@`0d@00 0(P0S@0 @P0S@snqn|qn -`VpL& 0V\% 40 C6OPU`` R$0$0$00 $0 0 0$ 00 $0$0$ $ `UU困4> -400 C6Lpȟ(-00#0"B005000 $0 (0 @0P`P `0 @ P` 0@0 0 $ 0p@@`0 0@`0d@snqn|qn -38!2CL0M,0 X@ P A0s!rGp(0P` P ` 0 @ P`R0 0 $ 0,0 X 00 Q, $0$0$0$0 $ 00(5000 40$C6Q0 ɯ(, (Xsn 0-LP@P@DTPU0 -pl`L@jP(  P@ (PpWsn 0-@LB00P 0P 5{00  6B00  00<00000  @P0P> -LM`@PBKp<H@ DP s@P 00 @BK0000000 -00L@ 00000%h000006 -L M!0 C6B6cO`p`VpࠁQ 000S @d _,00AS00L1P&O0d P~(qP03! 00a&0S0@00R 5 .0@TF R00C10/0 @L Kd 00?2c, dS0d00i0oxi4A8A`sn$rnrnqnX>333,rnqnrnqnQ 0-LQ0D0 P 0@OP 0 0hPqn,rn p-@LA00` 00;0000 A 0S `10S0000000P < 00   0S10S 0 @_Q t0S'0 0xph A0S*00800x00:000U00 00800x00xp0Srn rnhsnqnqn 0-00L PL00\<P0010S 10S00 *   00  00  00 # 0 0@ 0$@00@ 00 0hV008000hx00@000|000800(0 0@(0,@rnqn`> -P2Lh!H2 !Ap8WD Y 2 0PoPVif pP2 1 0PoPV30 fQ@00 :0S 00 x!0S  P2D4!0*@pP !0S: !0"yUt0SY00S0p R@ꕈ00700@`Ut0Sʒ40p R4 0S 00wDYp(rnqnqnrnrnhsndsn0> 0-00LP D0#4 R21C 0Q 0  0 00<000hv00000f@@Q?$ h0000h8iiDYp - LRpf 0ST0(0 P00S $0@QQ XD x0 0@x0|@0P `00 0@004@ $ 0@00<000@P 0h  0H  H g?008003\P0X@  @h0 0@h0l@^@00qnDYp -LpL0PS` 4@8@ R @00 00;00D` R O00 h00800hv -1L P@@?0@ Dp@ `P 0 @_R 0 P0OT v m>p0 R40S< tgSt0S0p R$rnqn8Aqnqndsn -SL M40 0 @Y? , 廡`P CP0D0 @P40p800P  wPtxlp00 <Ph@ PR00 L3`4 P00,400x>(K?3 , Po0PVFt0S22 RF4r>0#6Po ?QP@P8 P <0OQ t0Sf!0 ?Q?A!0w, >pL v11 RP@P0 ?Q0d1d!h0\ T1 \ 8u@A@!000@;00000Z 4t00300n]ע,=p[PUhP P0p R80p R[,=p@0 @2,rn!CeIJiqnqn`sn8Aqn rn|>dsnDYpLxn(rnhsnp>> -L@ 0P  -LMp< 00 & = 0PP%>K` Tp P PP 00 00 8000l gv@j=T P(KD@0 0@@0D@0 0 hS=>qn -LMp00  Z0ST0(P Z p0 0@p0t@$K0 0@0@00\9 000P(` 800@(, 80<@.1 h000qnDYp -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW s(K4K 0H ,@K@I0 PE,04 @r,@ TP<  0MPD < PR/JD 1`PU'J0O U 00HP`F<@T D1P @00;00!< TD L0 <D0\ 1@ > D8 1P(`80 p0@80<@(, T10 /00040K tx dP`0`4p8p0H08 8 0O`0@8 <d0h@@ R0 40K)D t0x@0 0D|00LP(` 80X0@(, 80<@ 0@ h000600sK/qn')DYp p-`0`` @X0TLP0 Q00cR0bc00cUpp$rn8Arnp-00H 0R00 P RT T0X0T0 P T0H pP` P`H0 0@H0L@pPt`psnqn -LM40PC6/`0`,0 R0dp`0dPh`ڈ6@ ,P 00000 @0 @4 0PB&@`?S RQqn -LM||@P0@P0 0{<(6@0@ 0 @d`hp4` lsnsnqn 0-4 LRP@H0aj4@0\p 0-PPQT0T x0T0 PT hp0 0@p0t@H@0H0L4l(H00  0snqn\p,rn p-H`0VLPH0 00D4OL+`0SLVJ 00H` 00000 R  600500 RP P0P0T00PTp0 0@p0t@pP RT0T0T00P T0| 0p@ pt LH0 0@H0L@00rp\pxsnqnsn -H0LSP 0H@ pHL Pp p`T 0@P0p P0^0pt 00000par00000qnsnxsn -H0LS P @RT T01T0 P T0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@40#6 vP`d0 `  8 T40CX:RH`@圐X shQtp Uh 0 `U 0t\p^snqnsntsn\pDYpLxnxsn>(rn00000z -0ML 0 0,`p@P0ʠ @ @LPT0T` P'HH0P h@lP`p@tPKh5isnsntsn|snqnsn>0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S p-` ML<@sn -Lp\ \\ (`VV , $0R \0@HP HL 00h0@@P P@D 08 @bP:0"09A@`Ȳiptn 0-00LS@E HR 0<10  0  B (P X(PX0S P0Q 4 $0R ?U 0hQ 0S8 R R:0.SR 90.S R$0$0$0`0 $0 0 <R  000 0   0  B tntnsnltntn 0-0PLP (0@S (0S TH0P (0@S (0S T0|ztntn -@\LP o\PXP hXP 00S0$000$0tn8 80R c99j p-@LTP `P`@@T@p 0-@LPT P@@T0 -4LXM@h3@Q` 0S0 GKH0KLKXP   0pWb 4 $0R |3@P  @(KPP  0 0@00 0p$PW 0JW  )060 8P0"0 RP *@P060G  )060P2@P   f*@P0@600SX 1@P  ^@ 0 0 p @ 0 P0t!0 R$$0U: AD1@P W 0!0 Rj(0 0@(0,@ @) ] E)0600@D90P  0@P  A`0@P @p: ,0@ P @ $ ,DYpȲiptntntn p-@LT`P@P  R0T 0@ PPP@p0@0@@P -1`LPpP* 0S'ʼ弡 0R1P MW0p$0@40$0 9,0(`8X0S; XP 8m'(1P垢W,  W @0@00 0S 0Rڼ0P m8 RR:0.S `0  $0@` TX p @0 0 0R 90.SȲitnAtnsntn>ltn -L M0@0a1, 0  +E0 Z0 0P` ,0  p 080 0Pp@`Z !00,0 0(K M-LM p0, 0 `@0@P`pG ` P 00 Y W 0  }ZW,0S (KoqW(K, 000 (Ko(Ko\ -L\MP lp\ X0 T PL T 0@0@0 @0@ T0 \ P@d@ `P P`P`U P080h0 P 8 h LP(04l l@\, 1h\ 0OS"U`U P ,KtL 0'PPP@t0sI ,T\ :PT0p PPTt00@(KhT 0O4 0 T SD @ "40\@D`U`H P H@@h D0Lp @PP8PhP TpPXVx0sPTP Pt0p 0@V P@8@h@ tPP 8Th h0t$ɯ0 QdPx0 S`T  0O 0 @UE PXV@4 K P 0R< 80 SHP\TP L 0` B1LP\'P< @UU+ CTP0t p H@8 @<@K0@ PpP0LPP8h V 0Lh PP `d0K0@d0 `@ T@0 0T dK(@U:1U*+ C<KT  PPt00@@- R00 RP00 10S 0<0̲i 00@Q@- 0@ 0$@!001 - L0; S tn -@(1 LRhq5 0 $  \kP$V T 0P P T 0S T00Q0SPkV<0h<0P 0zkTP PU  0P ?"DYp> p-P MLhh 0PPD0D `VPP@P U$@Kp>tnܲii -@ LP ( R,0,0,0,0$0 00i P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQ> p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0E00C0hun 0-L@PEUT0040P0T$0 0   R0unxi -0SL 0R& 08 pḖ P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS Lb) b)a)a)a) 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#0i0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P d)d)e) e)e)d)#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'ti|i -LM40 1\h10 ,0 080 E\A0U@ p pppU2T 0 P9 ,Y41; `PM@$ 0 p4  00 08 0@$0  8 0 ,0 ,0Y40% Y Y @\ @(K0@P(KoY0@1, 41+@ @TDYp -L M$@ 8 0}K0>un -LM 80@ ` #0 R\ 0 [  r P|0P0C,P SP%0 ,0S 0 !"xP  00W(0$  PZ W(0$  0  R H 0  ,0S (0$ } ! қЛ8>L> -LM,( 0 080 R0 0`(40 S P< 00  , "<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 0,P (0PP   9"0Sy 0Sv 0 ,  00,P @PD R,Z, 0 jb, D@0,SɌ,P0 ST@T$  "/ P, 4!,K0 p W^w ,P,P0 S SJT30 S ( @<@b <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN  T+ 00(K0/S 0 db<0@S@ p0S4 0p03R0S@,PɌ,p@ ?@p  pt,@0 R1(0$ ,  0p p  , 00S (0$ 4 Rs (0$ o p@0 0 jȌp,0 @pun@  -L(M0,04! 4 p(PK 0SO 8+0 `V8 R4 ,0 80CQ0S/SL Q0/S l0` 0 80$0 R 3  0D 0/S$ dqx  P8l ``8f00(Kj08S8+0⨽`+ Pn8(0Sp < P`Pf,0_ 0$"  RE $0S0$0`0S8;0`0K4 PP 0PK@4` H0 D@ 8 `8lѐ 000e R8Đ `?`0PS8iuntn0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-l@0l S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RPvn -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00K8iUjvn@-0@ 0@ 0$@\0`@D0H@80<@,00@0l0 0P T L @ 4 X (    (0S 4 R808080 Q(0S40 408080000  R0S,PP000 D000 ,0 0,0 ,0 0 0 0dwn 0-0LSP@@00CST00 D0D @0S0@ 00@P@0Vx> -@Lw'  tt0P \ 0,0 ,0 0@h&0S,0 ,0,0000@0> -LPp` &0@!D0S ;& 0 @Pd&H0@SD0S 妓'&`&@ R% V@ p0S'PD @VP p0S00&c00 X,700;00@U@ RDP) V P @PP p0S00800` 0^@P %  % %@VR D>>> P-L H00CsH0   S 00Hh]*> p-`LV@P00   R000   pH00H0!Ce@-Q @P -\ 00 R 0@W/ni -1h!RL PpU. `PU 0 00S00` %@]H%NW`pGZ`V Z  ''P0@X PU`(ߑ ܑDYpIJin'5 >> p-LP`\@0^0$C! I p\ n:P @0  0S p@0@  0S pp$3 0S p 0-@LTP (  X5000ܐ) - L@0 1 E5 -LM@X `RR RN`0SKRISG01 h5딀PTX SpPX 0S ` R,p  X`0,0 \CpP  15(K` 0S 4:pP0Sp\" p0,  P00U0Sp0p00p$0 p4x:pP$0 P<$0 LdP7p p-0L@P`    }P$0<$0pQ$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,` K0S S S -`0 KiDU`0x  KiTQ0PU 0S0S PU-` $4$ @᠉0 00 $P0PT `J4iܲiqn -QLMp`0T@$KW00 ?P@ $CW -0T 0CShL@0  h0S0 hDYp -LMP@U000`pI<0`9U2 V$P7U 00CS0 s0l0@!0,  0  K 0Sk 0F<0 Ki$[  0奐壐 塐Hi>(>@> p-0L\@ !0ph \ (0S 00CS'0 S 0p# 0SYt0S ,`Q00000000 ,0S,0 ,0,0000@0ph"TQ 0S00 S2 T 0S00 $ T0Q( P`Q T 0S 0RV`V 0;0;0$ 030T0TQT>l>\>0hpDYp -0L @ T 0P Q T0  R 0R 0r03P0S 0  -0LS : - 0RL@h!  0 0S 0S 0S 000 00CS003DYpi 0-0p 0CShQL@0 0 gP 0k0S0.0DYp -0L @P`  P<00!ZP0#1pQ  RP  .PP 00CS  R0 s" 0S , R 000000 000!, R0 0 , 0 0 , > -p0LM@Pp0 $0KT [P00 $`p P$  $``踴i   2 0- 0LSP@  @2P0@1> -L0p @T( `@U 0 PPt0h!0P  P@U`V 8W ,0p @TvnDYp>>> -LG PތL0Q P 0ԌhV$Ќ s>an>(>n -0LP@U3 PU0 `IpP 0@rp P 0$0 p0 00$0$(0$0 ☇/0B0Z 0*YZ 0%@i p-0 ML@P|@@` 0ht@@PnX 0P0@Pf@ @@0 P0PPKphNAHxn0>lwn8>vndwn -0 P0@L`p-   L RP0P0P0    0EL X000 RL L0P0 @PiiiiPxnUj 0-@L0Q 0(0PPLQP0P0P 000IP0 -pPWL(` `0P$@@0$0 0 @$0@0$0i p-LM0K@ `P000  0P` Q/0 ?0S 0 00^00x80 Q$0  iUjUjUji - Lh0@P H T0R D D0 ?R4 0 00 hLxnTniii -PP1h!L `@R4!40 ,P1p P 0 @ T P @ T0 R B ʐ R S0( tWw4 0$PP 0 f, DYpLxnPiiiUjiT>Tni 0-0@0P 0LmM0 000PxniUj-0<2 -LMpP`  P  0$S0S 00T(0 $@ 00 0@(KP 喜 K0S -L M`@Pp zP " 0$S%0S" 00R$0 , (  00 0 ,K$0K p[K0S -LMpP` ? P  0$S0S 00T(0 $@ 00 0@(KP l K0S -L M`@Pp P " 0$S%0S" 00R$0 , (  00 0 ,K$0K p1K0S -L@P 0S $0 R 0 0 0  p-LM(1@0(1@ c0X 8 4 \0 0`K`0 0@ sPP KpL`K4!0NPP41 Q 2PP0S0  p-LLM@0P `40 `K0CX \0 ` 8 0` =P L0(@`Kp -L0MP@Up`( K`P( 0 ` 0S$0S ` 00CS 0 $K(40K 4 @` T0 P <` 0P 8p DP (TK0L0 H@  ,0KL0K( `0 @ )V( D0( 0c0 -LxM@ 4PP  0S;$0S7  0S`0 S S 0 0LS 07 (K K0P | K  0Y S 0 <0 0 @<0@@  0 p-LMP8 `KL4 X \ ` `0P t@P L@T H8KuHP @Kp@K 00 0 ˠˠ HLK8 K @PLh0 (! (!0 c -LMP@ hKL< ` d h @8P *PHTp1!Q 00 0KP @ 0 娀 PP'@`T 0SA 0SP WPWA U( K V7 T@KPPx媀@KPP~|\Py0圀u KT `@KPT0@ KnP0SP[P,,tn -LM @z -LM(10(1c0m p-LM KP`P x0$@ 0 0  `  00CS 0 x -LxM@( KPP$(`0W00# 0 0P$ o0SP zPP  ( 00CS 0 $K (@K|` xp (0  05 P -LxM0( KPp@P $K(0 $`3(0$ @  00  T0P0 R K 4!0 @P  L(  00CS 0(꜠K@ 4! 0@ 吀 p @0KSi -LM(10p(1 @c0lKd h0 l D @ <@ PP $KX` (0$ P  00  /P0 R K 4!0 PP KP K4! 0P Ԁ p P0[Si -LM@pP @00hK<0 ` d h @ 8@ PP  KT` (0$ P  00  /P0 R ܀K4!0@ PP t܀KP4!0P p ? Pc0[Si -LM@ @K -LM(10(1 @c K -LxM0P#88Sp@ K Kn@P 0$` (0S $0@ @K ʠ,ʠ4!0 @ 6  00CS 0 o -p#8L8MSP0@00dK80 \ ` d < 4P @P KP`  (0$ @ @@K\ʠ,ʠ4!0 @ -LM @ -LM(10(1 c -LtMP`p (0S $0@w .P㔀K K4!0\ @P 00CS 4!0@p _ @ K@ 0-LHM@P @00\K00 T X \ 4 ,@ KP K0 H -LM @ -LM(10(1 c -LM(1P0(1@0 p<0 hK0C` d0 h @ 8p @P  KT  0S@ 4!0 @P @P`K@04!0@ P @ p-L`P@PP0S@ p@4!0 @P  0-D0LHM 00 0CX0 T 4 0\ ,0 \KP@PH00KK0 p-LM@ K`P x0$P~  00CS 0  x -LHM`@p-PP K0D cdK\P *@P0 R@ (K0H0 0pKh lp p D0 @P @P\pW@@K  V2ጐ 0:#: 00   V  V @XHKXP W ^ V-@00 0X\KH K_@00 00 H -LM0:#: :  -LM(10(1 :#::c -LM @x -LM(10(1 cl -L M`P)P K<@K P0PF 04K K P (@y,p 0P$048,0/< -LMp`})@P K -$0@@0$0Lp`P 00$04!0PP5 0PUU  $00#X00S%x R0 00  0 P 0T0 00C0PU ]/f  P}vnp> -LHMD0 p<0 hK0C` d0 h @ 8p @PTP41(` R 3%@P$0  @ K0  P@ 0e@ -5LOM@pQ`%PPڠK Z 0PP (KD0T0  0CKXP x |0 倠 Pp PPl 0<PK4!0PP.41D!R $PP$$P  -( `$0`4!0PP0S P0 T@ /( T! $0X1 -P}P41 Q $PP$P  X!`` PP$8$$$"2 00$ p0K  PPT"0@$0H <$$U$X$10SY EJTUT!000P  0@ <$0 ), 0   0PP! vP00 u8K0  PP]00ST1 cT! RT! ^ T1 PuPT0S\1  P PP 0T1 0 T!0$ 48$ v41$ \1X1 S꘴i^Pivni -LM0 0S K- -L M0   <0S-K K -LM   0 $0S-K K -LM   0 @0S-K K -LM   0 D0S-K K -LM   0 0S-K K -LM   0 0S-K K -LM   0 ,0S-K K -LM   0 |0S-K K -LM   0 T0S-K K -LM   0 0S-K K -LM 0  0$  0  40S-$K K -LM   0 L0S-K K -LM0  0S-K K -LM0  p0S-K K -LM   0 (0S-K K -L M0   h0S-K K -L M0   80S-K K -LM 0  0$  0  l0S-$K K -LM   0 t0S-K K -L M0   x0S-K K -LM0 0   0 0S- K K -LM   0 X0S-K K -L M0   \0S-K K -LM0  0S-K K -LM0  00S-K K -LM0  d0S-K K -L M0   0S-K K -L M0   0S-K K -LM    0 0$ 0  0S-$K K -LM0 P0S K- -L M0AS))d)d)d)d)d))d))d)d)d)d)d))0   H0S- K00 K<0;0 -LM0 0   0 0S- K K -LM0  `0S-K K -LM  00S K- -LM00  0 0S K-00Cy>000 -@ ML̠ 0 @PK$B p-@PL@` P< D   0Pp>$0  -L|M$P@`\(  40 pP00V00S 0,! @PT :  X Q P00S pp$K4!KxpP x00b0at f@ -LtM04!KPdPC l Vr0K0 @  00CS6)L)T)\)d)l)t)@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K  $ -$pP LR3 ``(0S $0 0 @ 0 @ 0 = `00c@  .  0S` ` -L M$p 40 R0 0,0 !P`Q VP! , 0 @ RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ b -@0L0C0P`p S0 @\ -LM(0`$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L0Q00\0S  (1 S ppW P`V  _5RU0 ` b 0a0 -(0L$   R02& 0P -LtM0p`@4a 20 S] ,< D00( ,0PP10S-PK S>PH K ` 0SP< PP8 0fPP1  0Sc  08PP%0 H000(K  0,0@0,0(qPP0S (r0P#  00l PyPSPPK 00 000 @ 0( PPk  0PPd@;0  0 d0r l@KP 0@|@ xP PP -LMPhp, @P t  000(K`$0 00 ; @P00$00\ 00 @P r00, @ DYp -SLM 1 P  0K4!`P~ <4p0 \2@`0 0h t K\ t@ l0 d@ X@ 0`Pp!PRP u 0 S  ` @K0 p`4!@ P 4`KTK,0KL H T` , 4p 0 D < 8 mLK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:00 (K ,0S `_000X@@0S0`m@`7? -LM `PQ4 0 , p0m 44 @P#X04 00 R@080 p 0Sj0 '4 00 UR (0 4 40SM 4 @P 4{ ,4 W000Q4Pm(K84!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,un -LM0 Sz`@S"`p?à@ @( K0D0"D0P0`>`P  (K, ` G` - L0S 0ET0( 40àLi -0LT 4 40#"B ,0S -i 0-@L0DPS <00S%40"!B 0rni00CS# *` *` * * * *t * *` * * * * * * * * * * * * * 00 00 $00 00 0-@LT 0 .$ àlL*PPT  !88#!$  T@ E0 00F0i - L -LM`pT 0#((0"4S@)@\& Q  R1@\00 T(K "88# "$ 40@P T00   @ T ( 0T #40CBD * 0| @\T (i( 090d00(  (0T `0d;0i -Lis> 0-LM0T  PQ%4@ Q XXs HL 8à L8>ii -L M @TP P@`K - LT0$ "88" #$Zr> 0  T 0 p-P@0L  ` @ T0 T00 @p 0  T 0 -LM@P T0R p  R r0 P  00`@ V. (KP@ *40bt f (0P0  0f 0`P 06  0`(KoP0  *40"!B `  UW 0,1S 0 R0,!0 0 x 0 `4>ii -PL0pS( zD@`T 00  R 00@00 \D@`T0S  0!r(>> -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX $@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P|p , KP ,0S$P3ᘐBC $0S000(0 @ * 0 @m@@P 8i/ni 0S  T R PX@T^X0T[4>8iihdi -L0M @P 0L0 0LSP SW pL0\ f 0SbP@"T0 4 R\0@H0 D@ *0@ <0 8 ,ZJL \UE L0HKP`4;D P 0,@KT @ ,pP8iiihd  -0@ L <00 K;0 T> 0-0L@P 0P 00 -L@P  04 -Lo`> -LPot> -L@P0 o> - Ln> 0-LMPP @ 0@K0 0- PLP 00;00@0tP  0h -LM` C AD_X`@Bp @P PU, `pyu Ÿ0Sz < 0 < 0-.R0 ܾ 0$ 0O?0@ @Š c0 PP!0P ľp!0PQ ` cP!P10\*<1P8! 00\: Q c02  1(^{>N 0C"(40 0ȁV000W 0@P` < B2MϠNl尀,0尀h0T,\0S0 S0AZ1TyndynQ`ynnmXq1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (jlynhynpq R0S  0 0-PLd@E P 0 0= d0 -LM@p( $0P PK0`KI8   4 00     S0  00S K$ K PPH$ c$P cS $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW ѽPm z V XT0 s0^\ S0 0S0e 傽U Z -LM@0 pSP4` x0s $ h iP(K od0WlW;`0 00 , `pdX01Y0dp$00W 0, r 00K@PPX0 G2#,p t0Q= x0000s7 3PdX0A1A ,0KPPdX0A1y\0080 Y `X ,0H `0Cd04K PP 4傻 JPPX0` 70bd040dH80cb 44̼> -LMd@H0S` 00S` $H0S -( $00  %0`H0 -LM0P@4 x0s` S0p`d R#*d0X  B2!0C03r T0Q` 0_`P0$0dP0i/d 0pi > 0-LD> -80 LP; 0)0Aynynpyn -@LplP`ᒶ0p8< U##00V 0` S 0!40X ln@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0% -L MßD D@ `0 <` 04P p `\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@08K4 K@0Kr4Q <P и4p c @SPQ0t `P2t0s H8'[Z0<0Pqx0sb,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@t0x@4 , 4@ Bd>yn>yn -LMP p 02@$p  0 !P  0P:0RT0S$pH0 X1$^D   !T00T01 01$pP0S5:0ΰlPὰ`P00W0S W( K,0K($K ,0PP$px~H 04 0 0, $pbP K$\ -LM4p`P4K(K 07@P$,K(04K崷P,(0H R:S 0S Q0S-$K)P&,  -LMQ@`PdX 032`DnP6"\050@0 0 PtpPX 0\ H `X H0N a 0P]pP 00 -LM$@ 40   -LM04`<0  <01PD p,K8 K0PP40K,08K%PP.0, H0P*0@SH0 @0S0S 0 YP 0, H0 @0Sጲpሲ(KUP0倲<\PP0x<00<0 -LM4p8K,K 0Q@P80K,08KζP30P,H0P *@,0PH0 @0S\ 0` \ JYP d DYP 051p-(KT0$>> -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04Kt`P-(\0H0 R (0S  @000 A @D\0 0S (决`P 0\ 00T00S$Kӱ(б -L M, ( S0 S0 p_(0Sl$K``0\p \H 4`x0sA ,K`X H `0Ld0 pP@,H0 @ 3  XP,0x 4qP0 40X`0S( U$ q@0S (0,,x (0K,p pP(S0 `@0\p,p\ `W,,p>> -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K卵`P00(\ H @H +XP 'XS0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SK-D  @  D 0 @ P: ,0 @D0CS,03(0\ C(0?`P< K0 (4K A(X>}`P0K40<K`P00\ (H @d 0g(K0s0`PL R S0 `, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 4x \ `S0p p(K|@ 0Pp |x ޺Pp | @0l@ ( KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP@\8K00@KB@P20P88PH 0@ s 3S00S9 X0S`hp R PP pᱯdd ( X T ᣯVX `hp V0fh2h Q 0\0"'p [ x | {0p0 SX`X 0\`S  P~ T0S08\ 0 0  80KK lVP`(p`0,0\0x 4r` ,0SPZ V,` PR8E v 3\x0s00 @`Ru P 00R00SQ  O u | 0Pp ``0S  Z Rp \ ,40KPp l 40R x0 0;0|t p|X T `\(pX 0B,00.S  R R0.Sp`R ,` P ``0S  Z R= |>| x 0  x | ᶺP0  u | 0"Pp ``0S  Z Rr || x t0 40@hQ`M0p0 h8噮p@ dP p `\ ,40KPjl0S P t |\06040x P   `00S | 0Pp 8X` 0A,0h0(0l0\;0p *t p|30 6p 0 t |)0\60 ,40K@P!lQ P  &40 x0 m\ ,40KPp l0xS40 |t p060|t P0p@ 6p@ 0t |P060 40p d 00  $00 0-L`P @P004  0 0 -LM0K@`RP00 0  -LM"0K@`AP0   -LM`B`0$0 ,` (  h0PSp 0S\, KqU  S 0P$  $Ko\Hh*> p-0LSP@d0 0< 0S  `P  0P [pD0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z mTBZ hT ex dT t KVp -L  p`P `R T0`@0Q |`< ;$0 :$0`" -L8MT0Pp @P (KPڈ7 U@ `4!0``@ T$0040  0%@P(K@ H H :D@P# T0``,Pɬ f4 0R  Z P < ; `b,0; KH@ `0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^v 8 0Br \p:0L m0Qj 8^g 40@<0 Ta,0<!<0@<@0 x rD 0,80<0@ L 2@?!04 H @D000H0`T 80D 4t0LP QT 2R"0D  0 D0x02tQ0 08l0l00P  S0CP0l04p0S0@4 C`\ d0Sd @0RX O@@0 40,0P 0 P,坫0,0 |QKP0 0B ɨP< 0$P P @P$00104P0010h0 0`刐 T0f"0#4X0 @0!@.X$ 0,00@0H&0%< 40| h0  x0|40+H#13 嵯@Pq,0H@ FRP 0|0,00 +0 ,10,0 yT 5RP@ /RP( )RP n>>t< -LMMVKp\  x P|`P$0 ` RC-` R3XP K Z 0}`P (KKX Z 0}`P KZ 0;;p @0,0 0CK(` 0000d`PP0S`(   Py010 0$004!$00  $0~`P ! $0T h 0 #40S`dP $0 LM+4! 0` YV$0F 0S`V`R0 0  00 0 0@>x0s009 ,Kz@P)  `_U/KT`Y KZ bQg@ 04! ` Vt B 0`,0@dP,@B_Z5QP\Z RZ-QYOKZ RZ%Q Z R x Q8iE0 d B40R+Xw*w*w*lw*w*w*Xw*w*w*w*w*w*w*w*w*w*w*w*w*w*w* 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s 40<0@l00l 0<0 0<0ȶiii@l R0l0 0S000-@0@Qd0 d08@P@TP0 @$P @000 000! 001@Q@- 0@ 0$@!00100000@Q 0 S 1 91 0-L M Pdd @0 80K0 p-0Ld@`` $0DWP4%(P%(P 0 0"$Wp>P>z>\> -LM0 dpR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 0d0CSDl0tP`S u*  T 0D0  p0S40@` X0b5 ` PVQt @P 0@t0x@H8OtP`0<0v@ t0sx0sJWp>0d<f0d< L0d <F -L@- -L@ - -0 LR@d`dPp %pl0lV \ -LMPdPdpWLpP 0@ BpTllpPn 0 pb p-L M0d@SPP Kp$`Kr#0 00 4 0 00 000^\ KS0 0S0T0XV B00Z<0 -0@,LNl0 9[tn -LM Pd@p`0S ( d0R`#:MC$K贠K Nl K`P 0 !0 044Ka0K00  T` P` #0 00 ,0 "0.00 ( K0`P0  l0 ( 0\K^ K`0K0DM0VKX Ka0[ 0a0K0 ZK0tn -LM0d`` 4pR ( d0R#:gM(K@0K 0@PK<@KN00 p "0 00 0  000 `X 00H `0Cd0 PPP嚪d@HMH@ M0 H 00#40&[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x `r= !4 0 0 &[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x r 1P t KP) 0 g00#80- [ `0#80c  @0S 000y dKf Kh0Kr0^K` Ki0[ 0i0Ke@ P0K, K 0X iK\ @ P P0  l0 , 0'0 bK0Ltnصi -L`M@ P`', 0 `((0h!(^x `p ,0U ,P301 (KP (0^\ x P0dd t S0\ P  0S t0Q 0 0 t0@t @0\ 0P lcd0,l0 Pdlp (0 ` l,0 -x 0d d``0P PQ  | X  Zp0S,\ltPf0 P ,K (P],dPdl Pp p  | X lp R S0mP\_pl_PZ,l0 ,(p d? KPH00 0 0 XQX  0K0PV dt T d\h (0d0 X P\zQp0l 0x  jt 0@000a.^! x  0 .R?x  pQ ,G00 X0 |0 PB \0S z x P R,0S8't H@# JKL?K Ll0 ,0` 0( tl pP JK K0S0th00d 0( 00htpP 0S x 0x  0,\\X` t2l 0@P Q x 0p`t  0S\0` 0$0TQM x r| RG T0`@T9 `X H `0Dd04K pP'4 $4H0@x0ls` 40  0x0s $,$8  04pP 0@0S 04Y0"S SSSDYp>>>> 0-P@QLdQ0hk -LM@p0d`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R PT!88S(-S0 0S00 00 y (0$ y0  ,0 s 0,0 0S P0 S 0, S p 0S~ S  0Pl0 (0$  0R P l0  0P0S 0  40s 0,00Z0@0s 0800^\ 0 S0 0 S0 0s (0$ X 0S TPQ0S 0 S0S000S0S0S0 0S0 0l(KoS0 0S0dYx 0, S Psn(0$  !qvPTA0sMg40sz@0sw -L M0,@KdP4p`0 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $~40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 00 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV 0t ,0!T D0\ 0^S04 0S00 0\0Z0m -LM@ d0S4p00 0 <@00 !!  0 @@yKm -LXML T 0d SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QTRPP80K0@0Ud <0jh@HD0cS0! d`PS0!\ lHS@1@!L P0彡UCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @ڥP,KP8 K0sPP`0K,08KPpPUX^OT(0$  JP 000EiC -L]M 0t d0x1 S 4  UKFnHt1tA d! `1 @`VA a | Y?K0@ttq`1x2` 8#8R1 `AT@ 0\! X1 @| t1\ xqd|!d0baY_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0p! l1 0 W p!h1 x< K00K,@K@P 4K,0<KgP 4, <0X! cQ!H! 0S> PR `Y?Kp`p Q { da `q p l! h! H!A0 P0S 0@ `pR Rd ` p l da `q h H!A0 P0S ᡠta\v x!|adAd0faY_K`W/K PU`XX\0d 50pa `2 PV1Q W p!zl!rt1W_K`PX`t1YK Aq 0t0g0xd PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KhPR OK _AKA[ 0,$0(@K0La Hq t(K0Sm:UKt!RP y0 4p! l1 0da `q h1 G01 da `q A04 00,0S00SX `H a0C"0n2O@ * 0@ T1 PA B!KUhPA[(0K 01Bh!UKh 0@4 4YKp l @A h ǟY_K`WKt1PU`FPV0 0U@0RX{4尟pq, tAWK^K`PU`Kd `! (4垟W_K`tAPX`V dqRU']0OK,A1K`H YoKA1[  L H! 0!0(pK0t(K\%:UKt!P (PUSKd `! 6x0s 0@T1 PA 0UB1K U0OK,A1K,H@0@T1 PA ?PYK`P` ! t1?PYK`P`da?VtaWKY_K`PU`40|a 0OY_K`PU`Y_K`WKPU`$?7? -LPMd dP dX d 0L dT 4SH P Sv MX  LTd0@0 @T0ReTPa 0@0@TZPTX ,0K[PSLTdD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0P P\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  LQP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0l ` RLDd0S*d0l\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0Pppp廡0 8HE0000 0 yn0S 0000400000@-@ 0 $:0S 0O0@ 0$@$0S 0S80 Pl0Sl0SpPyn0  00- LP1@s 0P0@<0\0d 0\0 0dPs $0S0 $ 0iPn -0 @LTpP ` @T 0S0S`   0V*/nP `` ynp\t0x t0t0n 0-\0L@CTP\@ 0 ` \  X( T, P0h p-@@PLbd `R0d0 0S00ph -L@QP x eP $l@0Sp0 p0t0tyn0  0- LP \0$ 0\00L0ضi -@L 7  2000 -LMP P- K@K00, sPQT0 Q8@K00, _P0S0ضiܶi -QLMP`p@  K0HS@P 0@i -1L@T7 W@2 0pS0pQ+ڸ 0SP$00S PU R `0S p0S Sl 0 R \W@0L0Pyn -pRL PP` U @W@1 ^BpWP`J,>8 SB0  0- L@p'PP@ A`@0S @k:0S 0S 0s $0S0 $ `VPn -0R,(SL`@ P U 0녁p kP  @TZP,@(&  ]P Z@,p(p 0-80LS@P0S  R00Q0 0008P PP hIfI8>P> p- L 0`S t0 PUPU 0S 0Ss@?Ippyn -0L@pTP) `0S8 BPV 0R`@TV 0S A0@S S yn0  0- L@`%;0pS*\6Tz P6T :D6T 86T Z,6T P6T+ < 6T g6T 5T  5TP0P0P 5T :0CT (5T 5T 5T P5T `|5T 0T 0CT0S i70CT 705T0P00 0T 0CTP 0P04T 4T 4T 4T PP gPl4T 0T 0CT<0P0T4TZ 0T0P;0w 0CTsz@UPk0CT] 0TT 0CTa0P:0^3T 3T 3TTQ0PP 0 M#0OS$,|3`P 0S0P 06P40PH00iL0P0(0P0S0<0"0S %80@SP y i0P0S0D0  QPL@0P0=0P00@S0P@V@0P00P@00P0=01 @P) 1 0 P 400D0P0 i PP 41 T 41 X X1T ,0T P1T :(10SP1T 1T0S i0S0 0R 0R 00 P H0Ts 0Tp P0PP080akB @}fwBlB mB tB@f@oB@nB @wt@|B@vB fB@hB yB}BqB@iB vtgB~fAApBfB{Bܶi -@LH0S LQ`2T0`0P `*T0`0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(KPn -LM`Qp9 0Z P 0 PR@T, 8 8\ @T$ 00= 0 00@0\ (P 800S80 4K 0 k<0S101@T(K4K t* 0-LMRP  (@K  K(P U 1[!0 !K0 -LL̠Č.Č M!̌K!00 K0 -LM@TPp8@ ' 080 @T 00= 000  0(k`P X4K T0  <0S80080 @T8(K4K U<30  00- L9@00PSt00  0- L@0PS`  0R`  \0 0rp\0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  7 `0 @ 0  B&0$00 pP` #P0S*P "`0 0 0 0 Pnt> - QLM`p Q -iQ Q pQ0 )*00@T8s i0TP,0 @P pP r @s17p Q00Q0000 0VT 0YY V  c= 0 0i 0   w`wp ,KN=, <4("4!<0 -0 LBM0 P @RP `62P PPK,~K  K0_PP p 0Shr(Px0(0D R 1[S01K @ 0@P20@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'****h****0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S Rܶi -LDM@dK`@P<T@Dp @0S񟗽 ********0*0*0*0**0*0*0*0*0*0*0***4*0*0*0*0*0**t*0*0*8*0*0*0*,**0*0**0*0*0***0*0*l*0*0*0*`*H*0*0*0*0*0*0*4* *0*0**0*0*0***0*0**0*0*0***0*0*<*0*0*0*0*0*0*0*0*0*0*0*(*0*0*0***0*0**0*0*0*0*0*0*0**0*0*0*0*0*0*0**0*0*0*0*0*0*0**0*0*0***0*0**0*0**0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*0*<*0U*U$ KG$0S< K U0܇0q3U 0\ :0S b0 bS \* 00q`p000 0 0 K10Dp0 K10D00UU 0P :0S b0lS P*0 01@0UF*U$ K$0S 001@0P:01W| ِ0P:01АUkUk 0P:0Sd b0lS^ \P01U:0aS0 $("0P010zQ20aS/ 0< 8kP 01gd0S 010c[YpW01@Q0N0 K10DpH0 K10DBp@><,, 00S0000iyn R000  B yn 0 Pnzn404 0,0, 0c`QAQPnzn0 R0 Lii -QL M &2 H00SH0<6 KH00CSH0ʴ64 8#8 & 6 1K, KLi 00  0 R0000 0 0 0cPPnzn p- 0PL0cS@`$P  0P@ R*bP!00p 0 \%*0Q25 RP:p Pn -L,A> p-1!S0#RL@:6 h0 Q0 00   h00h0Hph0  p0h0 0 0 @0  !  !\@P `0S ph000 0@@0i$zn zn -L@npP 0.! ,  !d @P `~0S fp00 @@M$zn zn 0-PL @^m P0 p-`PL @4:0 P ` `pPn -LM$pK@P `bP $0$@ T1!Q (cK2!   cP -L(MH`KPp( @9U  Y:4K0 08 K-4 40, 0cS$ 000_Pnznynyn -L MPQp8#(`@K>08#83K6  L@T@T 0S 0Stb@T0@T V 6 8#8 #K&x Lt KP m,2b00@K03K6 Li i 0-@LTPQ &8S0B8#8S6 $040h<A 0-L@P40h* 0-L`@PQ \0000  h00h0HQ0h i -0 LRh7z?>-Q 0P P P-0 50 0  p-0L@`T$@T 9P 0 RP U 8L1 SPUpppii$ 0-H0L@PT $@T 8P0000i 0-<0L@PT@T 88P0i -0LM@PT$@T 8P0S P 00PK@`T SP,pK!7 88 aPPE`@T Ui -LM0S $Q 00QK$@`T SP,pK6 8 TaPPE`@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK 6pW5PU aP( 0Zp PEW  UHK`@0Sc8K6HK `Z Y UL0 0eL 0` `8Ko6HK `P PE i -LM0` V ! P0@T PPPU,pK@T PU A6 7 `P` Kyni -L`p&6H0PU ,0S @A@PUhIgn 0-L,0P@T @T0h6i p-$@LT`PC@T@ r7P R000(0 0 PP 0S R000 0 0 00CS00$ R( (0@0(0 0 ($w sppi - @L f01 0- LP, P@ @ P7 40$    0$ (0@ 0i -0LSPp!$@T @T 6P  f`P%  `P"  +7@E0/S%709S@P  0@T$@T 6P000@p 00  (00( `(i -0L,M@T$@T 6PP @T @K40 0KKPP 4PLi<@KD 4 AP 4PZKi>< 0-0P @L0 PP ,P,00 0P000 4P400 4 P` P ` L@K 1 ,0K[0`0 l Z0`0 x0`` 0`` 61`PPK@ ,0K[`P@@ g1@ 1` `P0` t0`P6  $q`$izi xi i$yi UJii i$ii ii i i i$i i$~i ?qi i i 6i(KiFi@ p-LP6!;61H! T!L1`4 18+_,bQ R 0l10  0 h  R0 <10  0 $Q@T 0 0@T, X0 T4 P4 L8 H0@T 0 R 010Q@T00 !ph,*4*o<iigni -L M,pKzb$Q K㆖0 bPP 0 ,@`P @0 0@0@b1017@ -a!0L0S00|0@ PT 1S @1 RPG T &0S" T $0@(0$@0Q!R<10 R2 4 <8 $ mT00PP  Ep@P !B-  p$ 4PiLii>gn**> -L@O(00  0 @ h|i -L@=00S0 0000@hhiL - L< 04 (0P hc4yn*>zn> -0LS@ S 0SQ 0S 0Sh< ,PT 0S  ,P @< -L@bpP 0.! ,  !d @P `!0S  {p00 @@$zn znHH-0#" A0: 0 A  AQ0A0AUjTu<0@-PR@ 0 0!\!""0"!0u<@-pR` @P@@ 0 ,>#!^ """!1# t<u<   p-@LT`P7 T T  =, 9,p/p0S 0S0S @T  %, !,p3000 00   00,p@T  l,d ,p@0^  0@000X B00+pfiliZi`i -L M@*PK0pK `P5HBT+@T(  +P +P0 CR Q04`007oL20CL2 +PP2 0CP2 `$K  -L M@pl*K0K` BPP*0[P$K00[ HBT@T  Q+P  K+P0007 Y@P!  ]+ Y+00 pH2 S0H"00/HB L2 0L2#+PP20P2p4Pl7P -\ \:6S0d0\-P0P0p040\0\ )q2i 1i i i -@L<0 <1H”\  ^0 007H”\ -L@0@2< D0CB2A" @00/00 C2 EDUj p-@2L@%P0 `m @1l n`pP B l00ʚ;Q`0S9`00 Q-L@0CQ:T0Q %0CQ6@06 T 000p02i i 8+ -`LPp@W LP 6J6T,0 d 410S80 0@0@0O   R R 8 0s^/P0 0@0@0O  hP 7R^d0 3A0 >0>iPi(> -40L @P  -zn p- L`@ PP(  08s/ 9p0&0 L1@!0 Tl0n m L 0p0@P pD>T++zn -$LP hQA0tiL>- 0  \  \ 00SP \`0S S S 0S 21C 0ጷi p-` LPP0#U T u@R0000 0  Tpp -P`QppW@L jTh 1R' 1RP  0S\0PS000000P 0S 0S \@ P @P lP6   R03 Pp`PP`p  0 ^P1 P!Qp PU00@  01 PU@PP  w @P0PP!$RP5i 6i( -L@`p  PP 0` pP0  0?/h> 0-L @PP 0  Tg.0P P 0 P/>> -pRL` @PPU@ -L  30P .(+ zn> -`L@T( pP@T 0  "!    "!P T zs @T h$zn-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S 000S  -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -p L@`M'0 6pP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0 VjVj5+,+.+2+l"+ 0-0LS@P 0p 0P 00h0 -L M  0P&0 R (0P0 RQ Kh- 0 0P h0 l0d P*00PDP K,$-("->,zngnzn> VjVjVj(zn >(> p-@ LTRP 0` 0S 0SY 0CS 0 p0R h,pX, Q R 0S: ,,p 00CS 008C8S08C8J\0 S  P RP 0S T T  0Sd, 0 p0A 0 p4,p0$0#$p>`>>>4>,zn -L@ T@P0S R 0U0U R0 0T p Q 0 S R 0U0S 0 S @R 0S 00 0 \ !`P 00 00 0@000``p ,`,zn> -LMⴒ`0P@@PRPU%Uㄢ||2 Eq$ el$Qk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  $P@TXppW0 !P @ 0 "$,1, K 0o,0@S2\P P Q0h 100 0  dO% 0 00d0 R 0h1000@f+  0LSznVjVji(znhu< > -LM0 P`@ 0  @@0S  e#PVP  $P P 0S PU8P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @*M"0P>`>,zn -L M` @ 0  @@0SPU00  Q *0 R 0R  Q 0@P(K0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "0 0p 0 0# ^P 0 R !P0  0R01p W|0  "0  0 0#\g TPcPaVj Q0-L@P +P 0000 0P  @P00T00S P 0T P -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:!PW  `  w 3 -`LV0V 8CxW0 08C8J\F0 S  P RP: @T#@T 0W0P Y( 0.0PU% P  0R:j!Pڐ P@P 0 0 0000P@ 0 R 00 0@$o(( ,zn|>> -LMQPp0`%( K0( @RV 0 0`  `( RP(`0 00@0 `P@ 0 P @ 0-@PPLc R000  0h0  p-@LTP` X0X hP P 0< a!0S00@@p7p ii{n0 {n - QLp@`0P0 S 0S-`%U`" 㜻T18+8+ 9+ 9+ 9+ 9+9+89+8+H9+9+9+9+8+ 9+9+8+ 9+ PN @ ` @ ֺUѺ-`0 ` `s`<(-` 0S* {ci`[i`W @T8`0 0 0` @`;cFi`ꖺ`P`9` 0S  0`> --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0  P P  PW  0WP 0P iP [Up@TW 0P iP LU(K__p{nʚ;P  P0l 0 0-LP@h0P  0/0 p-LMP`@VP @0  Px/x -L@A0PP 0 0-L@P,0P0 P 0 0-L@PP 0 P 00/%'>00 R310 P0 i {n|n0 R0%3 %'i{nP (0 P0 Qi {n 0-L@PP P0 A0{n-<0 R  R 2Si -鈀LpP0PS:x0P@`D 0%#P @$T` 0#PiPZ+ 0 Z+ Ȱ-P2 S R 2 S,00CS,0 R0000 0 ip@-@` 0 PU1! \ *0 00\: Up lp@ 0-L@0jPP ""0  0 G 0 -0LSP' @T=@T P,00,0@Tp, "0R8@#xT0W0 Z`P  ,0T0r,0  @ 0``@00 ``piP 0-H@LTP#fH@T  R 0 0 0 R 000 0 0  0S0C0 %HH@T0,{n> -LM`HPP!00@ ,P 0`pXT`XpP`X 0S R 0 0 0 R 000 0 0  0S0C0&   P7 0 0O0 @`$PH R0 0H 00  000(K$PiXi,{n> P-L R 0B 0 h\N%> 0-l0LCQ@l0d0Q 0 P" Q00C0C8P0P  4  040h 0 0hQ$ %{n{n0>$> 0-L MdP@TX0T( @9@0@@ 8,00K0$ ix>,{n{nVjS+T> -p0L @R  *P 0@ 00@ R 00 i{n -LlMpK@P`@ c 00 >K|0 x t ^4T \18l0   0h d ` K -LPM0P`,0 lpK@hP $@P- ,@ d0 l00l0 ,(K 8 ,0K`nP" ,@ l00l0 0S @p p 0hP `a 0SH  00 0,P d0   {n -@d`LP  @P l04 0CRl0 Ad @\) 0P@ d0S 0A@040S T0 P0`RQ TA@0dp @pPi -0@S0C00ppPL`, /PP4 0 0P -@P 0@0d0 'P@ \00` R `R`0S0C000S* PP7 -L`pPU@ 0 R @P@P@PPU@0S @T P l0d 0Cl0 0 R 8@T 0SP @>P -@LTP`p pP% 40S P. P4P& PW00 SQ  R 00x440S3p\ 00 g44P -LTM@ H@ HKGKD@ @@ <@ 8@ 4@ 0@ ,@ x0 P`P/ 00 @YF Y Y (Kx R Q d0  80 R4 8040  d0H K <80 00jKq,4pW  V 21 0`00t0 0Pp0  R p6< :PHpt 7 I@Pu d 00V00Sj 0@NPdd0 o@P 8@D Rl0D0Cl0d08 0Rd0 0S x0H#S0x00@l0S0l0z00r`d00H0h,P  0 Y0 08p 0405  OPr0 pP:0S x0Sl00l0d0 J CA?pt .7t njox @8 0S5 LLl0r 0l0r D@p  [`Pd0 DP@P0P  pt g8d0,!x080S x8kx 08p 040 0 S  xx @`P4pr0 p$@VTc x0@{n{n> -\1LHMl Ṵ@1X PU 0/ ` W X l(KV R 0 0 0 R000 0 0 `V h0S0C0P h@K@0 0d $r 6Xi{n,{n> -LDMpPU"  R 0 0 0 R000 0 0 `V 0S0C0M PU R000  K\@K@M0 0X $r ,{n> -LtM0 p,0 00 `2!xP Z0SW cOP7P @ \`8#H *Pl00Cl0 80S PY N0S3PAP(K萀K@ Y \P ` ` 0NK0 >S d R00   0 ,0K@PP ,`V  l0SY M0l04,  -LlM P0㐐Kp`,0 @ @ x27 `0 @ \` 100 0 >NKd 0 0 0 8 #X,0KPEP*,@T' l08 0CRl0 0 y80S 88` 040 0 0R 0  ,X(K,  >tu< -LLM\PKp@` \`@ `0KX P 0 T d, r 4`p@, 0T` l0SK0l0` -40LS d@P  # -d0L`Pp D@T  P  P -LTM p t `5@Pp@ 3@& 0 p0 &30#P00S, 5 00 R' @PP 0t03 R00SH TU000|!000lK@tlK p0h dp ` P r(K P,,80T P,A@,P 0S 0Sd0 0A@P   0d0, MP, `@lK@(0K#t`lK8 8@ h dp ` <` !@,PP d`P0t03{n {n{n -`Lp 0PP! 0@T \ p0$ @T0S @ W0 @RP {ngn|n P-LPP>@ 0`P4  0pP! ԀPȐ@  @ !   !  `pP0P  80P($0 0ot {ni{n -L M@ 0t]%l0l Q  0S0 QPKd,>|n{ngn{n4> p-PL0S# S 6x 0 @@`P d0 @p @H fP 0S@p ph  @< p-PL0S# S 6x 0 @@l`P d0@p @4 ,P 0S@p  @<0@-000 @ p-@PL,`'T*^1 @0 CS  @ Q00T0#Sp p-P`8L00  00 @p -L Mp 4  , 4  R>` 0 Z0 PD 0`@PD 0 10 0BR0U ` P@ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 վR000 Z0 P P, [ P 0 S@, 00PUP U 000004 @ (K 0y -LDMdKpP @n1X[6R XU  R0 P P]0`S @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P80`S P 0S  00$d0 0?P 000@T0L0 D0 X0 X$K6l07 060d0 0 g?P000i -L(MP@P`0AS`(KHK ` 0`T<0 H D 4 @ T pyP 㥯H0L 0CPS h+h+,i+h+8h+D@fPAL``L 0m<0@ X < : 400hS `300  `Lή@`U @%T U 0/P`/`@ V  ``0h!@qBK K ,0K21C0b ?A1c0{ni+DYpgfff -LhM0`S@. S1 PK@O4 00 P0 | x  18p0 l 60d0 BK0X  `80pS PU 0S K d0Q !r0 0R@R d L r0(0 0l0@04 0帀 0o>P00000r 0a0 S -L M 0@0 Sl+l+l+l+`P,P I@P00SAX/ , @,@  ,Pp @Z `Q 0 70 0BR0`0 NLPP*p W@00P0, 0 0(KP,P @IU@@P00S +SI1@HP,P P,P H 0-40L@0PP XP 0]P H8000a0hD400400hR4iAgfff -L`R@pP TU EH@@TS S *@uI0 0 80@0T@S# S U *@ H^I0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pҭTPQ T< T  0p $K <ٽlQ@d mh1S p@ pP;h1 Q@180@ Q0001 0  7\0@004 0XPd ` a `R \0p40 pU bP Phd00C0 00C 0 K (00C0000DYpm+|n4i --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  ?P P  7P` R5 0Q 02 0BSMr+r+r+r+s+s+U d `X0P `0aR  R  40040qG(K 0P [P =QcG8p240`U  0IP0  d `X0P `0aR  R0P 0  QP8 r 0Rz 40040T0.GPow0Pk{nʚ; -p0L PRp`P @8V P u$$ $0 ph4|nDi4i$i -0L@M 8PRp `K\@K@ 0D0 !H 0P0  < P 60$00  \00 0g`0S00 0|nDi4i$i p-0L PRpr`P @6l07 060h,P^$ $0 ph|nDi4i$i -LP ^@GP @00 `p0Z 0尦,嶠T 0 @0 0m|nDi4i$i --LtMP@ 0U00 ,@ @  0SJPP 1 0S`V p 㻻OF(KQ+p_V V(p P7p  0E@ǟh1P嘀 0`, `00V ^PW 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\ڛ20S?000S \ -|8LS@ 0CS|8 06 d|8S06p@-@P`0"U@T$b0"PU0t0" ^" 0S0R  ^P0,0,P"pwS  -RT+++T++D\ 1 R8v< p-0 0 8LS@P+ 8`S S:0 00CSL+<+,++0:0p080p080p080p88\ 0\8S 0007 88|"R -41 \ Qu< Q-L QQ20@Sꬄ+++Ą+̄+Ԅ+++7P"  P P nP P,$`0 lH >d> Q-L QQZ$P> 6P? P? PG 0@*SH+P+x+P+P+P+P+P+P++P+P+P+P+P+P+P+P+P+P++P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P++HP 0P   `P lP`@ 7nx> -LDM@P`! 0  8Kh pl d d RPd0p0d0 H"0S7 82 1 h0 0O7 |W ?0"QP0PS0@ P h0倀  0.7 M8[PT70[S O0S  8KR0(K 0C8 Kl0Pl 80[S@80[S8K0 fP@ P 0 7  0B 80[S`Kn DlP p0@| (Kh  08[PPh B0{dw<@B/ R-L@`0T T 80H F84An>0Q0bC>> -!L0pS1`o Qo1_AP 00S   R` V0 00S  z  00S  7 1 7 ^ V 00S  ^<Q <1 GT@# P 1 'R! 1?0<<Q w<1 GrT@<k8P,0`1|w<>x> 0- 8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O000 @ C0 - X@LQ@ Q; Q` Q`  V`!0S6  pP V%  z 0  PPR P4@8 S8@4S X*14``D 0S8X op ` -@L?1f!T"RX2X2X2 h -LMp 02i @10jn L !P0`00` VP O0S rP> 0 `8`  V P\AL1 R!  0S 000',>li>0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫7. 0>. 0 > 0.? 0/? 0 |2"ᬟ+О+@P&갓+++++++++++++++++++++++++++++++  7 01S]H="!B10b>0 0 L=H= p-NLTP`@@T 0R!  P V Pp -L\MP @p`u P*tK   nK  f P"hK  HK |0|XX L00 0C 0 L )0C (KtK  f @hK ` `0++> -LM 04a8b #8$0(Sp"hc S KVOK 0F898#8 @PK1 * OK 0K%   0 -LMPU@ p$ 0`K)0KPUp)0[ 0)0K   )K U=@K (K -L"M`04 8 $#8(0"(SpP S S KOK  QOK QOK v0PK pEQ  -LMQ@,`KPp    PK -LMMPPP`pNK   -LM^pU@`@PU 0S P@ )00 ?H P P@ 0@0.@D >PP -LOM`d V p* 1@^K2K908 `V p#H d W*K BK)  %",K VL@K (K p-7L`P@8 0J 0 8 y 0R=:0 "#A10a> 00CS/괝+`++`+`+`++`+`+`+`+`+`+`++`+`+`+`+`+`+`+`+`+`+`+`+`+`+`++0 0  0)S0 SCLR0S <p1S]/phphphphR  048# @(R"!B10b> 0 0C-LSȞ++++++++++++++Ȟ+++++++++++++++++w<h+hhh -0L0C@S ꠟ+x++x+x+x++x+x+x+x+x+x+x++x+x+x+x+x+x+x+x+x+x+x+x+x+x+x+p+zhm 00CST+@+P+@+@+@+L+@+@+@+@+@+@+@+T+@+@+@+@+@+@+@+@+@+@+@+@+@+@+@+H+Rv -NLT` @ RD0D0D0>@ D0H & ^NT^PpW 21C! c.QpP@  W h -LDM 0\ 0C0@  p$@`P 0d `0 dPK`0@\l0 h@ ,l@#$0@`P H#H$8p0!,X Sp` : X  (>0(>;h080S* @0PK 3  T K0 80RKS0K&  LK" FKzTK   B@@K x P 8\p唀 (KX@ ,>0,>H; -L$M@p0 @00L K080 PJKK0K  DK >K 7 LK  B E9P ;PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0       0 0  00 0@0@ (K= 0=: -LP@  (00 0-LP [@P @0 0 -LLMPd `0 \0SK\ S0K0 SR K QK @A KK= EK90 0S 0? K>0K=pKz 0S 0 0S00000p 05K 4K50K0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l 0 > 9 $ =0=98 (K9P | 0jR 00 |0R|@ @| Y PKP KPP0E`@E 0PEP0#U 00@Kx0 88PK P?0K8+ 91P0 00S0 10PP @00S000010PP 0S:+81P0 08@@ 8@ $>0$>z -LP@  ܭ00 0-zLP @P  Ј@0 0 -LpM    590P|0  x7P|0 0 R |@ 0S p|0 P`0P`P`|@P "4 <00 `3 00 "8 80 040PP "40  jHK8KXK Q8Kh K*K)@K00j St0 |}ڈl@ |@p `x x p 0\x p  Z I x@a 0p 0aT@!0TP$pT (0K  0R@R0# 0B`!VpڀHKH KӉl08#̠8K#8h Kl0 *K)0KljT`tdPt +p @p =0=7|7 | |(Kq8P t 0R 0- t0Rt t    V HKH K⍉ 5P, 0X AHA 0 0#0Q| 0 0 0 W7+71P0 0+|7|1|| P0 0!8P 0 0G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝxw<8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00xw< -LM7`p 8 P0 0 31C ` cR 00~쎆>XU 0~쎆>N8>,@$80,$8 0` d@>PnA -L(M@p`Q+̻++|+8K00S0,0K00S00,0KPPK0+0K)0K*0KhO  0  g@ @T (K8K  2K 8K  2K 8K  2K  8K -LXMp l d t h p0P  0RSdP0 @R d 00S  P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p05@PT@ p 3P 0 BjR 0 T 0S T dP dT00@00h@!!R @t` 0\@"X !8X8U$h"H ht E⠐0!1 0 X`L@K8#8 h 㦹TP0paXhp @PX  0@a0g T@! h0ᱹX dXX pOP@ 0W 0pU` 45P` jX , RPP l p=0=74T540T0 T(KS lp>0>)4x $T d@00Sd000+41P  0pX0 @t`K0h !!p3VEh0t@E⠐K0S:`\.XX!h5T+441TP0 0l@p>0>3T3T p3@T@ p3T@ }p3T3l>0>`K T n -LP@  00 - @LI5P0 1!  -L,MP T p L \40PH0 T 2PH0 0 gR H 0S TH < <  00 @0@H#4<<_  0 03 00 "880 040 @ 40L !Rk 4 P`0@0LPCo` 8@K9 L ;T <0`YgH@`pD @ D@b 00gT@! @/D @   dL0=YL`p @D  0W0pD0  0 VP3P PgY P& P U`` P   PP T=0=2H20H0 H(K L0CoP"88 L0 1+31PP P0H@0 0 P3P 0 0 0PLP0<!T @  @0Lη 0@P 0$$$$ P @ L 0㼷H 0 0 0 Tl2+H2H1H P0 0 -L(MP pL P H P0` 0R<@K  9K  H`P 30P@0 a P `1P\@0 0 BjR |@  0S @0 @0 @  fZPPVP@@ PD  0@a0h T@! H0HD + dZD 8P@ 0X 0Up `2Pp jZ  RPP`` LL =P0=1@10@0 @(K+*21P  D0P,@K 0 %10H ,0SP1+@2@ 1@P0 0uP1@ LL =P0= -LP@  00 - @LB%P  -L$MH L ` D P20P@0 L 0P@0 0 iR @ 0S L@@ P D0\ 2\20 ŠD01@, ,4008@K30  5K  DJL 0eZT@@`0P<0  0@a0fT@! <@<   dD0OZ;P`@ 0V 0`Up 1Pp iZ  RPP  HL=0=0@0 @ @(K+911P  @p< .P1P 0 0p<@ 0 #Ƞ#\#0PD0@ 0 0 0 L0vfV+@1@1@ P0 07 0 S00RSS   -0`.0RL 9`>@0#200   N000N "" N04\0N7 t2S0S = 0=0S = 0= - 0LS=(0R=  d - 0LS=(0R=  d -LM8@S P0  0S00 =$   0` 0S00\0S 0-LM@KP  iP P P K0@K \y RP00CS@+H+4+4+++y<~y< 0-LM@KP X 1P 0S+++(+++K0@K |@ P0S+++(++++ y @0Q`>q @Pl"0002 R 3 777 7771Q3#51 R\ 767 !000 do6 \1\TA@.08 #88888 S808=0=UH` 2SD` | SyR=0=s+@K  zPhPf0Sc0< S < ]< R P @ 000t07670D < H @ L @z>\>xy< p-LM PQ ` đ=0@= Kp ĆD ȠH,Ƞ$H@* -@L, h꘴? p-`LQP@ )P   )p 0@S  ע p -LhM #R0 (K88 p !0&`0 " $PT #0P0 X :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*=0=xQ 0S| R 0` S`1 'R!=0= 8S `\ Q=0=`0/ @ |0r P  PP TP(48R#x 3  p0S  HTy 0S :Q ;@ :0|  u 'q0 0  -g?0$0#sp0X t x t0 AR ` r0S hP n *SjR 0X0 e2S tP a S^R=0=X+@K (0 PM0S dP I RFSD0lSl >7 h` x t ` | p l h d X 8hQ >Nd R >/00v8Sf8Sct0XS (1 R? 76788X t 30' Q 0 Q'5IlPP  L L PP5 L KDP00dPH00@  <008 < [0 L K9Ph@ 767{y<-\" ڰ\ \ \0\ P\ \ =0=\h0 ]0 -LMpW( E`(K(0S'  Q 0 + 0@`W0(PU ,@P+  PfjU++1P (0S 000C `b 0+@P  *P s+(o+(m+i++c+ -L M7P`p |2S V P 0R 0(@K)K l0R =0=6+L0 0@P0@  -ꈎy< -LM` 0PSp :@00S +@+L+t+d/PP|=0|=#2K 01R0S= 0F0f8#8 $#$"K(  00 PP  {$K2K  ,K  2K2K  z,K v2K  p,K l0SFKW(ꪪ 0-@L0P*000h胏 -LM`p!28#8N8 ,0 @P0M(K2< 0Q 0, S PU @0 0@0@q*`00 S0 00#  P00  P4 U 8'"* 000 @4``@lO@TlO @BPl$5*$o, 0L @*# `( -LM` @PU$  pP! 0 %a+88Pp@]d 80X  `P@Y< r40$Km8S $Ky<0z<>+o< -L M`pP00  PUX=0X= W 4P  ߵ(Ko)@T=0T=q Z,  0UX=5P!02X=5d:0S  R ,0S000Z 8S 1R#28#0"=00 ,0.  0S`=0`= 8S 00 0 08 ,0Z g Z7 Z)Rd=0d=$8 S@d 2 Y TTd Tb 6m4P  p1@ 00\(KoW)0 0@W0@r(K8SkRd=0d=f8S ' P\=0\=Z6  0Y7 6 t1 00@0 0< p=0p=@=0=<7 0@6TPT=0=/00@(  pP 00000@t=0t=  pPx=0x= 4P   0(Ko aPh=0h=  0-P@L !t 'p0:0; fB0 [0C\`%#53c0t0d >u & 60 0&(0 l (p08t (780bd -@PL`! p<' 8:0 0;.pp0 0\4[BC!XR\8-S0T 3535t0c0u >d 0 6 0&06(l 8p0(t 87 |x 0 0|00|00|00|00|00|00|0P00088S000bd ->LMQp %x>Q @l>QJ `>Q X>Q P>Q75P0 00,.hb@Pd 00 Pu=Q /=Q ^=Qf =QW =Q^=hCPP^80 CV=Qr s=QH 0Q 0CQC. 0APAD=QR @8=Q 0=Q (=Q.<hPP.=P P|1 'R!v 1?00<888S8S 88<p R 4P<Q <Q |<Q  0P(KP<QP H<QD @<Q;hҡPP!<  R 79 7 ;4P7;Q ;Q ;Q7P900;Q ;Qh ;QI@K! F8S8" HKI0K! LPH; @RPpP:h凡PP7@ 208S:4P*P  yP7n<000H=@00 `p0S :h]PPx0SS0P021Cc PPgpW@`P`7 :0 0>00> 000>00>000>000>000?S S S S00 0?00?000?0P0! P7P#500(008S.8' ;PPP1@P 0S`АK000@P 0S:   `PP℠F 7@2 8P㳀ᴁ+lPd7h尠PP6A0AS2P'8 ' S' w d`7~ 20CH'P6h删PPIK! PPI0[ S"M@ I [(HK4PT6hlPP7 0S7 <4P7{ 6hZPPu174P207k5hJPPe0S 757 4PX5h7PPR7 n 0S764P7F7P2#>1@ 5hPP:@x EP7;7v8S7 * 8' 4P4P!4hPPǘ 7 0S774P4P778S78S<P,4hPP@ P PA 0 3hʟPPPP7K  P88p8HK:0; I0K JP757 @4P7;7 P00CSN@` R0 0S- Rʉ" Q 0e! c.Q 0S00000 e`00 PPy |PPrY`@ 7 B<4P7H-e^00>0^>>0>S0>0 .0.. .0 .0 .R0> 0S S S S >0?0?0?00?0?0?00??S 0?74P67 FP0Q 88p Q4P n7 ;4P7ii 6i(i8ii4DYpi i8iiiy<0`8T T0ΠL(P8H H0T(X8 80QH( ,0h(0 0Q0,,X,+i@88(s0\ 8S80\  0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S!!  p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-`HLPT ! nP@@T0 -@rL  ~8Ȕ\ 0p Rn>0p0 -PL@ p[` \[ aV @[0S  V[00[0 m= a0=[@ -@L`Pp8@P @Ph^ -LPp`@P p0S  0S 3 #0S R@E:0S  p-@PL! 08Pֆ`6d80d8ph' 0-88LS@P gd80Cd8P0> -HhP0LH8ᭆ@PW@ Xpd(h8R0V 0`S=W0=@ m -d(h8LR@Ld(h8R p-L@`PP=0=  8 ''88p p p p-L@`PP=0=  fp -L`Cpg@PU@ )8PScU@h腅 -LpP#` @@D@wT8S hoD 0-LP@P 40p0000\0d 8H 0n> -pLP@  ѕ0p1 p-@L^`P38Q php 0-@PL$ 0p1pP 0h0 -L@ h藕 ѕ 0-8H.0L000000.0P  7 00000S /000000001'  < ` 00000000 P  R 0<0 p-L`pPp1 GT@(1@$R@ p0R@'l10@S: :  (@R :0R@ @ 2$ .0.0@@ @@$@@0SS S S@@/0< @@ 0 S@@7   P@@p @@@@ 0' P @";P@ -88n^p`LpP`Vo`1*GT@ 7 0  88p Rh|Q*Gw88* p`d -6LP 7! 87S707@PpDS(=V@ 8`S #PW 0RVp@W&  8T8Hp;0z7& 0108 d7 ~ ⡻07P'0S 707hU~0C7 ₻>>> 0-LP@ =&0= T0T  L8-/ (0(,0 $0W0h 0>>> -8LQ@ P088; h -`8 LSR R R 0S8X  p߃@iP3U ԃ000+\ 00S,,,$,$,0S00DPP8X X\ '8[[ 08h2S   y< -8LS8H㐃00000@Qʐ0P 0F.RP P PP 0F.R 0F.R 0F.Ry< R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ p0   ;8#("40 .0 0.0C 0 -(L"HP  0 0 K -(L"HP  0 0 K -LhHPP&$x 0 $L&  p@帀 p-8L`#X{@P   ;0 B 0P p -(Lp"haPP @  K0 B  0`   0-20P0 @P@D@L 0 0-0P0@PT@#@L 0 0-0@0@ LP0 -LMSPp" +@Kp z0 0  q00CS ,,,,,,,,,,,,,,,.@K W00P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pa7 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  00`P  08  #hP00P00P{ ? S0C0P m0 0R  P 08  #hPw 00 (P"hiyL> -"0L@M+pK0`P 8 00  0d0C0y< 0-00@0PL00C0d0C00 p-@ TL`PP T000p+1phDl> p-0L` P@P 00 P  0#40 b p R  R -L[ R7p p\L@`:U 0<Q 1 PP^H 0 D ;0\ 1 #      pP0 7P I7d;8# 40 Z 0 #40B : ;[PC1[0S470 !7 00c0 00  0  4d0  qp0  08#8 ' l p-L@pP+?0`(0\ࠓL ;0\    @P "(0 S00c0 0p  -LMpQ`j PX P = @pPP`0!P21   ; 7' 37  VV80; 0@006@0!0 P7SL@10P'0 6'H$K PR 0"Amp`pPX0 80H V 6 $0 @ by<0z<>> -@LAAPP`p #2 P 0iSS0S 0  7  0S h 0h蝺 -LM@` P 0iSS' 0 SD@P=0= 6K   P=0= 7 |2S2"[R>0> >00Skh+,@+,h+,@+,08'8 @ PU0pU  ppp[ B @P=0= @ P0R0p&1 "!8SY X 0@0(K1  "[1R P< @ <0`!0!(<S1 08#(<0!w00021  p9PP 08Pp8X~000~US8 =0=10' 0K     $0  0@00ꈎbd> -LMpQP@`z ~000}T_ T: T" TI =@0=L T @T T mP `0 0@PV|hF( 0NP `P= @0=("(RP 6 !ζ0 8G`F((8"(#8NP 8S `("(P 6 !⬶0 8%`> >> -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,\1 S@ *D  L [PL @ >0 > @>0>(KX1S:D L P< D L,  04Sa b04S 0<4.J@21C! c@0.H 0 4 H@ HD0 0@808L08F E0@$@<A`D0@P#D pC < <P`B0@<@!(#Lp4 H0(, (@0c, L @D4 |P8 L<0 T  0@,8H`P 0@ pDP0  ` p 0@#D <8 P`0@8@!(#Lp4D0 X\!@6@D4 (Ko<D@ 0`@ d?D!⓵@0@8 00D |"@L +L>L> -LHMp P` 0@Tp P lHPpT0KP` 0@D0p P`0`@\0 X@ \PK` 0@L L#D<P`0@ H#HL@8$p!,\1SpH K*L` 2PL 048#8 D0 B L hP<a b0cP4epX4:d d0X4 %8 % *,0PpX1: 0X-:0SR+@K  wP0S8P  S4L4 4 HP>0>(KHp >0 >X1S:8Q L f800  0R8PH`@@21C! c` < `pHL08008F E0@$@`D0@ApPLC #Dp<P`B0@(!(D#Lp4 `0(0@HHP8`0 %HL< |P@ 4pWd 0S 00L H0`H d0 $("H0D8S21Cqpc  HHL084~  P` 0@$hP d` @@`Ph0K 0@@@#D<P`  @  0@@@!( #L4P` @ D(H`4pHL |PD 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L0 X\!H@6 HL@ -L|HLP!׳$ 80My<>L> -LM`1S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp%*(9  (K@B P0:̓! PKJ? Ph p@jP  @ >0 > >0>X1S:@ 48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K  P0SP  S@7 P Q R 0S{ P  1S `@o pQ  0R  00 0 ` dX  WP^ P KP L0S  @0S4[SD ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1& 匲 ş8 0 *PPI   04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O 21q刁x1PQ   |P3#  `VU  0R@@21C! c  H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(D#Lp4 0(@HP` w  |Pe\[ 0S^0 $("H0D8SU21Cqpc>0 0 H080`  P` 0@$P ` @P`0KP 0@L#D<P`  0@(!(D #L4P` @ D(`~  |P@ 000  0 |  P .@K t P0S0SP @@T@T@ PP Ay<>L>y< -L`Mt `1Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L\!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K x QP0S0PpY`*X 0S (Kt 0SS<X  ptP t0Jo Nt!p0:M0>X1S:t@pJo |p $80 y<>L> -P0o0@0@L0pP 0 0@0@i80bS 0bSA0S>0>0SD S>  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS"R 0Q1 !  /   <cGP=0=0S0S1S 0SR   0S  c#P   2} p-@ TL`PP T0 00p+ 1phB> -`LP pP `K @1 08! 40  00S00 00$(SS"(08#(,"4 0 0  C Cq0CB#4Ac Ba0b 2@vQ W<`P"/00@ 0@0 #v1S 0S08#(08#(!1R -7`101 @10`!`R\q@p10`q! !Hꈎ M-LM0, 8 #X40 0@ CP( Z c @ ;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@&,( ?$Kk"400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!⽮8 7 $K> -LM` pPL Pc _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 6 ?$Km!q \80P 0#40  002<8#(#< $K>> -LMP xpP> `c ._1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0& ? Ki`! @804 K@40>> -LMP`Q<  pP; @c 0 0  x: s0cS  ` d 6 0$Km!ĭP8 0@: `?@40 $K>>D D0D 0< 0`"n0 0C@(8 0d"\2 D* D,,X,+Q778877p2 S-L 0-7p@6l 700\0 PQ L0S 7  77707770rt8S 27 8o S00Ro0墥 - L@ RL' P'  770C0C77  10LP RZ 10P  R' '  770C0C77 RZ -L M4  @8s4pB4 ? 00 [`p, ZRi Vf P\X00@  X0T @ V 40@( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h 8\S7 V 6 88S808=0==0=^ 08X  d8Ȑ00008(|88`8]/> p- Q` `VLP0 0C0^S@0 0C0^S@TtT`PP\UDphV 8V@@$Tp@D>>H>PE? -LMX`U@p8 TC$Z,Z,DZ,dZ, Y,U U:([0R6+ (d4R'\D@ 08HY8:;8p0\@T4@0 F7$ 3097 0|8H0ESx[,x[,4\,[,0ESP\,\,\,@\,U U 0`7D07 !& ('"p [ >  U\,(],\,\,t\,w 8SA0C0 0`8S0C0 0`0 |8 RL' P'  770C0C771  10LP RZ 10P/  R' '  770C0C77 wWF Wr00 0`i6C8!P808E RZ0 0`GWE00 0`<79 00@ `1(000 `08"8'Ӫ8 <M44>>>z>>>>>>>TiL>x>DzEN-E8 BS(00"S: 2 1C00 2 1C00 -LTM,šP p0 $#$("()80CS (K 0p 0K l0 ,Kl P 0QJ 0 R<0@\ -0\ h0 <@ X@ vP 0X R ,PRE X 0@(R@@"0 (P` E `VB 0PU?  R40Z P@K,K 0xh4Pҧ8P8 0,Q 0 R<0@\P 0 R@P@K,K 0Mh娧 0X000 IHTq0PX R (˴ 0Pd @40l Rl0S\Ph 0h0 lp 0Kl 0,0 >K \ 8K3 3K0? K@0K@ K 0C@1h PYP@K,K 0 h,PR0ht0 P d h20Sl40Zy P@K,K 0h4P08P8 0C0t0 T t0  hT X0  !0O0@T0X@d00d0`0 T0R0S$` 0@ 0@`0T0dQd0 U B00C0 0 @` 0T00C0d.P=40x TPh lh\ hQP@K,K 0lhǦ80 P@K ,K0\h左 08L@ 0T T0X@>>Ti> @>iPi}n>|>0 $!$("( BRPx- ^ 04"48S h0 000^: 04"48#8 S  S -L%P" 0S @ 04"48S0 000Q: 04"48#8 S  S /DP P | Pĺi p-L@mp0``0P 0PT0 <0R UphlQ긺i}nPi -L(M`!P p,P @,  0^ 0 P000  00(KQ (0,K PP,Pd0 7 0< K~ P` g x0PP,P ) U# 0\\00S( < K0U0"P<P< K0C P< K06t T L H0  a L HD @0 ^ZV 6$@cP^2 R? BPW0 S 00C0M 000,T X0 / d00d0 RX ,P|T0SC T0X@h1 P >, Ld00d0,/T00@ T0X@ 00C0 yP#P7L0S0SP 0 P' 00C0 \PX0S#P,08  =#P ,P>Til>d<>D>Pi}n(Aii -L M(ßP^`0}nPi,Vjp, >p<}n}n }n}nzn> p-L MQ@P` KpP * 0< @`^$ 0$PKphi}n -LMp@ `P< 0 0    0; 0T0@0 0@P0C 0@P00P0 0C 0 P0p 0,KrK&K%PKPP# 00 0 KonHVj}n -@LT @T 0 R(0SC \\0 ( $0S,0 Q 0$0 @TA}n -LjP0 R R 0S00S000 RhjDVj p-TPL0Spj80 @`T  @Tphi}ni p-L@ᵕPj$0`0CS04S U 6,0 R  .phiD P  P 0S 0 08OzDVj 0-pP@LP 0S0S P8 uzP 0@0 00DVj p-`LPQ 6S0&R Q8 Qz@P F0  @,@p,0Sp@pDVj p-PL/@j0 4S`$  T 6@ 0(0ph[ip  @$@2: 0(@}n l0l -@@L@AL0P k00 t0@ @@ 0h}nDVjHVj>< --LM0`0 , 0,P@ՔP 04%4PdU)ڲ1 0S*`P000 0p0d 0 PT 0d0 00SQ S Sa %(K000000& 0SF0RC 0S QQ 0 R(0 0P P 0 R 0RP ( 000$ R02& 0$0000000& 0S0Ry 000 0R0 0&@TB 00S81`"0PAqpU PU 0 R4S  2R Q$00CŜ,؂,؂,,؂,oi(0S@$@0 91(@00$0000XR 0 pP0 0 H1R@T@ @T= 0 R(0S0P4S2 $Pd90(P 0S QQ 0 R(0 0P P 0 R 0RP ( 000$0S :S0$0,0 R:}ngfff}n0S S  P0 0 BQ0S 0`000 RP0S1 Q 0-L M0@0CS0 K0VPP 0  0 $ K#K4 KHL-h R000 0 0 ~g60 x2i -L M`PQ Q 0 R 0@RQ000L1S@K06 xpP  0 00000,K< KhLP@g0S 0  0 00 0p`,g60 w@1i -0@L 夳L0S h蛳@ 㖳6H -8L @PL0S h@  0- @PL;hP 60h00 00h 0-PLP T @0S,㋕T00 -LMSPpQ 8@<`KL1SV  PPGᙒή,0S 0,0 0 Sl14,0,0,0\0 0(0Xt0$06("8 ,4$R3 ( 00L06("8 " R.UY(KI0SHu6P(ḵ^OsPK6P(0L06("8 h0S0(K0 h i  0-@LPT00!R00P    a -L@0\\ x0P6 QQ 0 R<0T L0Ti!Q Ƞ Q:8 10: 00* 0~n -@HLP 0H0 -L\@P` 0S s 00S" P60  00@0 ` YP 40S 8P <001R pP x@助TPP 0 Rd0 0R 80040S 0-@HLP d0P 0%HP$ H@0 Q Q H00S 0S$0S(0S X0 Q0P  PL 㧫H0( R P0QP0 L 噫H p-@P` PL 00P30800p -LHMH@PT `\pKH`@ d0P ,0 X 00T0  P 40d @ d0ᷪKr 0 p-L@` 0 \ @P P 00P30(00pph] -@@00L wHPㄪl0 $ Zېb R 0 0 0 R000  R 0000 0  ,00C,01bh,n p-@``LP  0<P  $04P  ,`bph1>> -<L48M,4pLPK`@!<%K 0 嶈 0K`P0K @ @ڈ$001K -(LM"(0 `0p8@ #, 4P @T 08 40 @TL "U3SE l0  ,0S00S` 0S0S0S 0Sf , CP0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  Pe30 Sa8@ 0S -LP(K  0`n@PT@T l0  3S3S, P0S 0S$0S(0S˦Z0S R000 R 0@@P8p -LM(@ ȠP"h,ᩦ  0@pT+@T( l0   P3S3S,  P傦Z0S R000 R 0@@p(K -L -L MA`^PY  @P7E  |1 P@` h0@! k] pQ5 R000 0@#P0S0 0 0@ 8 3 ( 0S00@@\@ 0 Q<l0K, 00#R , 40 +00inDYpd> -L@Qp `V ̢@TŢX@0S 0S@U l0P (0V -LM@,pK0P`D P@P00P0#S Kx> -PL\M| 0 P (KHK 30/ 00a!(K 0c1\ p q@@ R 1S q w Tp Rq w Ypw Ypv KvK` 0S WW `V00P0#S w WV3 @T*:0V0. Pd0!1*PU`V00P0#Sw 0S1 0S* 0aR }:vK ||x |Gs@WY Y4 h0R  d6P`  RY*:00 RR*200p? -LMP` \\! \ (KQ p04"48#8g00S03#!4@K,0   \ 08#8,#0@ 4KK.K-K@P A7, 0 @xP( K2#0P ,@ 0 @9 ("(04"40x> p-PPL` d00S p[$@KphZa> -LM@PP& d00S \00`0K ,`Kr[$p+P 21C0@ 10\ $ 0 Z0ni> -0L p3iHiLVj -LXM8K@p 0 70K8K4@ gPP* d0``V)x@K @ t 08 (0Kp H pP(LLᙢ(PH0 <P$KዢPᇢ P i|, 0-PL@P9 04$48# `04"48# Q\00AQ\40 p0 0QS\ JQ :40p Q`0Q:S`0hG0\0\0茄< -0LP 0$iLi -QL M@`Pp@ $KZ0S S *@$ Y` `봀@P" PUP0S@|N @/@\ 04p@PD$iLin(i -L MKdKH 0*Ϡ< A$0/@#b  8#" KQMb 0-L M@0 01@0̌P@@@K0 -LMP0 @`P 0S AGT(pT 0!0<@BT0 0p2Z p- pPr 0`S PS U0S S@  U@UT# DSSPd`     h1Z<1 p(KQ 0 0 Q R8K )0 7 K80K0  40 ֡ P d0& 8@%T 0 7 K80K 0  40 忡Px T00T0AApP  0 0L0 0@L0P@8@b8n -PUh#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S " 00 0  P| 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑf(0 (0 0b0(Ua!0U00P0 U00 UX: 00 01D 0NS@: 0, 0N, 000Q 000A ("(04"400  0>0>00>0 l 000U0S 0("(04"40+r!Aa _n>> -LM@P  XP h; --LXM` 0@,0 ,P倃pP 04"48#HeT 0$T$Q*`PE  0P %000(K%0000(S(1 0  PAQ, ,,d,d,H,d,d,,,,,d,d,d,,$5 R 5 R1  000$0004 R T000UPڴ000UPʲ1#T0 0T R 00S 0)SCT00T000 4 R1 0010000K 0 00Pv0rp4p 13 Rg x3 Rc U#T  10TRTK d@K tPK   0 PKS0KTKs0Kc0KtKdK孼 `K⩼  pK⥼40K0P(  0匤4P |2 R# UUhPmUc,,,,x,,p,h,h,p,h,p,h,h,h,h, PXPVPTPR1 (0W4PIT600 d|aD@K 㣽0 C0KD K0s S@0  0@0 ᜈP 00\  0SA 063 LP0  07`P000  001D@K l0 D KC0K0|@0  21C0d 10\ 0(  L0 0niii ii$iLi ,ni p- LM@T`@PK0`0P@^' 0T PPd@PK%![0(( b!("( 0P0 xXVj\VjPi -L$MP@` p9l0+@   0 K0 # 0  K0 Pl0l0`,倁@P9 P  0Pl0l0`0 Pl0l0`D@K_  0P`DpK ᷼0 D0KC K 0 K=K>K?KDpK ᡼0 D0KC K -L MQ` 0SP  K ŸA0`dP 0B!S#`,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,,,,0,,h,0,0,,(,(,0,(,(,-P&R 0 P`wPU 1 RP÷ x 0 Ki< X 0P Ki 4 0$A 0 @%`PV, @0S0初p 0 p뼀P0S~ U@{Tu  0x0   KiHp0Sb qU@ `TYPii/ninniiiTn8n p-d@`LPP 0S ܜ000 0`{P 8pn -LFM10 4! l@pePa 0S$S(EZ  0R\ ᭜`0 00 0KP JK ዻn$>hninܼiin~nn4>nTn@>ii(> p-LM@0  Q0e `F PK  0S S S! S Kp !K 0S08# 0S  0KR08# 0S0![ 08# -LM"1P0S; `02K00q 04 @"48g#8!,# $8#$$. ,8#8!8S hl0@ 00l0Ol0@0 0l0IDYp! -P p04 48`G#8SLB*0S010D fP9*`@P2 ! 00 A0p! P p  㡭P@ ⛭p 04"408#8 $#$  0 0  0 ㇭pon -LMP< 0p01 cX80 ((K 804"48#8P, @4 0 [0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P ,<0 S04"40 <0 P0S? !x000x0X4H00H04 04"48#8S+@`PJ 1`80 @@S00!1,(01(/0 @10 0 0|202, c,8#8 $#$<0 S  <0 PP 8x00x0>\ <00<0 00pW7/ <00<0202%8non -QL0M` P0 L H  , K,0H0 PP 001H0 0< 0SbVD KX  pPTp d0 0Q (0R Ž000 0 00(  0S q P `4YL0p 0@L0P@ 8d00p Q<0 0f Qd r 0s V  0S  d0 61P P0  P 0p $#$("Q(P3:1<1VDKX _ pPTp d0 0Q (0R _000 0 00(  0S q P `4YL0p 0@L0P@ 8d00p 0S  <0 0Qr<!u 0\10000Z ! j  6h 0S QQ 0 R<0 0TpQ Q 0 R 0RQ  R 0S  T _0S 6f @DK3PX L@X0S (KDP ҍ0 0@0@ 0 wH0L! 4  4 D0 80080!<6S#3PT00T0 RY 8qPU pQQ 0 R[0S #qP pQQ 0 R1<1P0V0 0S \00@00 ] 04"48#Y: 0 P0So !Hx00x0? 0@@s0@0@S R d0 \0p`0S`D!(PL00L0Y ߍP!APT00T0L  DPPL@ EX, @0@@U" 0TP  0 D@K D`KX@ D@K D`KX@ , 妍PIT @D00D02028n p-RL@ P` Pq@p@pkS dS4S 0 PphmSnS(D1RP5 0 0 0PP@ 0S60 Rl0l000l0l0P@ @3T/ -@ k0 0 l00@0PP 0S@0 S [@ @@ " --LM0 0 P@l0 p`-00S,* @P7( q0y0 ` x("(04"408 P  p0(0 0H D PAQ#(KQ`0P 0S 04"48#8QS0S , "\00\004 408nn --LM@2pP( ,2U o PUE @0 l0l!@(Ty R 0S8 RO( R 0RX"  !02@P l t10S@0  (K 0@P0 (0PC(0(0 PUX" l 00S@0   (K 0|@P (0P @U$K z(x0R 0S 0 k@004  B4 0 _@3nȾiʚ;8n - QL`P0@* 0t03Q0SQqH---8--8---8---@--8-8-4-H-8-p.0^ Tr p i 0`S0SM 1p3pTa0 p V+pCd1@` pPDpPE B08 V8p( popp 0S0S/p0(0p-p-.p9p0  0S s luP 0p80V 0 ,B0y`zؾiܾin`>T>H> -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/0|Q Q V# 01V 4 #tf4< (꬐on@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20oBN|1S(  S < t0b? S  Q-L Q  nPp0' ( C|0R!P;  2 0Sp0S < @40R!pS*< @S:< @i -LMY0PS S, /(K 0, 40 0 (0*0S`` @ @pP7 @D 08 # R+1 7( 0<, 40 0 0` ,`0(0 rYP Pm``  |00%(@ 72 <(4"4!<0 <(4"4!<,0 0 0D ("(04"4 0 :#40* 00S  <4("4!<0: l2h"0T0 <(4"4!<0P <4("4!<0Y RV R, 0b8#8#!<80 #80!010bKY 0S|RG R, 0b8#8 $#$(0"0"(`0!0 Y R= R/40Q4L 4  0z \0@0x 0 0 % 71T,0 c("(04"4 0!Y ^40h0q  x0 0 Y Y D 0S;04 on iii -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 <( 4"4!<0 ץ <(4"4!<0 0 6S-t0o 0-PLP P _0 0@ 勂0h̓T&- -: 0RL: 000 0Q000 H0"!B 00C0ᓃ4 00C0H0"!B  ꔕoo -LM@`Pp?0$ K@P < 4("4!<S >* :S0:>>(0@P pt!o -LM@`PU?p0$ K@P 0 0bS>z>(0@ZP hl!Vo -`L/?dQpU @^ETP0d1hy> -Lp?:: S 01 Q:1@VP X\!4iT> P>`0@1A : 08#8:AQ00Q000@ H 0?0ӂi(>@ ᅁio,iA$*- -LM0`S Y0S{ S0L0X0@"2  ! 1L0圢L0"HAB>xrx2, P Rj`"0Q< L2* ! BR0 0R000@b "0?0qd1@0Sd!00da0㼀0  0,`1R01 HL!`o=d!> 0H@P`1dA@0 rYX 7P@800# L w0t0j^/  @0x!|1L3@| ˀ 21CU @ 40P!@ TU@괐oooio$i i,iAo$*- -LM@PD X qK! P0`1 d ` f! X-0S%  0 , KYPP> cb? 0@X1A Pp0P0rPd @0 0@0d (Ko1|2H 2R(K  P! 0 0$ 0 P 0 pP X 姢 t⣢0 Z 娀0\0j  1=Y 0a aS0SD0Dp0P0P!= SF `0`S) 000  ! @P ~d @0 0@0d U0@P !~0,Ch0q [0 20   0 p0R0P000:0:W TP!S Xv Qo ioi -bLP|p@GP |4Q- Q(+ WP2ųpH20S S03T@!t@T@@3b/  R8 @D#h.8`#hw1 10S> S A !0S01S 1 g`P \ 67Q1 QL  Q3 0n Cw@ Qp0/ 0nC0@P10%Tt h1l1 S 1% A5g0 R0! S 1 !g0 R p00n C PN.n2 2:20Sp pS:0S0 Q020Sp  p S:0S R00n Ci2i9i -|0GL`@pP PU:Ezh0R1KXP @l00PR1h<$@꠲i -LMpP< @0, K`P 0 0R X; (K 0aS0BD 0a0bS#F; P @l0l <0 l0w0w000030S S, 0S H 000 0PP 0 0 ܠP Po D@D0t t 0S "2S1 `0 R!t0:t0=t0Px T0prX1P hRT!00 001006<2 4!0$"?08x000v:Sn: S7 100! 00&?0YD R1 0cS!`> 0@P1TA`C8P V 0(@0 @ Y 'E0@P !0 80P00Aj:H Cl0 PM 73 oAoii A-L@J 0\:@T 0c 0bS R@TL孧0D L1M0L1  l B 00C 0x> -6| 8SLP@p@T  0S m0 ( V%  0@S1 `0V 00000 U | R l0  HPP t04t0t04t0Po -LM`0 ʜP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@ 办M0K00e0     0/8 4 0 W  1QS P R0000 0$ [Up 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!00007 0a1 0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s  R0000 0  0R Poo --LMx00 4 x0KH 1 0#2S S  (K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,0=C@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R R > 0P0"!U00X UJ 101t=t pvP P ,`,``,` 0   (0 d w  80KP 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% S:Y PPE UP  @@ R 0S PP M ;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,0@ 0@\K d@Kc0K]0xK @KK0KS@GK0 ^  ^ ( =d  90 0 RR020J@TH \ :@T 0Rb @#3Rm101^ |0@  |1S S9A ,@@x0 00(P 0PU R 0S:D R \ 0`@ P1#  @ 0 0\41ʴ@T H0K0(  0 PHQ @P PȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^0, 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P Uf@t00t0 P @ 00cS10cSo U = @ 0(4PdKKQ Q{ 1 0 1 % 0 ?008z70S @0dP`XPP0S3HQ D T10bS00dS'ڨ@199000 0K  V101 00cS10cS0O0@0@e|,``e ,` H0S DT10cS`!0bSOڤPL  `1R 0R 0RM6 S=&02 '24 = #P 00 0; 3  80K-Pm 8@ 0R0% *d @Pt0PP t,0O0@0@t0@ 0@d0Kc K ` 0KKK0|0 K 1 AQ T!D00bSJ0 @PR00U0S% ^0S9Q `10cS$!0\1D T!,0S0 P 00cS0`S 1S:6S{ dP`XP (`PU (,Poioi oPPiȋoioii,ooA8ooiH?i$oVu U 00lSAy00[Y 6S7 1Ũ@t0 @UAt@8 0 0bS3000 0 ? 08.y@t0`0`SS1R!P1Q!_81S 8 cD 1'0 1,0@S>@0L0  ZA  P 6 Sʠ@"P00SPQ,` VP_Y 8C(RS R ʠ0@t 000t8C80CS@HU-T-8U-T-T-T-\T- 0bS R 0bSQ0Q,0S 0 0R@P0U000H0^0 Hጅ t0Ńtx3@P3CxP0 |1S S @ ,A4I4t 0S  &0P,43C_xbP 0 ( 0 \ 0 00g4 qPJ F0 00cS@,` ,`@68C( R?0@S0S  <,0K  t0t.6S$  Sʨ0lSڨ%6S$! 1S !10cS000Ű`l/H0 P  @0Sg08\ @ <10cS\l 1RL 40&@0?0w A$1T&P1#0Q  !S | R l0  HPax@ V0bW@< 0Ot 0p!0bStŨh1Vha 0 0bS 60CShY-8Y- Y-R-X-8P3CcwnT s kT P p8P3CMwP T 0  G(0 ?0 P8w0 @F o S O 0P,dKK 0PP ` p 0DPZ cdKK 0 &@t0t00006@C a f00 cR 0ITT10P\1000 064*@0<*?08vt0`0`S 00C0@dd _@P`@P,`  P @,A :6[\!00bSTL,/0  P: P  㐗P101P dKHKK 0@Pp,]S1Po 0@ j,`VD  0R H1 0c0cS000f0 0SY 00cS P00C0b0SH00@00L10L1,`8#PC 0 ?0 6,`8S1R!P1Q!P1 H Q f URt d= R X 1v0t@=u@@,0@@,|/0 \ @ | | R l0  HPv0  RPt0ăt#t0t@0f0P 0R0S:dPX`P0n aS0 R30P000 @@,0|O0@\0@| | R l0  HPQvt d? R ]X 1M@?tyuP0 @H0S @0S ,!S0bL%S:, (10(1  y0P@t0ătt 40St r 0S @T|*Pf y t0ăt0tt,H\P ,D\6 t t0H 0R0 @0Sr8\   <10cSl4 0Pc/00 S | R l0  HPu@t 0p!0bStŨh1UhQN0 1R& P40"0?0t < 0  t0ătt0t0Sc t0_N@tHŸc W ,A(A80t 8,[P? ,[6: @ttett0Ńt!c 0t00 f  @T!608#868C8S ڨ  1'0 1}cm Pp t@ P@GP0 GP!|P$1Pt8a0'0 !@\0 0@\0`@@I$!0, 0cS P$Aioi -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / s&8 S0Һ6 尜B,iA> -L`Mt |0`U@t tPhUtPf <-400`S:70 10 0h0 2t0VtPr 0\ P1P!R,nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d X@d` P0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q QL; 0b` R0a0aSTt 00aS  0Q ^ 040@ t sx ^hhX|Uyr40 @ Voj p aX pʃd XXp H r0 S X RT0!0bS'0ODH0@t)H0L@DpP PIX00S+1 0X0 0PX0X0x 00 0x 0S0 (p  (t00t0OpP pHX00S 0X0 0X0 0,0 x0S 噓x0 P @B t0 1R B X40 <(4"4!<0p <4("4!<\07 X0`#P7P` 1Q!0\ a7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڼ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ jt tQ6l1l\l@0\0@0tP 00 0tPP  10cS0P`!tPdQT 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  4TK 0T| p ,hd00d0Tğh00h0t0Vh tP    Ut0 PtP 1 0cS 81!S3 <8!0000@ 0R #0?0Lq40X?0S< 09406320P(0C8#,("(#80 0@l 0|8|H 0@et C0 p TK4p 0#10 " 0t0pIx 0PT7 t 1@0S0KT@K 04 4TK(K 0`@=tP & T"R1p < 4("4!$o0R1\R!0  Q 0-LEM|0@r Q 0S- J_K  oK -|> -|< -|1S# |8 -|( -XK/X0T :0X!K0\[L.0DH -00|, -| -oo oo p-LD@P`QP00T00S d0php -D@LPp6T Pg d0 \0 00h0W0P 7S -@ML0  0 @ @x&Kw-<Ĕo>Po(id d0S=0T 0S00D 0S=00S( (0?0c08o$o(o4oAgfff -L!'4@440 (0!nj hm& oi(o,o 0-@L't0P6 S `0P T 400aS 0hM&, ,0 ?0Pj,oiA(o p-L M@&t0`V% 40040&(BP1 R|0@  0 ?08jKph&<00<<0Kph &Pʄ0^x0l 40`0Q*80 080x0LPP\ 0o0oA8o,oi(o -@L&t0p0 h%,00,0&= R P0` d0r00r0p04h0a P * 8(C89H C1S01P:000<00oBi4o`i 0-@L:&t0P0t0]0h% -L0M`(&t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C=Z% Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0i2 R$ |@T! 6Sں6Q@0 R P d0 \0 |1S (nPP \0Q 9m6Qʰ0 G P!P 8QPV$1 AD10D1|?-0100tD [5t0K^?0 4KDK(0LK40 0@Kz㔊|0 00K/ K(0T,0 (0DL$_0\0IoNB,iAizw- 0-L MQ@P K00S S *0 `@PvR^D 40PK0hQ$ 0PK0h{Qؿilon -LMPYp00 *R5 0S` 0(K(`0S/`0S1` (0S8`@ 8H0,K@值`P3S l1@h!u`V(0S9` 80,0  cPP7` @ ᆅ08#8 $#$ ,0Z 0(0003311 (0"(104xq"40p0 R2H 02,00,0(@0 0 P`4`DYplo̿i -LM Q@p`"  , P0u03T0S#TP4-0--X--X-̧--Ȩ-ب-(-ħ--Ȩ-X--`-X-X-X-X-X- 0 Q  0(Ko(@,> [ YѼ@  0(Ko"-@l0L h@l0  0S 0S$0S(0Sa 8@(匌l0 n 0S 0S$0S(0SL ,|0@00U1 @P@Pl0 11  w x l0L0 3@{@,-@l0 $   0Ṃ@,,@l0 -  @r9@p'@Tjgc  0@(0S 080R(0S|G@ '@D>@<пiԿioii -QLM 0S K0S0S P0@ SAP T \  0 0HP0P @0S   0tiX,oP- -LlM@Qp PU (K`VP0@Sl kPg P 2 R X 0x S 0t0 p z L0KLK0 փKPKL`KDK| |x ,Z 4 0LK{*P2l0 Yg xt 0R:0@K㴃h`K0 xts@`PK⩃0 g0KhK娃x ,- P 0N*PWI ["[pLK l0@p3$l LKL KD0K|0  DKLK0**Px p r DKLK0*P dLKD Kl  | tl pLK l \0TpM[DK"[0(+P4X,iP-o< -@0@L@\@hW --L┩PM000` 000 , 0@#2S S/ i,g(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40KýP[ 4 0R0%p *,bõHK0Y0 0S 0S0s 0SV 0Sl0 ; 0Y0 0cP[U_ U d@K㢂0d0KcPK0 6K)1  T7PU h l0  ,c@()cT< PU @0 Yl0 000b2  (0V0(06  0Ω0S 000G0S 0s@Y> R00d00dSPU_#0RYV ,0S00S40S80S0S< 0S9$0S6(0S3h0S> %0@P7 Y h0l t50Sh @0   h, K@V h0l 450Sh @0   h,K 0Gph0dK@ P,0PE,C 00 00,0 @0   hP \Y (@ p0@PU 0Y,0 l @40S@0   , Ky@V l 40S@0   ,K 0Y l0  ,0S,@K @0S@ )0V l0  ,0S,@K @0S! 0pᅴ@dKP ,0$PK 00 0hh0S Y h0l 20Sh @0   h, K @V h0l 20Sh @0    h,K0pPh0dK@ P,0P h @v6dKE0d0KcPK &K 0`0 , P@a!Y  0&> $0"!0Y$00C ( ||PUD0T00! 000Y: l000 ;(@  0@P#000 րPj#0Rf8 R 0R_( R 0RY( hKPh @HK00l  0 hP Elo>oʚ; -L㼸ꠤo-Q@P P*R 000P4L 0LФoi -LMP)0Kp @H)0[ !#R)K R ϵ (0/0(0(K%aVT 5,  , 彵001S %1S T5,  , 孵0701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  P @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z   048<!$!0!̠ 0)0[p:("#! !4!(0 lp*K 0)0K 5P  )0[R 0 0QT᣷`PJ000 00 0;,?@Фo>iiiPi -\0LP1  0 ($ 00 0 iФo --\0LM R1   00 0 K 00 0iФoG-@0 0P8< 0#40   0 ! 0 8<0# R M` *\\\s\`B0P3P .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V0```r``F0 0! #0 042P .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " VHHHqH  41,!(1 !1! !!, ! !0,0 00 0 P 0.(. .A 1 ! 4 (  0 .,0!$0   !80R0!L`@ O<<<<< -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K<<<<? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kou@, u I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* aom@ m @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \ m(K4i< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LZM@  hKomoOh b4bp   _0!dj i .i ( c `0`  cc,0 " 01 \ \0 (bx  c   q! X a=ii .ଐ cq-T 0 ,' i0i  0̐ 0Pb1 0i(i   , a=! L!aL bq *L c-HL1 . i0i ,0 01 0bq'D  @i i jj! 堐 ጑ 张 吡a=(-༠c <0, cc )b0 8  .0ax  b ,  8 =j|x! 4 pb!Q? `P0`?SpP`0L`@  gog@pb@ g C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1Pf\f K>}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍX< -pRLP' D@A1>0` W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW-:P` gc@1@ T@D 8 `ph PSc@1 0S@DRH0 0@H0L@P:c@1 0S@DRH0 0@H0L@SH0 0@H0L@y -pRL`. D@A1>?0 @c W1:PP c@1@ @D  pj?W@<@pG@ ?W@D @W Pb@1@ @D Pb@1@ @D 0-8PL@ bP d@0@0D@H0L@0< -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM tiUUUU<<<7 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << 2 0h2Хo 0-L M 0ts3pPp0@l 0D@SDPS@ 80@SK0hsS >oХo(>ԥo0> -@PL 40$80Q8QhQԥoo - Lp`O`P W P80U408@ ( O@PPoԥo -@QL^ ppW`&P0S" 1"000 !   \P0@0 0 000ࠠ  @Zii -LM00 SPA 1p`^2 @0S& 0#1 V U 010 R010 R Qt "10010 R @ ^t`VX p(KV ^"100(K @ pP ,P0@`@00 000 ii p-@LPz0` RpQ 0ES"100A1 R U 00  Q 0 S Q pPiQU( 00  Pii -0L0q0SN R\ڈPPU 0S00S  00i.UARl 0`P: @2!  !!Q0"Q"10010  唠 l B`9l 0 z<0P  (PP "Pii -pP0LS`P @VP#:"100 A 0S0C0000SP P0  0S 2Pii -L MpP_ <0S\ |4 8QW 1PS 1 PY`:4 R 0004 R80K cP00K0@#0(04(K1"0 0 0.0S  0@0/00@0 @|0  P p( 80(0p4t P8ii 0-LPL0@S ,0 z0 /O00Хox.Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d OXpqWoWmW jW>t><>X> -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd OW2W0W.W +W>>>> -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0V(VpV VD>p>,>> 0-LxMPP$@KtO| |0 | x p l h T P \ 4 0 ,  L H @ < 8 ( $ K0Vi\...> -X1L PPH0SL a@ TG P. 00 R 0"QPU0ppW!00S PP DNl |P ;N ls lo0@ T0P &N l^ P Nl Tii` -pP00PQ0SL. fQx X0S X"00l  0@P%h 帥P  !cNl @ 1S  RU 1`l DP@I 0BSIt..Ѕ.ȅ.`..|..`.`..`.....`.....x.p.h.`..؅..tP l @P  R0 !P0p@ PU `l P@ 7ssl @0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01S 0\0#0 R0 P0p@ PU[qmq6q410@ Iql I0PM  0R !("( 0p@ qq q q qq;p9p7p00@ pl 0P 0p@ ppp0 000 S077@0ii0i ii<@xi -pL@ 0   RP`0 0` 00{P U000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000< -(0 $ , 08 40< 00D -@Lz E02 -LM,PK` pE ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z CK1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F SV@  Cb0`R1!~ C20VS  21!0#P1z_ +`h@ x -L@M\PK`p@C!C@0\0#0@@T(  CK -@RL@M@P`$p j 01\PK@sC!rC@060#0@@T PBKp\CA -L@M\PK`p@LC\ KC@0\0#0@@T a ]BKT -@RL@M@P`$\p Ev00\PK@C C@060#0@@T +BK\pB@ -L@M\PK`p9@BX B@0\0#0@@TZ  XBK -@RL@M@P`$?Xp 00\PK@B B@060#0@@T$ )BKXpB@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#> -@L  -L@Tp! (0P0(0 iT: ` > eP@hT ` z>@D XTPT  oj> -L0MH@K`pPS 0 }K -L,M H D L0 `^@ LPH  Rr \PLKP 0: SP  @0 @0 0 (KL@1 0P80 0: SPt0D@ 0 ?Sʧ LQ  10P ?HKj@0,P  ?`_UL20 R02 0 P\V L#0S0 P| VD0S0X0S<0 @0 , , 0O00p'T P @<0O ȟ P T K /<@0@Y80 4@ WQ @,0O0 p"XI8WF80< Z @0 L@@0 0t Mt0D 0 ? SEHRB0T R800  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?ῒ0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!<PL0` p2RLH `08?>   c 02L!0<PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0@A|B ?(KLH,0p S0QJ 0H 0 &AAU i<<>(>>> -LM ,  @_ 0ᔑ8  0莑4  ?n0 0႑`, p '@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤy<0PQ`004 P`1`#Z ,V`!@V`YL#20T 0U00 RH3 VH Y@0SJL#2 0T 0U 00 RH3 VtPAZ@0YL20 8@T@!@`02 08PY Y\L 20 80S@@208`@V\Z,(K004`}ꍤ,@pT, PL#2,P \08`V04`V PT PL#^08@T04`V P P  -L\MH< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_8 4 @ 8@`4!4P a, QU.QU10P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP 4 Q 8 <( @@8`04Q SPQ C` 0<0 \3R 2<0@, 0PD0 Z= 0&d ` @娀ȟ 0`@PdK ? |0 | <,,l0 h@  @ 0h@ 彏@ ` 0 F.lKP ȟ0),@@ ?ᣏD 00C0<0, 2R  B ?>0S @3CL#020C2 0>PiU |>>H>~ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?,0 @8\00 P4 'H0O0@8 ?_8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 08PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(KocUJ\ 80 0L>>4> >T@>>d> -L,M D `DL@ pP(K D P4 H 0S 4 0/ @GP00a0 S0`$Q\Q\0/ A 6P  4PR\0/ 6P@ 3 ^\0`ω1/p0@00 ,@ g 0p@WXt);p;P ?0 , @30^\0/ ,0>L0 L1000 R!H \%2R> `2^ 0L1/0 H@040  B ; 0@4D@@L#0 0 Q0C0q 4CV-0D 0 K KʌG0NL@ H 0x < 0Ox0K0@/TʲSt0PpD 0(080  P  oPOP`ʼn<ۉ`0d/ , l1 \00.QP8PP80 `H4x H0R @ṞPx PRLx00x0i   ?> 0@3CL#@000|0\ L10  YD0 0P:;PiU @>>T>> -L$M@ D DPAP(K@D P, H P0 $h0U 0 S 0S P@Q0N 0R P3,02SQ0 @_ 0 <@ 8P {D @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0[T P5:Q800cO  vU80pY,Ì %Pi> -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?݉ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sي 0@ <0 T Z p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD@@ 0 0 R#A4 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004Ҋ0@ d! 400C4000 c! 400C40PiU -LM080 00 @P4 P @ß 07|x7 (Kj  V ,0P* 00 ,0 Y V H#0S0C0ß0 K 0P`p40 8 (00Pl0dp 0 R RPn 0   R P 0P`04 H`6 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @P 0 Q P0S st0P0q 00 ,0 {H#0S00}j ^ l0S sX0l0U0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@娚l 0 0 (0`6 %7\Vl<> >>.`>(>H> -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P 峆  10Ptpx7 K X\\\ (K^4KKx0K P0K Po0@@ 8K0K P4Q@K00(00 0K80`S 2 K Ze㼠 Ÿ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] , P0S[ 0 Z&`pQ d0 ctx> @SPQP#00d0  c6 0SQxd "t 80O`p X_000K n ݋P' 0 S@P0(0SK ,^H K@00,KŋP,0 H0@_0 ^,0E000H00 f0@000 R0.i -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P 呅  10Ptpx7 K X\\\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@:Ÿ0 Pp_ Z1P` OP`0R` R80@P0p0Sp A0S_ , ^0S] 0Z&`pQ d0 ctx> @SPQP#00d0 c6 0SQxd "t 80O`p X[000K n 巊P)  R @P0p0SG ,8D K@00,K埊P,0 H00  Z,00廇00H00 Z(@000 R.i00 R 0d  0S i M-L4M00T S@0,0 0T0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0PV0@0S@TT 0 Ry T1 0ppi @T HT00,K  P@ ,P 0,0 P@(K,0 8 b4ɯP L0 T  0_(P@ H@ ?  @P 0TPD@ /< 8 N T 0 R T0 0 0 @0@T@0\00 H8@d0<s c>rc, StqQP @4T  0(0 ! (pǏSvP@  H@ß 03j3@ {H@<4 Sʳ H RHd <@D4@D_@Ĝ0e.H@ 40`S H00ßD T@Q4 0 T{ T 0 VT@ 0 R T 0 0 @0@T0Q00 H 0@d04# c:: >hVl >|>|.(>L>>> M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d P0@0S@TTD`  0&PP"<4 S<7 0 !@ Q> 0 R5 00@0@000 (K#3 P 0@ 0`21P84S 0 ?8S h00h0P  0p&|.tVl >|> -LEM P 8%@  8?0h1R 0  P4 UR00 0a QUQY00 @PP Pb0b1re R1nQW@Y0f00Y{,K 0KDP P,00C!,0  0PP Ԡ  \Kؠ  pK 000@K@囇P `0 H,1 0Q0 0@0 ,P P+ @0P> Q<   @4K00 @P<40 0+dh.̠00 I4 d0# c4! 0S#Qx d03t04 8H&40< 04 {@TK00\@Kܠ 0܀ @~408H&40 < }4b@ T+. -LM P8%@  =0h1 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@jY0N00YfڜpK4K 0P  04  B4 X`V# 0  L@K0 @ @@ `00,KmP ,0H @4!\@_M R   >@- @\( ^  @ @@LT M-L`Mt t0P  l T l0@t 0T@ T`P0ST` pWDT@  ?Cz\ X lPt`0@p0 DP@ ^p 00$5şhP0`00(80 0@80<@(, p0084 9Q00Kp0tx pz@P t` @  0Spp HH 0@ D D @0 t l 0p l0h H0 "l@\Pt0P@`1D0!lPt0St@ 0 R000@lPt0S(0$ @p|H tpD @  0hSh0 D @ l@T0tP@P` `dP `` dpKOpWdp ` X PoV($ L p0X  ã?  t 0 R D 1ȟ h\  L  H@(K\ UTp@@DP`!1<` 8p 0 40 0 L 0SM 0 0ȟ 0* @TlP`d0FS c8R SCQQdK,K0pt` PHpL,0PpHp L l@ t00LPP`PLP dpK<Kp4 0PJX 0O BPETdp ` 4 0P ʁ\`S~t  0S4t Pu`H` h` Rpy`H` A \ X ppzP| \p00;00dznl0T@d \ l8^ `\ ?VQL,y`dKF0,Kt PkHpL,0PpHp L D@10=)DYpqn$> -RLMM@  0BRS> 0 P 00@S1 R4P 0(0( 0OT \&0h R"P00  (pp" 0 Rd 0@0@0 00 P(K85@00  0 R} 0]K`P`0`(a 0OP 0]K`@0@3b b\ R`TnQT2$a 1 I/K 0 ! 1 C?K   H D t0 OQ o@ < Q 8 4 (ApKD `@ \u 00H0KP0pt S{N~`FP` 0P@``^ 0 \ 10pA0V\ ! 0@p0t@00 0&@A8QTr45< S,:' 0K``0H,0K0@ 0PP1 0 R 0 KK Ᏺ ᘳ} ,z05@S*P0MK0@ P0`Kpp@,0K P@0 0PP 0 R 0K @Q -LM@0 p$ @t@310#4@ @V0 0\%1RU s 0< 8 <O  < $"@ 0_@pP@Prxs`0d  , l1 \.Q00,K*z@P 0 00Q4R# xr,0H  4Q0 (0$ @ ,w(K,u,5Sʰ0 70xr,0H ,,w@E$T\>A-p8@T`Pက(/.000b0X3 x x0  T0 S0 008@ TQi<<-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 xPP<,0Q84 ,85H 0 <0, (K,t( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -L"x>\5XX SS 0 R@0Rh0 S8P0!RTTciC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85Do>to>o -LM4 8 40@oP0 L, B0,0 80q800 \/0 0\40 j Pod0p4 H4LDP`, l5. 0\#Q0(v @ H8 Rt,0P0,0 800 \, R ,(Kd TS b5 @l4  `\h0^Q^,@@@u @044DPHh ZL5HsP5,5S4 0054E80S qs,P, SH 00RPi@-0` S@T,0 T:F@ -LLMD @ @@< TH0  iDo>itoXiTo -LM``@ -pRP =S>X< 8P 0` 4 @( X0<0 8P 0` 4 < KX<@$0#= ,K ,0P@S / 0勤 0P@]a@ =S P@(K x=]/@>> p-0LS@Pd0 0D0S  妏`P p0  TP &sp -LM, `2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,n`Vp` p, ,0C@$0(@[`4P8`,P0`V0(KTT> -$0L Pp`  Ĉ@P`@0 S@`V 㲈@P  t40 У @壤 -LM$0`bp PUMT500#0PP00U  R@ $KPHs0@T @ 3 0@@刊 0Q ۢP2 LUh Q M$0`B:$0 -L> -L,M$0PH ,P L  (K`20D0 L0H DPPZL D2Zu`2D0OO[/ P`$:,@K@qP],PHpgP9mL3P#L3P#h Nh0 S, 00;00,&m(5`(0/ d,L  40@[jP@ L080p ` ,0 H&,m80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@WqP ,lr5$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 {RD  H0X>k/ -L$M@pT܊$K P@ 0 嚇PZd, @ @i 04 0 4O  4$"0@<0 8@ @_@P< K @@Pixi`0d  , l1. @\$Q00 (Kp@P,0xi,(0 H q, , 0 R,,00000(Cl l> -LJM`L QKh p:=P0$N5%0S' L `@0SPP6 (K 0$004!$00$0%E  $03PH $0$0$ܐKD Z 0>PP=S3$0 KZ 0 p @0,00C0 0K(P 00IPPp0SP3 Պ4 +PP   PH! hP=S$0 `5   41PP ,㕽 HH! oT  0 #40SP>P $0 LM04!ȞP 4U$08P1 p 0S T T 0SPqUBO@Z KYOZ Z  Z QKh  O 0,L\& $ # H>8i> -@1LM8A4!00hqoPP1ahPP P  KЋPP  PP 0   B M /V変 0P 0u/ 00 `2@=  , .CDinDYpxjn>>>vn p-PLd@`P Q 0 R <40d0p 0d0toDoo -L0pSr 0SD `RI 00600 RD@T ?iiDP`U@6 0 1P0S00I X p0S0S 0S 00 P10S  P00700gEq00600-Y0SwkP XD 0S" 0 jP㵫D `R YIhT00S $0 d Q0rn>> -LHM\ \T \ X  P@ dP X0S S S KT0@0 UP  45 S:05S*P(KXT@ 00KܠPP 0T R8 p 0d ` @  <  PD , 0H0 > 7Z 0jSXj ZXXRQˣVP 0,0T <H @a4L0T@gPPu<PoPL0 0Sf45 R , 0S 0 $v0t03U0S000T P PT850 p0L0 0cS0!S40 PDD\D D 0D 0,0K  40PP40 T 0R* 00QRZ 0 0 RO 0XHH |@ T @0D,)j,\j,0LH %00 Uj 0 \ 0pP00P @@b b3a R`QVRTUR\0P0  85@0L 0G0pP500 @ 0 R 00T 0 @ 0 \r 00"X  R R \T@0y 0 TC P,g5T80P*\ 0S 0S 0;0T8 R U @(T000T0X0l H\0 T8Q< R 0 T0PU P\ @<0dK@ T08 0`@Q T0  0d d  R T0d ` 00q0 >i> -L MD < d @ @0 080 45Rp(K <Pp < , ^8 T^ @ 0p00@@ \3),XVS ,KD 40 lpW@$P(`,4<00cZS[ 0 H < pPu,g<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40kp0P` ,pP-gD(0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LM(D @ `œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 08e`p 0K01e 8@0@8@ ve00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM (0 pd @ `T`P @  0004`c@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U Pex00 40 i 00   0 R x ,0H0 1@ɯT   00 R 0$ 0pǏ0S#  x0@S,0 x x@ 0P` dP R e@(0c c9b SaQSP``(K@ 0 R* 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q00( lß2 b91 R2Qx0@( "0t P(`80 0@(, 80<@党"h000dPP  eP dV RPQx0@H, 1 0R00 @  ( R% 0$ 0pǏ0SR @^ ,0!P` P`Q 0S00 0@0$ p@0SR^ 0@H ,0P` P`Q0SR @PP 0 0,0 S00R U 0@H, 0 0Q @PP0$ p@0Sʬ0@0! (Po010X ɯW1 !0 ((pǏqnDYp -L M P0d  000S P K R0 0S  00<0 -,0L 00hSuA(o$oo 0-L8M@PK@D H d  D0K@H0K @ E 0 01K0o(o$o -hp`@ LP R R 0S0S 㬴0<0 R 0PP -h0Lhq`@P 0S0SP PPDYp 0-LP@P 0S0S00 0-d@L0P Mm 0P㪂d000  -LM@dPQ 0Sp >Q 0SF0S00S ( $0@ p0 0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1hAL,K 0 @`P+,0S(\% P 0( (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YXDYp -L8M0P( @> P@; (p\@ K08@haP0 `p務@P ((0( R-0[.0[S "[0R4 0R R 0(04( (0K@P ( T (Q$K@k(@DYp..,> -(0L(\;;X> -L M(K@Pp /,0K`@P,0p( (0S,00 0C000C0000( $0@(Q@000$K(Rc -L Md@Pt 00b/$0K0p 0K`P!t0S  0 00`0U 0 0C000C0000(0$ @ t0S$Tc`000K$c -LM0(@(0  ,0 cd>> 0-0@00P0 L 0( (Q00հ "0 0 -L(M((@ D  \8 0<0 dD 000040 t RF;;S<0,K000/ <@P0 0 R 0 UP# 0P`D 000040 (4 PD0%!*Q(0( R000000pp{00e0P `c010 >> -LXM@  04   < | ,0 8 @0H l dp 0:9S0S D  D(Kl@< 0吓PD 409x0 l(0$  00CS D l@ jPD |0|S00t0 Q0Sp0  x R` 0h X0 l |0(S`2 4A|\1 T 0SM 0JP 0P`0 P d \0 L0 U T R|P0 UT0 @,P _,K /0Ph R;;Sd \0 0\0 d ,0H `0SA 9 R7h0S Q0 l (0( R000000000cSX R.ʀ0 d0 ` h Q l(0( R00 R4 P 00 LS L l P (;;ptn>- -LM0K@ P00 0-LMP@0K Pd 0 R 0S P 0R zF00 8 0S l -$ L0S00Vl 0-L`PT @uP004  0 00d 0S 0` X  R R  0S 0000 d  R E00CS@d///x///ܬ/ܬ//ܬ/ //(///P/// x,00  0S00tt 0 ,x x(K| xpv x00 00,0 ,x P 0;0\ꄳitn -L MPpd@0 0"&!R :R4 0 R00(p z`P d0 d00 d0 zyP`0(KS000\( \` 2 1C0 00 \` PKR-ꄳii p-L M0d 0S 0P`@P dP@lKp0P`0d   廘0d   ֗ -LMPp0d0CSBl0tS q$ 0`T0 D 0 Kp0S@t0@X`Pt0sx0s8H|t<`rP@Zᦛ`00@`;00C@Zᙛ >0dh/0dh 0d h@-@d 0 \00(0(0Q S\  0 p @M\(h0S  @襍 -LUMx ( `( V|! pP0KKU p! p(KPK UPd Xd2@00K P0 @P ,P L@ <@ l xl0 PK0 o@0p Pcl1ZKF/<pla\p0 SI* R_0YA:ta 5@|Pp`q \ 0Q@h1 dA 00V1KV1K  U!KU!KNKLQU![(KU1[  c B ( KZK 0tP`0ta 6Y R0&Y :0 0~?(K0S Rl Np x0 d 0S 00R0p 00lp Qg0p 0Y - P0 @`L 0{pP0lȘ d000Xp 0 R0( 0Op0t@v0@@w@iji 0- @0@L JPP0l0iji -LM 0P@  04P$0l(0p( Pd` 0 R00(p  0 R 0O0@000v $K0@0 0D0 hA 0@崏 0O0 @DYp p-PL0@Sd 0 R 0 X R `T& NvLvp0 d Rd 0 R 0 X R0  0`l l Tw%vp0 d R -LMPpd@d`Vw vT0S v00S Blӗuu P 0 R# 0T!X R# 0 R! 00!X R00C0  B  03P 000   0 d R 0 d R lhb 00C0000 00C0000( $0@00 Jb -LMM#dPp0 QQ@ 0;;  ,0K@P ` iu(K,0d` 0S 0 0  p   0 R  0S00t000l@P  l@P{0000ᰠ,000 000000 00@PA(0@Ÿ( <2RHK @0H0  0< 0 K   <@P" 0 Rg <@0@0 00 ,RV 0辐00 H [0@P- 0哌0 0C000C00000000,ta  0S00t00t0y` 0 ,t tN0e@PNK h0 , 0|@Pl ,0000 <@0 @tn>8>h>>$i -LMq@`dP 0 vy \00 p00R] ᲩP 0 \w 0, 4 0 ,QppYpP (K 04Kp   0 R00t`` 0 R00p@@qPO ~ 0 R00t 0 R,00,p[P4KJ 0@T  TL\00p00S\00t00S  P\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP, YR0000Q 0S 0;0Pb 0S_ 0;0Z> -d@P 0` R00p00LQp P+Q 0S  ( 0 R00tP  0:0*000000  040#0SYO -LM`d@ 0 P00tp  0mK R 0 P 0p X  R R 02& (0$ gP 0 d  R  0-L MdP (0$  00K00 RS 0 K0CS 0 Re 0K 0$@ 0 R 0 00D0 0 RS 0K(0,@ 0 R 0 00@0 0 RA 0K004@ 0 R00  $0H0\0 0@\0`@  0  0 h0 \0 0@\0`@ 00 00 0 0Pi -@L0S`hɌ -L MPp0 Sd`0s0s0s @(K0s(0sX0s\0sP0sT0sW (0$ % 0 Q00p00R ኧ@P 0 RQ 0X 00S 4 R@(0$ \ @Q 0X T 8#8RQ  d0X0#8#888d0X0 0 R%d0%X000d0X00$00T0 R@ 0 R 0#X  R R q (0$  0_@Px p 0 R 000 ,@ 0S@g S S  0@PY$0,@S: l0 (0$   0S00p00Q @P l0;  0p@P4@0s000{ 40s (0$  0 0 00g@0s 0 Ro 80(0,@ 0 R @0 @00@040s 0 R^ ,0 0$@ 0 R 40 400D00@Pq@ (0$ % 0@l <0d  @0d 00Q T0 T0d0X0, 00 So*n0 d  R 2 000 ,@ Iq>]l0000}0s%/ 800 ,0040sL@0sI/n -dpL   0@0@0 * 00 0S00p00 0 0 R00t000 0 R00(0p0X0 0 Rf 0 $0 0 Rf 0 , 00 0 R000D040 0 Rd 0( 8 <0 0 R000@0@0 0 RO 00 D H0 0 R00$0H0L0 0 R00d0X0T0 0 R00l0P0P00S:(0 S(084 (0(  0 R 0 dkT\P`` \0d0h@0 $0 0 R0 ? h0OdkT0 ?0 ? -L0S% 0-L^ P 00S \ R 1S1  01S  RZ(@K@ 0@@"00000 -LM, p ` P4S,@PQ@T@a 0 PP 0S,0PK@4S@S 0 PP@  -L M @p0S Q#0 GPA(eK4倢 0$ 0,K4 RP1(EK,0aHPQ8 8000   00* 0 R0$ 10C1,eO(K  =<-0S$,M  =>>> -LM =  { > -LM @`0PQ $0:  KbJ4r$ 0 K4 #RP$`J 0 H\2 20 01  000 N M ̈́0U>4>x<0> -LpMp @P P`, ! p(K: S3 (@J (0X  0P , (0  0pP40dPQ !R0 00S0805 0d0ꠔ gJY ڸ$0Qp0 0^  \   0 ̈́ >>/,oPil>> -LM @p ` RP  3 Q 0R 0S pW $`J(@JP4 QP 4 $ 000h>|>/ -LM P剂0@P(K4 4,K QPV40 RQ 4 $0pa00 ,0H`IY @ a 00qb P 0S<  0S6 \P Q@ Q 0SG QT 400cIApd PV 00`A@ 0T TUP,KLA0 #  00C 00 0C0$,M$0"{T  A 02 10GI!@P<0<  T 4a06I xp JP@ = @>>>> -L M P剢@P00 (K4 4,K MPPW,0@TH% (H!\1@0! 00C000* 0C R0$ 101,M( 0 (0`00dq P 00`A @ 0T  hd]p P`  =40N,K10@><>>> -LM  @ 0 0  0 Q 0 F A 0( R @,K4KO`P,00(K(0 4K 0:`P 4 (0004K``N0, $40@2@t0x@ ,08H4,0<`8KK0K`P8 0 B18 0XPUX HK`  嘠KJ 4,@K@dO`Pw,80Hp YA T 054K 0`P`4PP40 0@4``N0 43@t0x@0 H800<`0^L`PB 2(K 0h 0P  Q3 ,NL 04K 0`PR40K0@H0 4``JN, $402@t0x@, H8,0<`,%L`P DKH0KP ,K{,vJH0K Sp# *@p4Qp R0 w0P80S@K2@4N, 00P;00,GJ80@SW 04C0 00 0,6JT804K 0$`P4@@804 (K20h  Ag ,KK4PPPM0 4 3@t0x@ 008H00

-LxM \0d  00Q   p d 07{p ( Z `唠  004F@ ,Kp l0KlP ^,\ d0 10LX0\t0 , I LK 3T X\I00 40 pM00  H,1@t0 \00T0S Z $ 0`0Skh 0LS,0 000  0t R@_@_p IHPXIt@(0`30@O(K `R00lK00 d0S00  p  0@0S@ P0 `@@ `3B PAQ0`pp 0@ 00((@Q V`0@RPQ0 ,0 S00PP0$ `@p0S ,vR U H, 0 0Q ,gt@(00 3)Ot0x@0 ~1h  (0 0@(0,@G@P3 ~H@ hUZZc   R| x [ QX RTڰ|0! (0,(0PI   |`0d!p W:0^7 0,0( (`K `pP` p (@| K P 0| x0 0SDYpqn@-P 0@T 00@T 00 :O0SSp- 0P@`@0  p -LM4 |\0 (0 (K00S,0 V < < 0 "!B B\ lB!100$000c?0"!B  0@ T^ \ 0L 0  Pp` G0@Pđ`pP ,4@ 0 \48 l1.8.Q<LP;,0NH 8#8,0  0 000 R21C 0 C P `B!100$000c?0"!B 0@ T P 0@0u S S BRG@h @-0 : Sl0@@0@- 4S:4S :: S ^l @L0S d  04d  -L4MH L HP T0 D PD D 0D$!0 S T^T @DHL0/J00D}8@ $3ßhP0`00(80 0@80<@(, 0084 9Q00P0Ot0x@7| E@PT0HS࠳@ 0 < D ̘D0< $@D@$0"!h! B DH0 <@ DL4 #`@ Xࠣpc4 *1@@4 PU  RD0$L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S<^* D$140 00@(K@1S D D DwC 0B,KH #00P0400 <,0^4 00 ;00-F *F pDYpqnd> -L M0( $%0 00 !00 !00 1 \0 0@\0`@000@(K 00P(` 0PEp CC@C4 4@C,K4 @J@P40,00L HpR5 Ě0 00 0) 910#87 0"('LPQ` 5S`1`# @B0 p  Y ,=G@,G,EPi -LMpRP Px0 0BRSPqRr -  W# 0 X 3/ 4`| 47 c SXQ ,K 0PPL 0 D~,0H f,08@- ,FTW``1 G4D  0` PRQ0 ,K`PP  ~ ,F0 00P(K  (0( 0OT R0S~ (g   d0O0 @030@ `2 PT1Q&  PCl n(K< d4 > -L8MDpKP`Q /P0hA,K 0 @`CzP,0SP Q  R0.S R 0.S Q0@P`(KDYp 0-L M0K@/0KPP0 0 L0S 0  qx000K0`0 0#68#80C S T0H00<00000$0000 00000000000000000 -L Md@t0S 0KK/vP0 KKc/0KhP 000x000 -LMh 0d @h `@ ,0 \ 0@ dP0 d ĜX u0PT l0 I@  (0$  00CSh :MPT T(K Q RQ D < 0(S`2 4Ap |@T@|@  t X00C0 X0 ? 0 0 ? 0  K QC <,,8  x0 0@H 4 @0 x R |0S(|@x@ | x R,P !B,K/0PT  0, 刔H<@@HT 00CP0 @ H  SL @p`B8 R  L \d0 m 00\q 0Qq0 R0o<0S R0 0 00 0cSDS60@0 4 < R  0RA t 0 pR80080 @`P\\' 0I0 0c`0S< 0@ 00<@ D0 9T $<Q@qHH 0H@0 D0Q0< @00a40 P% 0 PI00#0OT |p x| 0d+,0p@H 0@0  0 000ȟYli ,`\`GAQ00SX@ 0d0|0\m ` 00S V`  0S  (000KPT lQ R\ u06000h@00  h L,PAQ 0\0"'T z h  L0T0 r,K/0PT } hSuXP$2 /@P000 ,@T@ OV d 0.tPT E0t 0bt00tS  (000KPT /0  f d Qb 0Q_ 0d0 Q[ M^0T0 Y@h0@\ hu 00K& (@ @PlQ VG00h 0h\ vPH0T@ 60d 0sPT 0S0T0  @ (000KPT 0 hl 0\;0\ Tu0600l@hTl\ u060\ u@P060 0]T@ R# 0!R @(0$ ud 0~sPT <\) 4 @08@P0t X K=X0   x0l0Q; 0T xl\ t0@6T@ 0nXX@h0@h K  K @ <,,T@t0i>> ><>> >>h> -LWM  dR 0t p!  |!  @4t0C PT| |(KPK @elA l@00K P0 <@ L@ , @ 孑Ax x0PK 0 )sP| J@0lx!0c0R1 >*0pS0|1 x5]?KP`(@K`Q \a 奰PDtQ pa X?*0S> F/ZK0@h1 dA  0U!KU![KV1K]U1[ 08#8(0K0 Q PoZK p]K xl!!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0刔`1 ZKL0Sd `070 hY1KVK%ht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` r(0@`"00YP (K 0#68#80C S񟗾|%0%0"0%0"0%0"0%0"0%0"0t%0n0O Po 0?5!,@ n@P000,K/00KK@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!,s0@P00xPU ) ?Q,h!x /0@00S0@ 0`p@ 0d Ppyt0S0G0E0C0A0?0=0;nPl  |>> -L8MH HD D 8 d PX P% D0@T T+ T T Q H  0S 0SX0 0;0UT Q4 R0000(K8X0 @0@PX Q } 4S| D 8 00K_uPP0XT0 P L 8\4 < (~ DZx, 4<H0a@X@@ 4 PR]@$ 0Sc ,$?0t03U0SX000\ 4@00$@0 c4 n X !X< <0 0ãH< <0 0 ^UQ@X ,K<PPi`@0X@P3U0 X<PPWX0D vPPg8p44Sx*P\,?XP` U% PQ,<T~X L8? HPK 40XT0l@Q  *V6 P)X P >>> -LM  d 0 00 0vR@4S@(K  P@ P, 0S2U2 4S c8R SQQCQ ,K h0XA@T&$`(p,h <0cZ Q Hl0 @P,<,@ @0S# x@0PQd ` ڜ44c cb SUaQUs8 4 0Dh@ l  aZ!`P 0OTdXK @0S RP4S <0 t p0  P0S 0 ڜ@tP4p5 c S\Q\PTP P DT|@ xP Ĝ@ @ D0K\@ 6P d P P# 0XPKP^P`V  E0pP@@0`YT0 @P0 @  :<@T@ @P 4@#P c5, S.Q,K0@@Pt|P\ 0lS0! ?KQXU , P<00cPSl H =@,<T0SqRz@4S:P@$0  S(0SP8K,@K0 0K h0 @"@@ ,@P;P(0$  000d SdPP,4S:(3[Dp`+HU  :KKhN< -LMPp4S, `94`Sڈ4$ S/B>$4@HX <4`S0z03Y0S  (K p-LM`2 ^@@^@TP` (0$^Fx 0KP @xd0 R W0F0x0Sd 0Rx -L(MH D D@ \L0 d@Hp`PdLP@' @(#00K,Z`P" t0h#`00 d00 00` Pp0`P 0)YV (K`L @(@H K  0< 80 <KP 0:$?: `p0<K:4   `1, P.Q4,K;>`P_, L0H S4 UP``DL0pS　G ?<K:0&,4 @,910'080'180 R6@00K `P 0Qd0S000S08050d00(0$ 000L s0"WL00m5S1#0W,c9L0`  0  >Ti0o>oi,oPi -,1#LR@ IQ A 0S:LQ3Q T Q *`?0S T d PTTd0 (S?(?L?l?????<? -LM`p-`@V)8 K00 , 8` 4 QZ8P  {n  0l 0PPm- 0S @0d0 PP(K  ;0Pi@>> 0-0LS@Pd0 0 0S  WP  lPKV0D0S 0S -LM`2p1#RcL0嬔S, D" d0 T``\Pࠃ P 0!P` ^ U P ^ U`\`4ė0$ 0,f"0a0`0b@ 0@ P,`P`0@PU`P `P $( 0@,00@ Z PBZ KNYZ G t *Sl? p-L@ `bPPP  m4 0 l Plp -L`pP.`R@-0ᤔS㈤( 0ST 00 m-0Q 5kpU 寉d 嫉 㧉$0 :$0`"P303 -LM 0 00Cpb0,0 4ˠQ L 0E^ OĊ4D$T4(4D4"0C40 4S2P,`K $,0H,q74,@ S#ڈD4 T/# c1 S,Q0`;@PP0 4)04,L7(Kd 1@4D`0@$4!#/@1@4$L0S Y0 0C14 0 4 $< 8 4@00T4pK00  0 ,`t0 @ P  0O` ,S<K`R $Q 0< 80  -LMT0`R4@p OPP (KUP2 TP 0QPP$0000  0jPP(KP, ;';PP ,P6 Ll00 S0i ykY 0!r  n0`2,00H040 =PP ❈ 嘈4+PP,v6,P 00 S40 03S03S 04 0`删$ *<0(0$ @4#1$0$0,0( T0ppn -LM$0P@$K`2p  02QP((K ;:@P(0$H`@P`2`+<`@P08 K4 0 8` ,p N@( 6F0|? -L M@T*TP(K ?UPP 0  PP8d`@(p@D 33P34 4PS 4 ,K>:PP`,0@H@2L0S3  5@!S 1 # ,5 bSz? -LJMP QKh pPPA$ A ``0S  qPP. P3 # 04$ E0S $0 @P3 S0$#4DP T-KfRP(KDܐK Z 0PP KZ 0p @0 ,0 0C K(P 000IPP`0SP ^T4 PP T 8 0 #40SPP $0 LMj04!{hP iU$0V 0SP+TU`,H p =L1 iLP,L0S`CBLZ  Z  WYOKZ Z N Z 0Su 3TS. 00Hj@ dj04!'hP iUH XK Z f P@@ `@ v  8iPi? -p1LMd1dhqYUPT1TARUP @Q<< KUPP S  PP 0   B 9U /B 0P 0  0,0 `2` M ,&L0S   , U0v@@  @ DiDYpnxjn??>vn p-@ MLP`P 0@ @%0 ,0 @Kph6?0o?o0d  0 0 0S 0-PLd@g> 0P SQB?d0o0o -@QLN0dQh -LM d@`0P0Y (0KBpPI(0d@ 000$1P!( 0 ! 0 $pP UQ 000( (KQ rpP0  >Q(00 =P `P 0;0$(Qꄳitn- 0iji -pLd`P0 00 !00 !00U00  0@0@ 0:#:0 10 00 (0X0 $ 04@,00@ 0@@80<@ 0L@D0H@  T  0000T0 d0P00S:(0 S(084 (0(  0@+` \  \0d0h@00 \0 0@\0`@0Pi p-L M0@dP`P dP`DKp0S 5 00ʚ; p-PLd@`n(0(0S S0S  phIf (phݣ -LM 0P@  0`P  K(0p( Pd@ (/F`P0000P0@0 0,0 hA 0`@bi`DYp -@L0PSd` 0 0 pU PPd0  opP0! B!gQO -LMdPd`VWQOp0!R BpTOO P 0 0 0 p /pP10C1   k<O@10C1 0^p[< -L8M"dP0 Qp 0 ;;I,0KQpP 8 O(K,0 d`0 0 0@,0  !@! !000pPN DK0 D0 0> K4K L0S `0=@K.0<0K8 d 42K 0C3K L0S `01K0@ 0 0. 00 K/ KhA ,D K0@jhpP (0d ` 00Q!/'pP 0! B! 01000,O~000  +pP ,00q tnDYp ? -`@0LSPepN( (0R eNpU  fpP-d0!R" 00 epU  e !0 00pP 0! B!HAepe  pP tn -LhMP @, 0 ( (0pR` fe,0T vN,PsN[eO0O (K\ (0Rd0 0 Od0   PY  ?fP08dh d t !Ry 00qt 0 l0: S\ X  O,d0P`0 dhd ! !h 000MPP Y 0 CePd0S d@N`N\ Rh@ 0000ePh0! B!h 0M0S$ dM,MdO0bO00 0 0L 000K B 08?|?l>?\?DYp..? -LMP 0pS, d`0s0s0s (K0s(0sX0s\0sP0sT0s! (0$  0R  P 000 0T0   0000 0<$T0 R0 0 @t (0$ dt@ 0 y㘐ST ׄP0 S R 0000R@ 0S 0;0Q 0S 0;0 p 0S S S  04P|l0 (0$  0R ᘄP l0j ,0 aPc@0s 40s (0$      ,"0 "0 1 \0 0@\0`@00@0s 80040s ,00IP Pu0 (0$ 2d@ 0R ;P R 0S  OP   0:0000   0 0L (0$ a gqQ`0 S كP(#@0@l0l0s540sI@0sFPi -LMd 00 $IK p- Px0 @L0 `P d 000Xq0(J0`K`pijiA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 -LM Pp ,#P  t$0(,@ \`,K 0` `P R"P  (K4pLo꠫oo p-P`L@ @` pLo< 0-@PL @ P0蠫o< -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0<"P 0@@ @? -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K ']"@T# ( $0 U:,00VR 1 S0!  $ P X!@T (K,40W@:00W8pX080WxpW*Xp -L4MPpU@80 { 00%Q01Sr:0a bU,0 , 50 R 10 =>0 ==``  0, 80P` UP(Kf4   40 ,80 P:P   0 ,80`P $P  4800P, P p-Q M@L ` 0 @@P 0@@P 0@@P 0@@lPh 0 @@@@0*080 Kpo0?Lo8?|oD?ЪoP?o\?po< -L$Mp   Wz34 80 `g 0 P0b\0j   @PS@g0U#*QB Q!1P! 0`P`V00V03S *@P `0PU`0U @T (K@ R 0S@(0$ ,00V: R `0U@@0ST 0# UP$( ,0  0 R 1S0!,K0KEP, 4V@:00V8`80 -L !Q 1S 01 0AS 10 ! 10A0?? -L !Q0? p-@L !ƌ\`"S  QP P 0 " `p Q0S  0  0 00`ph fd?4?? -@`$0 L0b#6<@ SpTQ&0@ P P"TP\P<@0!PR00R0S0 !P "\ -LP@!ƌ0C  0S0 !hhL? -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `F}U -@Lb 0{P  0R000 00 0 p-"fL@P  00b0fS 0S 000  pp?? -LM@p, ,P'0, Q@TO 0S64`V3(04 0  !( ( ! 0,` ,P(K : 0 B  a  !( A( ! ;>,00,0 '`P  0??PH, ,???R -PL@PP) $F%6@y0p0!a @ ppf bPzPP@ 0 0!< R$0(0$ (nPoo -b@L y 0@sb yhVo 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0S0PS0000h0? -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(Km꼯o 0-@P ML@4 ,0P@gK0hco ? -LpQ$M@H L `D@ Չ1P< P0 S@CWeQ0 0a00P 00< 00@WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0 SQPC0WdP00 `00R4P004 8000 P 'JD 0S U0000PRH @W(K@Q Q,00,0000DP 0@0 H?(? -L@L\p`P \ RU 0S  0BsU 0h<0 00RUh 0h* -P0L00 0S@p` 0Cs 0h 0h 0S^ 0 -L M $0<@p0b#!& X 00Cs 0X4X(K 0@lwd" 00Csa@Qeb ?xP(T   bw b 0x@P b w0 0 0As Ye`\100 !1 000  0!0c0,0  4 P! ,0  U P!4 4 H40T0 P ! 8 @YbP10  1` 0b w0Esfb wh i 0H  i0A  ꫪ -L@\`P@z 0Ss Z$p P@P_ 0e#viv20!Q  pe bwP 00@P0Sq W0<00!  R 000 0  000W 0  c!00CS0? 00Cs2D0`0 D0< @@ R$0(0$ @( $@l< P@ D00D0S $@0l#6S"(<x0#8\':WX: 0$  c"&<0000D  D 00C0o F# $@o, #$@oo@-^ 4@T 0S (00  !( ( !D4 -@LP dT00 p-PL `P@ST`0  !( ( !:p 0-@LTP 40S 0S 40 0C 400h@P0Sh p00Cp0(0 0  !(  ( !0z <o0o -LP 0 0 o 0-TP M@LH 0 P@2(0 QAK0h)ot?0o 0s0 0 p-0AL01 @_P ` 0S P 0S 0SpRpP TP 0S00@ P`p 0Sp됰o|?< M-L M@00< D @ <0@S[D 0" 0@@ H0 SB2D4 00 H8 <@80 aV5  Y, ,s 0S(r X\ 4P_ pQ10@P0PSPS 0 B0 U@0S R0H00 ,`V8HP8 Z!p00jp0(KOW/`pD0OWVD Q<@0PS0OWPVZp p00jp0YD 4P0@Tp VX4@Rꐰo0o p-0LP@ R,`p0@S0a!p R P 010U`P V000V000C0S R000 L 됰o?? - L@PR M-LM0 0`0 , P 0pO# @  Z (KY 4p PP (0 @ 00CS 0 080800 0 0SC40S0Q8 o0 , !( (, ! 0Cۜ*0pW0p O &#*0@Z0pKp|{0O#Y40S0Q !h:0?(?? -`ȟMLVF &(*0&Z W0  pX(K - 0Ls` 0CS 0 f R$0$0$0 f@T (4 0  !!( 0 (  !!`!0V@T @R&R00R @P Q!p00Cp0 0Rc si7 !90XpQU @T 10@P QH Tp00Cp0@0 TPpWiH?0o`oou 0-L MXPU@@DDT 0P, ((0PK0VlP?o\?`o -A2LMpc S1 # $0KP(  $0R`0@P@RP0S  N0 000! 0 @RPc 2s -LM0@C2A P # S<#Sp8 c 0Kⱑ`P0 L2 S<#S PQ R000 R0QL2  S<#SPc r 0`0p  -LM A B2 \̠# S<# S@p= c 0Ke`P4  L2 S<#S PQ R000 R0QL2  S<#SPc r 0`0p ep p-`L@c 0HsPP 0S 0  0Sc tr`Pp p@Q0@S: p-PL@c 0s`P  'U0 P c GrP`p p -`LPc 0rpP,  V@ 501 P0 0S1000C0SP\000@Tc r`p 萰o@Q0@Sڽ -LP F& 0S\1 p`@U    0@S/D P #c0pP@=  0@00`+ 0S5p0`0 b/wd @R 0$0 p$Yd0c krP@ dT`p`@0,($iVltiii`o?d??? -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  1@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  06@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T 1PP (0"0  !!( 0 (  !!@TP 0PP0 P5PPA?@0 , !( (, !0x!@0  !( ( !@T0 00@S@ 60@Q30  !( @( !Pt JT@P @ IM(00  !( ( !&6  GP @010 ?? -`/ML&@!*$Kp 0K @ $p @ @@PP P  M 0 , !( I(, ! : B4K -Lpb1PUT `pbV@P'P@@P0W  X R`P0@Pb @`T. P`P^ 1@P  W00X0S \P^@DZ(Bb`>bU ~`ii 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 ^P<pX@ @8 0r0 @08 @ 0e0@ =i ? 0-LM 0@S ` 0SxaPd/`0 R000   ,a 8hn0C 08>i,? - LàML pWP`P1W 1W V0S0:S0 :@P`  0ptat^aPUPU 0S06 00(/$12a  nP>a R  R 0Sa sn ,000S0 00pPa00Ta 0H0 0a000$`ᰕ0i((ii8?i 0 0 0C 0 Vl0@0h$0PDYp 0-@PL \P0 00   (0R  ,0000000o 0-PPL@ T   0h,  0h0 -0 0 @ ,0LRP`5:00Rp2:0 @P$ 0$  c R 5D0 0@ @ ,0R:00R*V  ! @P (00 -LM` K@PP. T$pK2%* P $0T: $0ST0S h$0#&R :0R*0a"!B10b2JVK b6pD? p-`@LP   phq -0LM0p00 R 33hh    `  1(0!n 0 !(  (  !  PU] 0 zl"0㓕@TK V 0 <acP]000@T 40S X@P@ 0@1PP<  0 K0 00P(0@&0 !( C (  !( , <Y(0T(K  00 5%0 000S; 0 ,00J002T  , 08T000  00oDYpp?|?? -LMΟ @p> \ : P L H0 PKsP   0PKh p0S Ɵ0008@P4  4< D0#10#0#Xl 5h  Z< 14`01D0@ 40S 000 P008 Œ0LS P  (00  !( C( ! 0CPK]4p h0R 8@0S} 0`.P Z*BW @400C400`0 !( 0&(  !-P0!!( 0&( !! , !(0 A0(0!!0pPK 97PK3PP@ 4| 0.`P@4p {-4(0D0  !( ( !!PK0ThŸp h0 @R 0400 8@  0`.`P 4)@0!!( 0H ( !!4 4(00!!( 0 ( !!4   @00 5) 00)4` ᓐ)0  !( A( !<L 0 c<0r00C0&4p 101o)04(00  !( ( !4, <L 0 c<0DVl?????DYp??0o?Tn 0hPK0 000$< @0< 00, D0 LPPa0X`p ,K400 0Q40KP P <0D 1 4 PKvPP@@\00SuUR4pO {,4(0 40  !( ( !@ \>^,PK 0P04(0 ɏ40  !( ( !4>,PK!00L006@ ᫏4l 10 1O46 ត4+0  !( ( ! ሏ4 <L 0<cjP T PK0f{\"+(00  !( C( ! PK0C 0PKF6@Q|+(0 0  !( ( ! !(08<0 00W0X$X7@U Q-L`pP#*@JV  0*P T   ;@- 6(@004@ 5(@80<@ 3(@ 0$@ 1(@(0,@ 0(6@P0T@0o, 0S00000 WVlDYp -LM KLH0#&R*0R*0a"!B10b\p6p -$1L@T< Pp`D0! R"Q )00CS 0L0L0h0h00P l l0R*QP 0l Q*QpP@TV \0 RUQ <0h<0`@T *ni0o -@L< 0<0 - 0@LL*0L1i 0-LMXX0X P@d0*L @@P;@PK0iio.  . Q! X -L΂n^P`Up*S N@^ Pe?Ns0O,0 hT  h+\pi.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `a'P)4 R @Q00000 0J8 4 R|< e<@ DP 8080$8  00ii\p -@dPN`@ RL @ppP .0 ! @ i -|0LM R h ;KK 0( P0  de /x2 K 0o6pi? -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 ̄` c ,4PK@ 04@ 0P @/ Z<0cX@ (Ki>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 `,K,< 80,  000P!4@,`T 8 0,:,0 @T 0\ 8,:,0 @T`4K &(K@AW0S ((1@ 30S 0SoW4K%0C! S, 0 0 h0Q @ T00 |RW 0 S ` `R`^<0,  04K `%P_ ## ?\poo?DYp -LPp 눀`H0t@"0W 0R 10 P WM* W*C*io p-PLMP*@`Kp P \0#&R*H70R*0a"!B10b *JUx\p6p? -LPM($rV 0R Zl 2   V PqV 0R1   V1ZhK@ @@h`K|!p,*0 @P@0pP`8A1XVP1 Q 0 hK!PR U8zVZ 0rVU1h K@U@PQ 0*1(K0@p  T0 00 @` P@KVVo## io@? 0vbl0 4pH? -̡LM ,V Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp,0`$K0!&0@P0 `DP?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, a$Koxii# 0 -LMP0,Nl@T`p(KT,K, Ld0   P, 0 ],ꄳo#T? 0 p-LMP,d`K! ̃.# 0@P0 PKp脳o 6 0 -LMp@ `.` $PK @ 0$@ P @y  _K -.L M  8 ,0(Ǩ0!Y# 0@P(0 sP0 ,(KZ1P ,0,`0ap`p |1ph  a(RP4K@  0 4@ z#PA,P0U988 t,0Z0S. :@`p4@ R00000  0  0 &0  !( ( !Z0C 8,0Z0S$,8 li0o\p -LM>0`~0^p@0P 0` `P @P 000rT 0 a 00 0P  K0 @P幾巾嵾##?`?? p-LMP@ *|`|0 d00  `0R0 P b 0K@P0 P 0`Kp儾Vlo\p#i? -P`pWL !@P4 (0 0  !!( 0 (  !!0 ։0@P`:P@`XW% 0  !( ( !)'% q Pp00Cp0 ?0o -LMℑ,~d(K!ph 00  0@P0 P>41W ,,02 0cP`0  !!( 0 (  !!08 L0:P@zG`W 0d %@Pp0x @h1pS /W00S,(K, `o,,  a5ꄳo#iDYp( ? -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<喽0R*0`"!B1 b 0 00  000 JU W3 !0 0S(K0݇@0S 0`S00S ɇ ,$ 0 0S \p6p4 ?o 0Q-L@ 00SD00D0p@-0\ @!@1Q% \ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:EC  f@U>0e S 0SR F@3 U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300< \00\0 Q-&:0@2 DP 0Q:0Q440Q*<0Q:@0Q:HP 0 R 0Q:0Q4^80Q*XP0Q:0Q4 0 Q:4p$0(0@-P Q0#03 P 0S @@1 Q#3PQDQ 0T # 3P R0T # 3S RXQ T0#03P0S T0#03R0SHQ 0T # 3P R0T # 3S R\<0@T # 3P R0T#3S4P T # 3 Q R8T0#03\0S 0 04p-$ (,40 R:80\34<0R:@0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`rP nPU 0 00p 0 0  R P; X> P@0T 0` @M0S0P  0SPPP`?P ;0SP040S0p  0SppP@&P#0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ 0S0P  0SPPP@uPr@ 0R 00  S`0d0S0@  0S@@@`VPS R 0 00 0@ T`@D0S0P  0SPP`P6P3@y R 0S0P 0@ P 0S0P  0SPPP@P@ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0-,LP@P'0 Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP D0P X0P sV@ ;P@ A2P @4p P 0S0SP0SP0S PQ00SQ00S -@,L P0 3H 0-P@LM0000hM p-@`LMP00MpphL0\ -0L @\h`\0[0[ -0LP@P (00(0`vM0p]MA[PpP3U gM0OMLM[FMP0-\ M-LM4 040` P @xh 10 Sp!z3S0CD  f, , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g 40R8T:<0R@T*P* 0@P@T :,`P,  ` O(K0g00T0@ , K00K0 PP  740`@y z5, ,P `00T* , l\p p-LM0@ (00(0xP`L![P L0 00 @0FL0 ZL(00(0x(< -QL M8 <0 4 ,0Q:00R, ,(K 4 8 @Pa 0ZD0T I 0ZD0JA$Z(0, 00Q8P 0Z? , D0@000 00 X <  l2 R $08`Z p1p!Q`!V< @ O l@@P, PU) < 00CS(118181@114 s, 4 l0,0 0,0 4 c40S0Q(0VjW X/0S00S @aW00CS0$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z D0@000 00 Xi$0Z p1p!:*iT ? - L@]T0000ɵЭp ? -L` PP1 @ pT p  eU $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x{0S UPK0$0( ,0 0 $ (,@ @^Эވ ? ? 0-t X0PRQUL*0e/s B@T>000B 0- L M0 X0X0X 0d R@P 0| @\l 0dd @TPFH 0@d@I$GK0hNꄳoTWl@ ?4pH ?4pP ?5p -Z%ZULp`eW   < @A$0X+*@0(PS$@d,P  << *D05 0P004 48 ,0S  *  o 9  og(P$$ bP!  b `h0@,408@0 dPtu00LegT$0 -\0L@  Dhm8hi F((X P1X@0CP1h^E5p4po0o p-0L1PU E`PX@T P10P1X>E0\0T0000p0 P :@P \P 0 m@Pd0. d0d0S0< @  ʨ  0ie p-PL`@ 0phW S-LpQ,00 Q`!`1\ P1P!V: F :@P $0V* 0V  0  XU@P 0U$0U* W S-LpQ,00 Q`!`1\ P1P!V:  $0@V$* 0VTP@P 0U $0U* xP @P  E@ -LM0P\@`p:\:,0Q:R*@  KP@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O ,0U@3K:00TG0P W$pU@*D0=P 0T C 0TAD0;$T,0( 00S1h P!$0T'Z, T0S 0UHT0S $0T<:N 0@<@@$K@ J @ T0S 0U T0S $0T :! 0^@ } x O J -QLM`p ,00 Q!1\ P1P!Z#:  $0@ZtT~ 0U P U$0R D0aL00Sd1 W0S售 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ 0 T 00V00S4@P) U&$R D00HSX Z $U* m@ u L0S $ 0P i, ? -L M`0, Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3' D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* WvD0 $ t@@`t@P  -LM<0 $`8 ( 4 ,0\p 00 ^ <0P 0,0 @0408@ DPTP K -`@LQpP% @ {$0( ,$0( , 00  0P$0 aP`  -L`@pPP  PPPP @0S @0S P  0P@ 0P@ -LMP`p@ H 0 P@0 T X  0P (K -`!L,MQ@0 DP:0U!3Q<,0fwA X!3< F 00,0 00  y<0H9 UP\ !Q0@ X 0H  0KT, K0Pi0KD. DQ+ PT, K<0 L@P@ R 0@8KT  0;<D P, KT0L@P@ 70@IT<,KL P0 @P@ $ 0@x8KT  0 <,KT LP0@ P@ c @ _P0T0 0R c8K 0PwP ,00c`p/ &8K P0`pTD00D0 P T0 t@:t!8 K1H@ "0 S al\pi4p< ? -L8MPp%D Z`@ F80K@40 8@ mP< < = A0 , A\ !QXW 0H T @  X3N@: DQ7 D, K00K@"P%H D  G8K<0S < (K =P 0 , D, K00KgP 8K D,K0 K0@ PD, K00KIP D08K<,0 P @P %20P0 D048 HLH  0%D0T X0  0<0D u@D0 00t@ ` < tD 0D0 0D0 P SP 0S0#03P -L0 @1P  1S/000P $0 )0S"02 000P0,0 0l   `  l0000  c 0(0 $$0l R*000$*n0oi p-L8M` 0PP. Q)0@ S'PB1|B1B1B1HB1B1B1hC1A1C1C18BK`00, jP\0X 0 0_S{\y! 4?2cT0`Kp-L@Ks0 0Si 1KiM? CiUϠ @1;i< 0iAKX00, ]jP\0` 00_S2\0 4?2cL0X@K\00, AjPX0` 00_S\X 4?2cP0\D 0Ti :Ni0oQ6p\ii -LM 0vP t1t l/Qo K D1\ @E )00CSD1D1D1E1E1E1D11S l0S|0T R |0S@ @ \ ePp0 #50a,#50 ^T h!\31C0a 1 0a&1 %\  @ `Piin$*n\6p4 R 4 60R: 0v@P  [0o -L(M@8  4 <0 0 p `@ ~ 4 :#:S@: 8,0 e 0SD 4/ PU Ơa Z, ',  ,0< 48,0 Z00Č,0048 0 @P@048 <0(Kon0(Ko/<0P0 B/T08  0PPʠ< T0Z8p  0P8 (, 0S0S@ @40, >0>00 -LM@P`p & :#:S  0(  ćć  P  0(Ko 0 R>0>0 1001 !:# -LM ʠ,ʠ\ 0R lR >0. R 0^  0tP  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P (4d 6R0  0;P 88`0S*#80o -L -LQ 00 (` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ TP1P1P1P1P1hP1pP1  0@  0@  0@-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0_@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @y a -LM0 0 , SpP 0 _d`V[0`0S0 U > SR UP *ZI>0^PUF  j:#:S?0Q<0S93Q6,  > r1  t0(!6@ Q 0@T< 0H(1,K`  0 @ T,0 000S   BR r( 0U@(K 0@pW P (P @  0 S  @S @$ 0SS S R@S``> 0 Y   @ SA S T0 AP[0 < 0  p0`0(1 `,K0@S0` t0(!6@ Q 0@TS0 @ nXʙW@c 0K4!3%@P0L 0S  @ Lj 0 CR     # 70 '? -L,MH T H P J$JT0D >0 Z< *2 P08 40 ^8 0DP L 4 T TD8 0P4 O4 PP , K Pw ,P. 0< R*L?0,<$ QSf 0Rc:D0<Y!0000 . 0 0 0 R( Y0 Y0,P,  0<Q P H T8 LD8 L B4(KL B@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP P00 PH T8  040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,&0,0 00@SP *10 0 000@-P@ R' 0S$\) \ ^ \A 00\0 S 0  0S  R 0000@00 R ^- R / 0\00 S 0  0S   0S 0P@ 0S@ @0 @ 0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -@LPP`p 0  !( ( !00C0, 0 0, U ,0 `$p0,0P0  !( ( !000 -LTM@ < `Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pi6p0@-0 @@$!( (P@@$!0@ - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P U\ `LV`@DPVʹ| 60 0 R \ `LU`@DPVio6ph ? ? -LhP \0*0  0P 0@ 0P ̛0o ? -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM f(00\Qh!@0R A0R @0 Uh!@0R 0R d% (0 0R0HA :#:S 8 ᧚40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KS$rn0oqnoDYpoLxn ? ? -LMX`4 Vp@r V40S  0SQ21C  4000(K 4 Ph21C! c0 0 P; U, Y `FJ$&0RP08@@0D0H0L0: RYH 0  !( ( !0`VTY' 021C, T B 4,  ޙ4 (Koؙ֙4 0@Ph0͙\(Koə h21Cc,0 g 傚i6pi ? ?0 ?l ? ?? -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J UChh@0>0>0 0U *(i`mdm4p\pP?|?? -递LMx0 @0 ,  0 @@/^ p,0 0b\0"6!v21C!@cw `ᒓ0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S$!% 0%0" 0%^0 c21C cl+0S 0pePcUg墙 0, >0>00 00 >00A/` 0 P00C $ (0 0, `\0TXL(K(|넳oi6p56p0o?`mгodm?@-0 .!( (@.!@8@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 0oo-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 0oo 0-(0LP R0 <10  0  !( ( !00C0(0-&,0   PP@0!!( 0(( !! 000(0 D0 0!!( 0 ( !!00  P Pꄳo0o-000CS00h00`0 000 !(07(0 ! 00C 0䄳o0o -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!h@0QHP`0@K  0 @0 ,@ PFP @(KR1D0Q Po0RO 0@VUa0@< 8 K VV 0  !( ( !h0 Q0  !( ( !S$rn0oqnDYpooLxn -LM`@.p,PK 0P(P  ,@ @tPP(,^% @ 0 0  !( H( ! R000(0  0  0 ,@^$Ki 0-( L@4Pa U 0  !( ( !0  !( ( !U00C0, 0 , 0( ]7G W R\ 000Ȍ l!00C000S P 0 00C 0 R00ƌ0  !1(000(000#!0h U PU 0  !( ( !0 xR 0p00  0Ǡ   B (  0 R $0  0 0oy`o -QL+P`pW1 (0$I`VP @0Ds(0 0  !( ( !`VP`(0 !m0  !( ( ! -L M0@KS8 0 ,@ G ΃,Ơ0@ ;P4 50@T2 6P` P `8 =000p0  !( H( ! R000,0  0 I 080@T4(Kƕ$? 0-L0LP@L|0+0 0L E`0 $0`E@`!`0hb+81гo -p0LSDP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 _!(0 R0  !( ( !`0PS0 !( 0 (  !0(0   0  ! 6  -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 003 (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# X T 0  ,0`0 0 00 u -`LPp@T6U#:0`V @@d=*$H04$ 00 F$0^0S |h*@l0*TX0&h<*0d#8 # ^V6p6p6pi 0-,P& L@0h\p -0@Lri -LMp )aP U 0P 0S U@ P4# @TPU@$  0t``P0S U@`0` h@0@Q@P404$0) 8)6p6p<?DYpo -LM`@P V 0p @ZUJ 08 L0pP  ,S$o + h \p 0-PLqDV)@0\ 8P` \@0@0S T06p6po i -L$MD H0 80K@0H0p 00K@ ,0 PS0 , 40 Sʴ 0K80K0S @PoD#Q ʘ H 00S @#6:1< @ @@HTl P` P `@Q ,0S@ <0 0@ <0 40SX < R (KL D s@P (0   0SC 0  !( ( !(0 0  !!( 0 (  !!0 R V@^0@(A0 P0 `00  !!( 0 (  !!00S80SD0 0  !( ( !PdH`0`0J00`SF*A80@SFP`8P 4` A -LHM004 ;Bv @0S0p0 W0PW@hKH02@T70#0l0 HGl `0"p PR0!!( 0 ( !!`VP1 Y (0 @l0p  R00S 0  !( (@.! , !( @(, !HhK (K,rn0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH000oVUUU - LM p 4 X W00S6 R< x6x&t0PQ0 `@ R00P0S F 10 1D `(@PU}   01001 X W00S(KW  XF 4 P0S0K,0 0 CT`p4P, K00K@ @P4upPU1 X? (0x@0!!( 0 ( !!( \U`o UV (0`04 S0K,0 0 `_8!00 0X8!0 (00```4  B4 0  !( ( !(@o$1P0$1(@00 7 p00p0-1Y0100Z@D@ @ܽ`[,10,1Dak0!!( 0 ( !!0@ 0S", hp0S l0Qb ( 0  !( ( !I000Ÿ Yn P_W @' ( K10Y㌀00H @ (10(144tKP@, , K00K @P00 P  4K4 pP00 @0  !  ! 0P& !˾(@0 ! @ i00  l !᭾V0(@$rnqn0o -xLMp0lsPo!0PU` V0P!@ 0eS$S1011!,  d0S{P12d R@2DP^@"0P `lh0Q p2PU> 0O Q 0R0faX``W *T( X``W0P ( @0S; ^  0PGV C3<1T0H<1(K ! ԽP 0  !( ( !pG PP~40A4  !( ( !(   0  !( ( !( pGp0,PQ  \ RpndbfN$rn0oqnooo -LMph1H08%\`V  0[\`V 0C0\00`0%V 004 0B6C0 Px"@|!0` QjV@%,08@Y4ѫY$D$DYpo0oгoȳo\>ooo@o -,LMh1  @0! P $"4p@Wk 0 00, 0 $ BQ4 0"@?CSD00D0W0 #0/Q R 0O0S@PoVOL 0K{WQ |@$ ,0R0SDYW 0T00000 0R000080 0 ,Yxn$d!04P\z$L!4p@W<H1 p[14p0W1$00 ,@ i4PU 0a0c0K)W 0 ȟ00X@T@0@PoPU`Q D0tPo0Q RO 0@V@U@P}DYpo0ooVUUU$rnqnH?i 0-0LMx h@0@QP `$\X0TH/PZ8@vP (o$0 QDYpooo@oT?t?A( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q 0\, K P#U (0 0009 0 !( (,( , !,0, ,,00,0, \, $ 0  !( ?( !,(0  0$ S B0R$ K,0 00,(K P8 00P 00  8 0P@ 00 4 4 \H X0`WP 0x 0S 0' \X  A&0LP | 8 0  00 4 P W0P0 P(K 4p h 0 PRP NKꜳoo0oToo p-@LTP#0  !( ( !.!( ,(  !@T (?4<S q\` x` 08@000\8K0$S 0QJph< ?o0o@oTo -QL' @P0  !( ( !.!( ,(  !PUT@ (?4<S pJ0$S 0QJ8kxmlhp P`8 80 @#FDV@1<@ 21C! c`V@@P ?o0o@oTo -@1LMh!$pK(0 $aD1$ p   1yLP\$@T0  BPP $@T 0  !( ( !@TP$0S 0 @$0S$00$0ZDYp0ooTo@?0 \ PDP @4SQD$DRH4H4H40D$H4 d  Bd  \7p0oT0\ P ($R,40QDP \7p -L@P$40$4 -\0L\T 0 @ST0 00\ @u"T7p p-$L`\P3 0R @'0S# @T 0  Q0P" 0@S 0  0 00PD4-H0t ` d00d0p U\ 3"00 0 S 0  0@07p0o pp-L`P j(@a0 0kP 4$0e 4l  el p2~0oH? -LM`d0pSOL`VM PUDTU 0 4$0S0 @0,K@ @ImP DTU `VZQ!00D$RH4H4H40D$H4 D$0-H4 P 40 4l0  l (,0(K0o7p0Wo< 0-L@T4P$SE^P T40T40   H00H0T$P4RP0000 -P@L<80< 0a c< 00C 0@0S00Su0S 00;00 @ 0 0S T40CT4i<0S0u7p6p p-h0ML` @P0 K@ @lP0,d(4Kp ~7p|? -L,MH D d@sL LH 080  DQH H0<@0 0Oᄤᣫე< ~D LD  ?0 PD#<0eXesH0p0 ,To@ 80K0 P,2"@`\tPx`|0 84@H\ H< 800b ccQ3R 3Xሀ H0 R  H<800` ccQ3R 3X᐀ L0 0ULP0SWLL  00, 0 D0ED<\< " @0O@ D L$@D? 0 8K 0K,0Kt@P!80si40sfM}sPL0 0R0  \RH00@ ;00LtH(KYPL@t6p7p1!CeP1? -tx 4DK#6:Lp@rP# (4@$0cOF#J6T[Qd@ Q}(@P0Ot0x@yi i00 ;@ 00@ie? 0-0($@,0LP0P 0000(,0P $$4R@0S" 0@ P 04!?x$h00bh0@P (P0(,$0=i0k\, 0[%@|n0o7p? -P"LM@d0Vp@ 4!0PP0SR S P!0V 04!(K$40"!B 0S p@ @0OD K4#R0 A0  ZP@QCN@ 0p $!6{\0@ Ipp@_k00S&  0jP '|K4!0PP(0 ,|KPP(0E4 0P44;L$@4 04 000h0P0h0ni i??0o -d1LhMPu  KP K%D]PA %88#Č@ {pKa@0, [ @z\ \` 00@Pu\ $u 0@4 Lt0hP  &@\ \( {pK[ 0zj?DYp? -ML MP`p 0S= S #@P; \& (KL3Z ( `PUDTU W 4OF#J64; 0"@PAn+0`N@PDTU Z@2@d F~KpG pG+,0K@P+0\D0H0  0CtKL@ l p0 tp D` @P0`0CS@1111111@0ST0! @\ `OP8PR  z.P@ 0@@"P\ /\P *00@0@ST00 000S,  j,\ , t2@P <0S{# \ \P @\ @4#i7p0o|j p-`QLP@@Tp -LMp`N0@,P@f5TK0$@K0@ $ @ `PV@$0  !( ( !@ R000 0  T ꜳo0oi -70#L0`M*x0 000p  t TP| > W0h$80 S%:S 0 80 S:SQxP tQ! o`P$U |lKe@ lK ltQ  PS|@(K@x3x#h@0Q x0ST#t0  0OF*p#J 6|Y0 3# ĠP,0 xHt\PP 䂟P@> 6Q8040 t0SW 2"h@02\@0"000| H@ Pp |Q @0P  H00H0 x0S0 Pq |Pp@`*q0  !( ( !`VZJ|(0Kp# pP| G00x;@@\00 6|YpW$ PZZ Y *q|Z 0PS0S PXp .Y p|lKy|Y i,rnDYpon!Cen@ 1 -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p00o00  -L M0 S0d% @\0!@@@g0P  0@q|qt 0l@qXqKhD0P 0x,xn7p0oX?7p?6p?7pDi(?`?0@- 0S x06BQ*0 a("400@_#& U x0T -LM0 p>0n`Q70 a(@P$0S, p060>0. V  b 0 K@P0 HP  ahw K f 0p 0f#&Bp 0S* 0p 0c#&p ? P-0L R.  . hx? 00 0 -L4M0\ P `X Zj @<0t"0mC 0S_ R@@ \P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 h< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV 41@ XPK`0@H V @ T00T00S` T\Q0 0C0 S V(K S@f X00R0S T0 `q0SA XB=`Ph \T Xh!i41XPK %`?DYp -LM= - 0LS0S\(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P> 0S0  $Q(0(0( 0<0^,@TKph 08p8p8p -PL0`X  p0W0 04@0 0h!54h!DYp -LMp 00@"0?0S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1hK 04!P"PK`| 000P `@P0 @0S$0 $0(0p0(<0d  .>0 0@0$K">Q 0T0 h 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@v?8pDYp$iihd0 _8p8p? -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U >P, + (00  !!( 0 (  !!PU 00 , !( (, !0!C>P0 P^, aPPU ,K 0PPP,0 , !( @(, !,00 ,(0 =,0  !( ( !r]??Q00R0 S-LP P00S00S0P00Wr?Q00R0 S-LP00 P00S009r ? p-`PL@ Pzj00P30@ p p-`PL@ Paj00P30,@ p -L(M PU`@0S 0S0S{0Sz JTH DK0EUSP 8(@#h"x 4Ÿ40S;80S89 0 Qz 0@S.0S/+p 0wP" R㲀 0S0s 0S! R 0SJ  0 5P 0 1(K 0 000  0, X,  (Ko04(4 S :0  0ˠP @0 ,00 ,较ᑣ0S0S  P ,Wp8p -L0M 0 ㌢0 , S`@hQ*0S/PQ1P(Kr Pp0S 0S0s ,0,pSi LKLPKDK00K @P P 0H,K4@ @0PPH R d04000 0]w0S$[00S40S80S,@ 0P@AP0P0S00S 40S80SQ+ ,@p0@4[p@30 R f!P00S40sPyh$,<4 4:00p0h!DYpiQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1\ \ R 0S0S 00S0 \ 0  2  0 2P0 0  6A0AS -@LB      h 0- LP @   C0000 0-LM@PK fT K0hjnfT00  \a00 PQ K0 S K0 ,`P JKfNK0 (1K'!KN/KLL R000 0 0 ,6 2i -@LP6  -0LM0@T`p @T 0 R BePPT0007LP0P01 86 @P70P0( 00006 0Ke-KtLPPs0S 0  0 00 0@`> K6 CP1i p-P`L@ 6 t0PP700  PP@ p6 "P -@LPPp' 0S 0S PRl0S 6`t0$06P#2W 6l00NL1S L `P a0S SL`P000dE3 i -@L0ME+ R0 00  0 Q 0@00|  BR|  00IGKRU00S 00S40S80S \ dP 0> K.08 _l100S<0SWp<? p-L4M P@%I6 0GN R Q000 RKp`0S  ^K`P000 0F K.0㦢 80`l? -pP00`Q0LMSP, 6H0S|USx HPPrHK,T-0S x |0SaRt8 RUY H0S |0ST|H6 G@[T h0s \@0@0@0s 4@0@0@ P, 2d00d  '0@0Y@@b,G0[S@0[S?0[0S[P &04"48#P (KS P D7 R0,0 Y ,U  0 ) 0(0&(00@0@& `00 |0 0 p0P0 P )aS>?P d0 006SAxP d0 [K,0@0@k0@0@\ K.0㛡 k,-0S S/ @Kh ]cP5 000`)0 K.0x  jqK^c<9KᛐK圀K&@K04"49K$0 0 $0C, K 0KP 0S0 0001 xD0K6cxKdKကKK.cHğ\KdKcK&0L0 04"45KdKx -F@P   bP xECOK@c3( 0 d0K1 0K ! 1 x0 GP, x , KvP 0h0S 0010H3 d0KP b$ß0 d0Kc KL 04!45KdKx E@P   bP_ *ECOK@bd0K1 0K1 2( 0 ! x0 YGP, *, K (PC 0S0 0010X1 R j1 R  K.0 ᛠ, 80 j, :IP0 T1 R 0 K.0〠d iDjD1 R  K.0l, 80i , KP 0S0 0010]Z x0 R@ i<&04"43K<0 RH  K.0:, @80i;Ii i Qi PiFiRi Si !i ? -R  S LNMR`1 \ `4Q 1CQ 1CQ -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I `DP P@QJ@0`SE0SBpK_  _ K_@T00   1FSK00K\ `1t d pX`K~ o_XP80T@P40P@00L,0  XP T@ P L J_P 8@KP_0)D2X T XK E_`!pWGpWD 0SY H`K 1_HP80D@P40@@00<,0 XK HP D@ @ < ^Pp1X0 VOK_  _( (RK _`!6 K_K`` _|| ^\ `1 '1%!K^T00   eK_K^( (^`!6 `F` ^300XfF^pK`^  ^K ^4iiii ? -LM`pV 83PU,P  0 , PUE x0S(@$T@T@T 0S,0S 0iSl PJk `2 R ,  P00^00Sd V0 0,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0d,` ^RlʗRV 0 0bSPRXWVU P yiiJpH? -QL@R  UMRp` K\\0SY .SW T 0 \H .\F ^G  0 a?R0a 0PK0K_0[ K A [R A0B0S 00 RNK K []PK$]00 <0 &04"4  0 q]0 a 0 p-LMJOK`QL0 XPK@ S]0000#0Kp/n/n -LM⨐K =]0 8 '_ppX@KtPK`KDp0   pK嗀K,0 `pK_K|pK{K00 D (KP<< -1LS@ R lPGPp4 P2 GP 2PUU` \P  \P U" U00 0  00  0 00  00#0 UP#P P \  \PPiHi -LMPpPDa0S"$K,1@T T P0-@T2P0`0S 8 d8 d0S 0 @ P `p pP@ P`pc8`0S 8800 c8 Oc@P 40S& B[6@D#Dx 0BK80K7KB>@P 40S h0  Ph0 0h0KxB=xB=`0 9p -PLU'@KV GV0  PU `\0 00 pW | PUTQ0 H00  0 00b0  00C09p9p9p 0- 0RL@ * XPP 070 U 0 0C 0 0 -|pL0Sd`00 P LP 0 0@ 0$@xP00hhm9pJp -L80(qS00PU 90P0C0S90`(0 0@(0,@FUP 0R*0S`0 R 00 0@004@ 0) 0R:@`NPPP 7P ohm9pJpi9p$Wp -LDMh l P 0` Sp 4:W" H@K V0  @KG0KHKJU( O8PT  80S 0T0 7 0$0TP2 0 0@0@[(K ,0KP , 0R0%p *X \dP.` P)`,0 P00S0UP0 @L@ 0 00PP` @  T`0 TL@P0D U  P  04 8<0 0\4<1X Q   048`@ <,<$"* <4#:Q  q3RP` PUk `0V@0V@T\ 0 00fS G`0@T R000 щ 7`@T`H00 O0@ 0$@` ȟQ`@0000`0 `@00 0b 0l(00C0TP " 00@0@ 00@( 0$@劉G 00eW 0@'00@T0@Q 2@0x x|  048#,("(04"48#8d0 + )$h0 0@T h0l@R 2@0  l@P04"40e 0 TQ 20Sx&00l6QL6 Qy@60S`0 G`P` B  0`@484 <S  SP  SP\ d R`@00J,0 8 0 `$("(04d@,"48(#8j"(QX (I0 0Sw0J 8[(00UW5 Rşğ0R"0<0 0gPP `P 00S`@` 00@@ P 048Jp9p9p9phmiiQ@-; Q! Q `0 0@`0d@Q" Q(0 0@(0,@X0 0@X0\@R^ RS R@0 0@@0D@RPt2,t2t2s2s2R00 0@004@R80 0@80<@ 0 0@ 0$@0 0@0@0 0@0@0 0@0 @ 0@P0 0@P0T@H0 0@H0L@} -L MQ@ KP 0@S P*0P P@0 @Kh-0 Kh8i9p p-PPL` d00S p<$@8ph Y(? p-PPL` d00S \00`0p"$@8phvXX? -LHM pPC4`P+ d0 d@K@*Q0`P 40 00\0 r P$0Kp5@PT$LLt3$`D0 82P Kf3`b3`4iu2 -0L y)p3(iilm -Lp:R@`P Pׅ @PS*@0S  0 PP@S*@ U R (@P Q P@@ -L4M `Pr5 R UVppp(Kd0 4Z D@KP0 <KC0KDKP , .P 0S  v@P pP +" @,@߃m0 P # 0000PP : P 0P d0 0S L 0@H0 H `00H0:  H 000@@@ 8PH0 3PHv0((0@@@@@d0 L R H00 PH @ PL x0D-P(P m0P 0@H0 c Q:d 430 S H P0bS  :P0`@0DS:/.00Se@OH0  c00 000 `- 0S] 0Sh 0S^ 0Si 0H(0C8#8 $#$("<8#8"( 02 <2 0^#P " 00@0@2P`00@0@"|00@0@F `d$aH00  L ~OH L@ yO] 00S0C 0 0 00S0C 0 000S0C0000S0C00`APg 00SL 00SGPE 0SB 1 0( 0*m =OP6Jpi9p -LM0P @ $(,L<4,4" X@` K1/T, 10SPMPL  1 R O/KH.0 BQ\K@L K  0T/L0[SLA \KLK Mp3D 41 R \KL K oH TK0[0S@@NK(J( ^'b)P$\ 0 a m0 00V 0 R O/KLK.0 B\K@L K mP?F 0xoT00 R \KL K .L bTi9p??X??4??x?% -/RLpMp0 S 00 S0% :Pg 0 ` P0 3V ,+Vh ,V V( 0R0% :PP 3V000011`PP 0@S0% ~:P= 0$48#8 R`P<V 0Z0#X( hKqL0 \h0Kg K `@K, P hK0P 3 R᪁ 0 00K:Pk3@P $((K 0R0%@ J:T 0 0Ra`P0S 0S0% :P 0 @2  0 00KP 0 00R6:0V 00KP 0 0R':0q 00KP 0 0R:0O 00KֆP 0 0R :0@0 00R0% a*SD@KLKK0 L0KKKK,W 4 LK 0x@Pd 048 <:0RH0 00  L0K\ㄠ P t |0 p 刀 l`K ( 21C0!10\ W hK( 0K OS6`@K  BK!0  <(4"4!<( K0"p  00K^P# 0 0R:0B(0@P $(8pXi? -'QLPM@,P 0P `9 R-ᛀ(K(Q1 0/SQ:0000 (0(0 0@@pK 0 5K 1K\K'KP `TK[`K\PK&K, \K 0\Kx@KKpKw`KxPK,  088@T 0 JP0 @T@0[S ,PU  J0` :0 00,P ,2 @@@2!<,2!0K 0@tP 00Sx " 00@0@00Sk 20 C00@0@\ \022P22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222ȓ2282p2222ğD (0@Q`K0( ~(D} 0/S0㴃P ( I?0[0S1@ P,p 4  0㝃P00S " 00@0@00S " <0@1A00S " B?0@1 Aw00St " 00@0@i00Sf " 00@0@[00SX " 00@0@M00SJ " 00@0@?00S< " 00@0@100S. " 00@0@#00S " 00@0@00S " 00@0@00S " 00@0@00S " 00@0@0S00S " 00@0@00S " 00@0@@K$I0( \K,K0-@Pi+T,P 40 R TK K.0 0 }PJp -L|M0 ,0 ,@pP 2P h`0@,Z>0@ 8$H"00@0 @,0F} (K 0S 吀 ` b:VV @,: 0@ PP 0: R:@(,(P (,(" 00@0 @,0 ɟ! !=0@@8DHPUm ?Ud U :UD U=2@0h @hl TW'Z  >0@)084H1, 8@P $( 00KlP 0 0R0%` *(O,0U QUk U< l8 R 0,Pk0,KmfU U2@0( @(, T *:T( 8H 0@8H^ K.0@E 0Np(8,H 0@(8,HTU0ESU3U#:Z}Uk 2@0x x| ,&0~@Po H 2@00 04 " @00@Q@0D@2@0 Z A}2@08 @8< T,%0~pP,,p : 1 0\ MW|P' Q PQA @@AQPQAD00@( P F F00 000h0C 0y~0( p(000ğp8X`0@  4$D8X?ʚ;? -ࣟL M`0@pA P0`p 0'Su1   V WV ~z(K0S 0SX 0S (0K  #* !P,0:Sb @P PQ0MSp 0| P4 r 0/Sj40 D D0Sk S 0Sn S  <( 4"4)<(##$#(`p 040 , 0 0@4(0@q 0S0S0S (m~P0 0@0@ 0R0% 4:PP 00R  3 0 0@0 @jMcw0B~P4 0 R_  LZ 00S0 0 000S000 00K[P 0 0R0% *lL00S St 00S Sh> 0@ 8$H#9p 0-PL @R 0S0S R  /P @0$ S00 00K0i0? -LG$0&0 &0,i4i$ii -QLM# @P`p, ( @P 5", K  pf`0, K $K -`L_40@!0c480!0c4<0P 0c4D0 0c4C@@D0@ 00Q0 00Q D.P@10 R 00d  SH,0 0C# L0 蜙pPP喙P@ꫪPi -, 0LRP*L0 OR뙮, 0S*4@pD`@` s@X4<0,0 H8@H00 Qk,Pi -Li(Q0( ,S  3S001 001 R0P -L MQ@P 03SP KA0PF P0L/Sc2د2د2222222222222222222222222222222222222222242T2ܮ2د2د2-P^P 0PKhc0 KhC0 Kh;`0 `tpP0S @r#5\00 P@P~iJpx <9p,i4i(i -L4M@PP` 1KQ<R2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2̲2 222 2 2 2 2 2 282 2 2 2 2 2 2 2 220Q:0K vV0[00[ 01PڦpQ: &0Kv"[00SV&0[0(pQ:N0K( vVH0[00Q:0K vV0[00[ 01PvtIP? p-PSLMPK0C`@0%T  @0QPx@x -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K ov,0[S! -0[.@[01PY3T0V:*0K Zv3T)0[)0[1001*@[PP<T000 -LM"0K@ p;v3T!0[!0[00QQw@P00U00S +w1` T ` `tU* 0v PEv@ -L(M@0 Pl 0(K0 /  )0㢇Pllb 0 R 0 0( P @3T +T1 P PP p3T0000aa 0V 3T TP00P0 @QvNvh2@P  (K<T<T SM: 0V R*K?"[04"48#8 00@P  u+00h Z`*0p@0@P0h @PI,0T0h `@0p@P@P8,00h Jp -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0K7zP , 0R:0( ,0K(zP , 0R0% *8F0 EP00@Jp> -0LtM40 ,PW 0!7 0S L/9I 0@0/9I2P`0@  0'S-P00`S< .P0`0@0@"00@0 @2t(K0S @\6SX.10@#P ((wxP 00@0@"00@0 @ =! `0p0@0@-\> Q0S1 @pTE 0SB0S?0S<6><-P0`0@0@" 00@ 0$@< < #=0@8Hc 0S$0S00@0@" 00@ 0$@sQ0S[ \ ^ ^ T 0SV Q0SU 6 \f ^q ^N 6} \U \{ ^L ^ 00S S$48#80@3S,K<P0S 0S0S0Sp 0S0S 0S$0Sd >0`0S j0S d0#*> 0@*p -L RoPi -,@L; hbWp53 p-L lPD AnA#!B30b0020aA00 S0P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:40@0@WrphvBXi8piWp? -LlM1 `0S 0S 0S0C0 MRM.0orV 0wP\ d0PI00G:0 0 :0 0P P, 40@T `@p0 0@0@@D 40S 28 8< $6$ Ɵ/ TVpK 0.00`KUx .0Px40F, 0@A0S$  0 0Sx0Su0SrD5D 4`0ş`0p@@ T@D  ^o(KSVpK00 `K.0 x .0x,@ 0@xAhtY d0 0Sd F`0 00PW4@P P  0|Ss 0r4d, 6S0PSV 3 R 0@6Npp0S> S 0S S 442 Rp pR: R. R,*RI*P 0@P  0Sl 42 0Sp pS:0S S:0 W 00S0 0 0 P PF 0 AP +9P0S PP  0PA 40S " X00@X0\@`1@@P @D 0S 7^# ^@ (^  000Sp000l 00S Sa00S S_P JnP80`0@80<@40S 2H HL W H00@H0L@W #$Wp,WpJpiiPi??i p-L M)  0K@ `PP 0T Kp00e  TK :TP TP 0S0![ P P!K 0K(q -LM"3@0S0 Y 0 P0S "101202(K Y 0 z"00000202  :2<2) 00KPZ0` ` ,< $4 !$ 4,̂&<4 80 Xpe XL 0p 00 000 00RT R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"gP0Sw 00S S00S S *0Kkp"L 00S00SoloHWpHWp - 0L(S``OmpPm7Q PQA @@AQPQ100D000 00 (A(  ( ` 7` 0-0L@P EoP 1 0'S 0S S% 0S S  00h(qP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000= R5 h p-PL`@Um U  U U -p0V 0 00p0V 0  Q 00p0V 0 00pp 0 pi -pL@60h00d0 -q``.Q00SLP@ P { 00/U00S00=U00S0d00U00S P 0 0P { m001U00S 0P { `000#U00S 4P { S0403U00S 8P { F<pP8p 3P\ W4p20^p  p ^*`Q  Q3 33:^*\0 ` 0 X p Q* ^ ^:P -L4Mp4@W`P(@ h5 P7' 4@ 0p 0@ 0FS222<22-0(0 0S`$0S 0S@T5 @($KU R 0(0 U R4K24 0 Sr3   U R,K2,0S0ǕU 0S`0S0S0S Q 0SPjXK$2(@0 P0KO KT@ HK PKP010X (0  4PU 6Sc10(0 U 0S`0S0S0S Qo 0SPP70S8 @T@T U# &0S :2P R000 \Q0KK20PJ :P 6S0A/PP0(0 9)PP00S ("(04"400S1 S9 @T@T &0S 1P00(0 P] 0(0 P ( KxP 0S0 00p00S&04"4000S SDYpi -L M0#A(0 0 Qp2d2d2d2d2d2d22d2d2d2<2d2,2L222d2d2d2d2d2d2d2d2d222*$KPG 4PD 0P0a V(pgW@V   1PpphP0PK``gW@+:gP PpP`D@Ko1pP`P `P`PpP 8PP d0SpdP`p(PK`P l0p0,PK`,0 P PP`P 0Pp0,PK`,0 0-L@)R P f @0S*@ P fP 0 :RPPEg 0@ 0PP@\ 0S @0@ 0 :RP@  R-L@p`gPP T V @  0P+f1e77 -L0M`p,p @ P<)R@ h0 T0 P(KT+UD 89UA #3U0U,U0 .U *PTP8#8Ƞ*U【L 9U 3U0Un.Ul +U *PZ yePUUVZ 0SO P keUUE1 U* U"U0E<SN22222222222222222222222222222222h2T2@2,222222222222222222|22(2222220E , Q񟗯22t22|2L2l0   , Jf0 0 ,0P0U)U &PMl0#90,0 l0#:0,0 l080,0 l0#80,0 l0#;0,0 l0?,0 l0:0,0 l090,0 \)00S0,0 l0,0  00,0 ,0 0,0 l040,0 l0;0,0 &UYP1 Z 0S<0 E, <R<83t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t2t22t2t2t2t2t2t2t2t222|3P33X2t2(2t2t2t22t2t2t2t2t2t2t2t2t22t22t2t2t2t2|2PY l01l0,P 7 7PPl0l0Y l01l0,P77PPl0l0l01l0,P88PPl0l0l01l0,P88PPl0l0l01l0,P66PPl0l0^l0l0<<PPl0l0^l0l055PPl0l0l0^55PPl0l0l00/,K #P\? ^l0l011PPl0l0l0|^66PPl0l0ul0q^88PPl0l0jl0f^88PPl0l0_3S[,0SX00SU40SR80SO 5 R; ^I PH0 SPCAl0>^77PPl0l07l03^66PPl0l0,l0(^77PPl0l0!#U UD U( *P>U=U;U <UP>U=Ux;U <Ud 0P 0 00@ 9P 0K0H @PP#00P@KS 0 Y.0040 d 0 P.dP @ PU EPP#h2T22,22@2$UwUu #U U GP Ut U&Udl0Z   0S 0+PZS \0(K  !0 P Pl@U8 1UeZ6 0Sq0 @R" 0@1S SPP@a_PP\Z 0SU P00Q5U$7UF @UX 0Uc0 0 ,0P05U'P&U 0ES +Z 0S+0P,  P Pl0P00l0l0P0 0l0l0P 00l0P^ P DYp<! (R-LPp( B(0?eP @@0S1` cP  0 0 7`P 000 0 0 0 -LMP`UscP0 @0 0P <(4"4!< $K= 0 &- 000`P @ ZLcpP +b1^b77 0 @0 0 000  ,0@CbPp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`gbPP@q P  Da@Pl1 (@pp , @ 4 ,0K1@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0EdP!  R4 000,0) , )<)00`,08^a@PP7@(Kon -LMPPK p PK dK0 0 C, 9,W? 0Q  `K !@`P `a\~aX|aTza KP ua 0R \ (K4Q  \K !`P8Q  XK !`P`Q  TK ! `P`\0Q S  0 X0 S 0T0 S 0 @@TP00(@CT0*8#8 $#$("<8#8"( 0T R UL 00T  T0 <00`0S U; 0 0 `  `00`\0S U* 0< 0 \  \00\X0S( U 0+ 0 X0X  XP P0S0K`P0 [@ + " Bu+  L '0S$ 0S!0S0S P0@ 0K-`0  ,P2 0U `P 0SL +X00 @*\X0\@0K 0  W 80S< # d \0 $(:0S    R *8#4"<# #$# 00s 0@KP*0 xK0K*00K( ,0K 0 K0 ( 0`P0PV L0 0@L0P@0 ,0S " P00@P0T@0 R 0S W2 0S. 1<1,0S SE Q QH 0 S4KP0K8@K@`P40 S  4 W h0S 0S ` R 1@01,0&@K,  <0K ! BdPP`Y1 @01, ,6 0S S 0S Sf ,W l0 80SL,20Sp  p S:0SY RWS;: 0 P` P! "dP `P``f  m`PdPJAV &0Ɵ0 @0@,0S6 2PX0 0@X0\@  0S0S9 000 00S S%48#80P,00@ K-`P  P0S1<<1,P " 00@0@,6SDş0 0 @P0@P3` 2P 3`X0 0 @X0\@00S60 48#X000, 00S6 0 48#80 0 0 0,d00 0P@K${)@ @ J *180S44Q,$ 00S S00S S PS: 04O 3P40 X0S  ,00 40( ^`P,0S " `00@`0d@P00^U",`x0p0@Px0|@ 2p pt , 0`XPe 0V0 c^P(`,0S 2Ph0 0@(`h0l@@T @T 0 R B(PT  R 0S , Z0S ,6Q00S"^P\1  00S[ 00SQ "48#8 0 JW h0S  4 V  p00 @p0t@P 00S S.(V `0 0@`0d@R,0SO " h00@h0l@D\0S(`0S%,00%Jp ?i p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0K6cP  0R0% *T/D0@P0  x0 01 xJp> -LMP`4 P~ Pz 0]pPr H^P ,x ( @@0( 0@0 0`0Y0 a 0* B'V{  '`0 0@4 P PPPPPPP '0S8 00`K0S P P2<2'4 p!0 0@&0@"K * K2@40P S 0 S% S Y00 @O(K20`K<2'40 '2  2B  !2 !` t'c\9pm@< -@LT @T 0 R40S C R004   "000 @Tm p-TPL0Sp80 @`T  @Tphbmi p-@L x04"40 d`04"400 PR phG &P 00S ii p-LP0@ Ġ#Č` &P 00S 2h00 40 00040ph im 0-P0P@LMKP0`0 00P& 00@8mxmm -LMP,@pP 0R0%` ::VH  0S [ 00S0SD S1@0S 00S @T @T 0 R Bb&PT 040S 00S0C 0 0 (0KVaP ( 0R0%` *h.d2@P $(60ST 0SQ0SN0SK0SK 0 $("04 48#8! CP6 $#$ @T? @T< 0 Rpd B%P 00S0S0 0S-0S*0S'X8 40S Sბ0 4 0SQ 00S6 $#$("<8#8"( 00S>k0g  %P6 $#$("<8#8"( 0> 0004>9pMbiml0GS S S S S 5S p-`@L(P%0V00@ 0`p0( pS\8 0-D?2 -LLMl t p ]d lPp l00`0 2` pW\p  0\0 lP `0@ Sh $*t R@0  08R#21C@0\Z\ pWl R t0\p S @3@#d}(K @@% @  P[l00x < d0(0h , 063d0sW !\P`Q R@?< 0A 0$@|040p =0 t`V ) h`V! 8#X"B` 08P#(:h 00@   j`08V#(21C@0#Q0@ 0$@V K.0b8 Y,0@ 0$@\p0l@zi? -LMp0 唿W, 0`1P`U, PV,`U,$ W,0 Z:,$0 0  *0V(02,200 @ &"P,`UWP 00S P3P#,嫾(K|Wp S-`Lp@`PQPR00S`RU  SP ` V V*` X   `P00X00S U  N` | -L pj0`V 2P@T 0>CS0`Vh?@0$E D ,0( #5#3 0*3WpiiMb 0-|LP 800T0@  0@0< #5: /#3 00 0800uMb P-L \  R @T 0 S *01 0 S00@ 0(# _+]+?? 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q (0 K p@P26} P/ d0 , <@T/ 0S, ,"0 00@0@&?28Sm C8Ss02 0V 0 p  pW9 @$V/P@62 N K.0^  0@>(V@ x0P 28S02 00 I00"0 0Ba:0 pP@p 0 Pc 0 ;P\s8C0004 0 28@i?0iAMb$iP-d 00 S<^00S0S2S0T 00S 0 40$  08iA -L\M 8@KP`<  p1| R0 4 P# p0= 2S  V R4 ! ɯS"`X30 0 |.0` 2S 4 0x@K@` 0 4t0 l xr 0|(K4 02^WaviAPi0i p-(aPLP $0@S0S: TP $0@S 0S, T0P S! Th0 "@0S0Q S P 0 R 0S 6RL0QpA|Wpi@i 0-dPL@T T0h&H0 @@@0)0 0000h>i?|WpWpT.3Wp*3 -LM@!$0S$iqPU 4`V <2Q p QWz 20S?3?3?3p?3?3?3$?3>31 Q?001 1Ba0 i9P 00002 U U1 U (Kd@  0@PP 0S ` $P  P$@ 040 S X R X d@ 0S 80#$PKd@ 0Sl0X060@ Pp< 倓0 0 0 h` (UR 02d00Kd@0p 3p R0RP^  ⠶@Pw 000228 P4 v ! 00 08@pXn  ( 6S% LPK<4K&04"4 4KH 4 BD0 @ K@T @T 0 R BPTw!0@0000 @l0GS S S S 5S 80 P0S0SPm -L9p$?P%?h%?#?8%?$?$?<$?h$?p<%? -LM@P  <Kp LK,P T `V 7 RP7@P J(K 0R0%P T:U| \pK 0 \[48\lS \ &300  L0[S @KH PL0[S{ |PP@ 0PA00P 0R Y P 000f J  K.0jS@ K.0dS8 0X  ,0K0PP" , 0R0%P *[0[0S0\&04"45K5 Ry  K.05S o5@P $(n K.0!St [0[0S S,5 RP 4L|P5 RE  |A4 R t<K倮P4 R0 g,U m0 00S l4 R  K.0R m0D`M x0P X < R T 0XQ 2# S <0m @R@U@TC 0m Q 0 0 @ 8#8S2d00d0 P @PT P0 P 0TI PUc 0SW 0 U  2S2"0 0,U+Q  K.0WR@08 LU m0 00m 1\4 0 0 02A0"0,R00S d000m P  @ޮ @P4P$ &.0U00S  "1!0 sd0  W 2 00 R0 4 40x  0r00L D00 g%%?9pl&?%?@&?&?&?&?A0iL ?itP0S0SP@-0s l@0@0s H@0@0 @0@0s0@0 @Pi p-P0L@`TP @T 0S CPp|Wp -LDM0P\p 0S K +Pd0 `@K@<`d 0P0@ 0 \ XP T` p p-0LSP` p00S6 $#$ 0@x 4phGm3 -Lhd Q 0 R  0q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@ -h0L @@0S ,h@00C0"0 HiWp 0 eiWp -LUMP<0Kp@`  <Kt1 ,P h0 S?(K20p1   H7 <R<X ,7 R 7@P 6?<0[S 6 R <K K.0G Z;0[0S 0R0% :X d@KF P 0  48, K l tK (Ɵf K 048#8 $#$("(@P@PVt@ pP &Kx  <(4"4%&LTp!0T @tp$%0$#5 x%#3 000 0 4 8  <,$!$p1 , PpKXQ7 @`Q201`P-:0SQb 4 R  @  K.0NG@ K.0HG8 0\CP4@P $(%PQ 0S `\> 0 A< m0 00T7 3 R# <K K.0Gm0 D ,0KCP , 0R0% -*l83 R Tt@T 3 R  (h@ @ 0<K@ @_0Sk Se 0 S [K0 VK_1K`Kt"l 1[0 031K 1["# 001K[KK0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q {P@1[K #@+0 $(, <4!4"\ U!*D1 RQ  K.0|F 0PF00S0 R  K.0iF @p1 Rp0 p0R@1:@Tp%P%%*0 R!  K.0LF 0@@Ti <0 R  K.0:F 0T@ix,?,?-?<-?-?h-?o00C0S𠑴6@ -h0L  0 00 B( hi3 -LM`m@=P \R 00 000Sؑ+= @,@2x <2( &00*K"K)@K0 0: pp @@@@ 00`0 0 * B0 (`z0(0@@@@@@@ P+ m@ 0 @@ 00P 0!0@0 Hm $H 204$48#("48#80 S@0KP 0@@ᡡZ "P`00@0@"00@0@80@P @D$(KBpP& @ v @,0K  P 00 0S 0( 0 0 ,>pP@pP7 H00 @, 0 4@K bP  4<H R d040,0 p0  0#$#̠`#8 0v00,{ 0 :R0 q 0 R:0( @P70p0 u P4@0( l0( 20 ,K` 0 :R 6@0P 04 P,0S 2 0B0 @0@\ 񟗥(3p3833333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333Ȩ33X3 333x3@33Ц3,0S " 00@0@0S ,0S " 00@0@#0 0@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " B?0@1 A,0S " <0@1A,0S " 00@0@,0S " 00@0@t,0Sq " 00@0@f,0Sc " 00@0@X,0SU " 00@0@J,0SG " 00@0@P vP Y@@< 0(p` @i<XpX,<Xp -Lp(MPp`0@`, 0SL  0S 0S0S  HKP 0HKP H0KGK^3PU  S PUB @0 l0  v0S,0S00SJ , P0S 0S$0S P P0sU 00@0 @L0 0b ℨP"C 00@0@Xf l 20S.L06@HKP ,0MP @BT(K40S80S 8,8(00 @(0,@ 0su80si, K X% !0;@P l 10SZL >6@HKP ,0LPH8,8(00 @(0,@0,0 T(0Sy rP0`0@0@!  00@ 0$@;Y# Lο,P 2 (00@(0,@0 0c೽`0@PP PT v@BC8, KWpXpʚ;Jp -L,M QP`p0 8#8Qcꀱ343|3333Ȱ3ذ33303x3H333P3d33KW P  v00:@8$K 0@Sx @-@ 0 ( SP0S /@^9@tK@E U8@DPK0<K C0KDK 0@@@@D W @ U+@=2p uI@P?@P_ ሜ0 :@U 0SDPK @C0[S /@0@00}0S 1@x0S& 0S#0s S0S,@dH, 0(K2@PX(KN0 P 0 1@A(`0vP0  P  <0, ( 9 @(.?i iXp@<.?x.? -LM`S@P3h0P  pK3 0 @Pp   7Z K 7(K U$ 0S @0S/@0S1@ 0S 0S0s 0S 0S$0S(@Tg 8@0S 0SW ,0s,0 0 K9PP7@ 0 R(1"(1(0241"4101 #0 !p0p0@  0# #$#8`00 0HQ d04ᥧ, G  C202, l0 , 2(0H `@n$0S(0S9@e HKHPK0@K t[ǧPi@0H,,K @P*@PI3S@K ,i@P?@K|DYplo -L`p c P@ P! P9 T00PU0S+ b P@00P P P00W l`FpGW@ L@T0gG F`p(p@ @0.?xD?.?>@-@ pϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@pDYp_ N 0-@L P0h@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ U! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R8#8S    2  0(<P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S B@ 0S \ @`0d S:^ 0R B^a00@R0Sa@ R 0S0a@00 P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0pT("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq8<0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 008<Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@44t440% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_|33333333333333333 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4i4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d C@T*00(0S, 00000R00#3,05$ 02,0(00@c T: l# (0,00 d `4d (0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4(0,00 04d ,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S3|3d333333 4l333l33333333L3\33303T3333V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,==@==P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0c T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aLl0S 8!EB C800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n8~8 n8w88!da 0SC{[00hg00kI00+ n8V8R n8N8z E8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0 = =B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p = -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSP``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00f l0\00 RtZ\ R80 b0R l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z = =  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b09 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X = =  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00ll0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  @8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p = -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0H_44t44 = -LM@ 0 0=K>0` = j 0& 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@iiiG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0   = = G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0 =,== === -LDMh 0,& p`W6@d >d @0 SU 0 5 d  \ˁ\@ 0S0%d0h 00?@T  @TQ=0! $ş`K 10\ B ` ğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{P4p R@`   B10 \ h pP T  X 0\0 3 \㳐3 ! \ಐ0PU1> 0 L` A010 W`` 0 P0SH0\0Yil ,0Tl X0@װ 0#!T R 00" PU`Qw G@2 R 0> 0 0 Q0CRA l00 B 000`0 0C BS`0 W> 00L0 K L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL p( Id !d 10T\ @ 41 B8QX 00b0 0S0d0Y H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0 =@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+p&(+kԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q= ==0 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ >T@D@007@> -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  Q-L x> p-LM0PK  % @`P  0۾x[4 0- L@P 0h~xD?[4e -0L*p3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pL`@PL L8P$1( <0D $00HL!0C00wwww 0-0 hA  $0|  LPU͸0h蕝0  !$ $ !DH!<0H10oDYpLXpDYp2-@tAPr?0RW` Xc44c4@c4Lc4` B`p Bp` B`RE0C`R9`c4c4c4c4c4c4c4c4` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `d4d4d4d4` B`p Bp` B`p RpPP2-BtAP00O0RW` Pe4,e48e4De4` B`p Bp` B`RE0C`R9`e4e4e4e4e4e4e4e4` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `f4f4f4f4` B`p Bp` B`p RpP2-DtAP?O0RL` P 0Pjm 1PP0OxPa2 7@0L!t1*4 t t!40L0C0$KZpnZpTXpZpbp\p@0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L dXpXpTXpMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ :P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K Z 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KT p 8("(8Q, "*46*, (00S 0p \p  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 =<,< -L1? -L>0^0P0@ P* 0Y`p@00T*U U  0P J0SjZE Z p(o <<,<<\p1? -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V 7 K6p $ (    xv -Lp@@`  ,PvP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Qꄎ44p443p(K80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt 0;c0 0 5, 0 / TXp|2?2?T2?42?P=2? -LM@xPQ $3\ b  S] 2"S0"p 1E1@8 1 82XRR0S Z$ t"10@T ``"$KmP2 RJ D2D R ,, A0B%@Z$K1   0!!dpmPPLZ2 : Z18l1 0\T$KmH1 1R0 \a0@PLŠB%0P @`r1lci`f]c_ $KmYAl=|4?Zp?2?83?T3?xD?XpXp=3?@00$*!00|P@pp0 R8P\ L0R  K< hp80 4\pTXp\p@m4\p\p p-LMP !. 0@;>00 `+.  0;>0 0p0 Rt 00PxP\ P0R  K@Q hp 00PxTXp\pi@m4\p0\p@-X0@P R 0S \ R\p@-X0@P R 0S \ R\p,1p@- 1 L!1+ 11!>AK0@A P0PA 0`0` 0 0 0 0 0 0 0 0 @P`0?00?0 pL\p`\p \pp\p\p$\px\p\p\p[pP\pt\p<\p,4T\p\4d\p,\p\p8\p4\p\p\ph\pX\p\p@\p\\p(\p\p 0 R 0a B0l\p -LMP@ D 0 S S 8 < 4 p3p#0 <0 d34 080 >0>0S00 q <>D 0+ 00)@ 03@pŸ0SxD &D JZS D0 @46ZS#PP @): RdP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 p"Q0S P\ 1R , K, h`pV@D0J8ZD0 0(K)68; D #;1 4Q@p(0SD *JD P0\ 0R , K, hpnP\ 0R , K, hp\0\ 0 <0 P04 080 2 <' 4$0"4\p\pL\pTXp\p@m4\p\ph\pX\pt??H?? ?? p-``LM^P @ 0000@^Kp\p p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600p\p?? p-!:LM@ P0S bPY :#d1L R@ L000@ap81 RHxx ! 1 0S : 00 0`p0 RHxP\ 0R  K hpP\ T0R  KD hp_L\pTXp\p4\p @m4\p?? -L㸼 0 TmH\p00 R$0 Q! 00ºH\pii -0LM0S | 0@T00 KKhκL00.*@ @@@0@H\piii 0-0@0 0LP$0   R00 Rt rP ` `000@0  0@0$0)$1H\p\pmm?? -L(M\5T(2L2L ( BϠ01l80 " 0i8Q} 2@ < Pr 1  4K@ B0P @4 0 @)Pd4`VYH* @8`JVX=8 >$*(":X1 0"P- 2C 0S0$ *"%0L000Ppp0S P\ 0R , K, hp<   @< >80< S @@0(@ P@<(K48m$mAibpbpTXp\pL\p\p@m4 @?8@? -x3xsLMP00L 0, P U4 0So`@P E201^ 0"!B  APP0 " !B 000 Q P pP UYZ @: JT * P (JT:bRDB$r,0! 0! !0!0@1CD ?FD@b$J@$B!h!021Cc!@!08!81@ @@ rQ 0P孽 0P襽 0@坽0 P@唽D(KX 21C! cJ J|H\m\p@?@?TXp\pD\p \p\pmm\pZp0\pmmmm$i,A?mi4A?Tm :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D00D0  )G#&R:0R: 0a"!B10b @PP 0T0UD00D0  D1p81 R $1P1\ 1R , K, 0h0p 0h0$  0S@ 0p0` Rl0(`0P\ @0R , K0, hp6pTXp\p@m4\p 0-0LS@P 0SP1000T' h1S 0 T 01S 0S 0S  R00l00 0X   0 0 00P$00TXp\pDYpm - 0LS@ 0T0000TXp -LM@PP @ p4Q 0 pR Q 0\` @R^\aT P @D4\ @T \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S c0S h3Q d3 R 0RL3p0 *t00t!t t1 $ 0R10L o1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00\pDYpHXpn|\p \pmmTXp -LMP8  80e S030#U00 4 %*4 %!*! %::86S1\!t 0"!B Pm 00Si Xh:#u@T] [ 0Sw$&Rp:0Rm*0a"!B10b`002p2B RdV4  0 6%R55SSH0SL L R0R01!0ATD0`0óD0D0` 1ZU   @D0`00D00Q=4  4 0 ZXpP8 Rw00S 40SD 40 0S 14  (K` PP\ 0R , Kr, hp0 S  0S l8  20S 80(j0S 0$ 6pTXp\p=\p@m4 -LM`t PP X "&R :0R*0a"!B10b0<0 < p@@@@V  Y  (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< (#&R:0R*0a"!B10b< R$ D0< 7\ 0  \~ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN %RD5S<SH0S6L R0R01&0AT/ 5V2  <<<D0`00D08VI  @ @D0`00D0W@d <D0^ @[<0L < 5< D0`L Rgg5S[[4q 0S  l 0Si  4La0S 48  @ @pq008 d0TDp0S44 Zi 0f *:$  0SpZ p0CSS P\ 3R , K, hp?0SA t3(<WL0P00 0P V <3 Z(30 0 \ P @ @p%R55SSH0SL L R0R01"0ATD0`0óD0D0` `"Vv  @ @D0`00D0 P`40 0Sp  0S r 1LR<<D0`0D09@ R@Pp P ] !V*   %8P\ h1R 8, K4&8, hp8 <0< @p 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ h0HK 0S D0X ,0H0]H\p6p\pX\p=HXp|\pTXpA?\p@m4TmB? 0-LM \׭P0 04PT@j80q,0 0t8mHXpbp P-LPF 1h1S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0PDYp\pTXp -LM0!00Pp0eS P\5\, K , hp@T0D6P0D4@G@5p:#:S/,5,%$PQ,KP} '*(":10"P 2C 0S0 ,00*"%0㔤0@p0pTS*㙮hP :*#:"*S6*H4H$$@Q  0P? 8000 %*(":10"P 2C 0S0 000*"%0㔣0@p0pS*YXd#0@Pp9X< PX43<#$Q,K!P p2 0P 8, <!*(":10,\"s 2C 0S0j <:#5  X040 p0S]*< p0S <P\ 2R <, K<,*hp  8 21C <0f0000 ;+ 0 06P 80,0 0KPKpP\ 1R 0 K0 hp 4P0\ 0R 40 K|40 p0hdp*P\ H0R , K(d, hp%0\pTXp\pm\p@m4moX\pmL\pm0 !Р!0 ! ! 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0|jiixiiepap -LM3cDt#\0s dC0S XC0S ( ("$0嘲,30p42 "P< n 0Sk @Pᅲt OK㒫2~Ϡ "K(2 $ ȟᏫ<0 0<PPZ0S? ``p p, 8R ," 60Q*42@02 " 4 1 <02 P4 UJ,," 6`0 pS1娑XA'$"|SG(K82L!082 08",S00S, 0ESx5l5`5H5H5H5H5H5H5H5T5H5H5H5H5H5H5H5H50S @0SN "8"8 #$ޱ|۱tرlձu3`pTXp|jiiXB?\p|B?apep\p>B?B?@B4B?B?B?B?B?B?B? 0-LM0PS K@P K0S@00p @  0@@TXp p-00L ` HP`N@^P@@eN@ 0,0 L 0L0H p;\piB? -LM00 ( H >~p@g00^0L PFU@`H@ $@K,0  $ 40MZUzj Ki\pC?Ag 0-LM   $ h(0 L!P + 0.L? 0L!.@ L1:40  4PL1L@E@0L!L ($Q( 0800` E`0$0004 K0tXDYpd4A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhip@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4S@i40 $ R ((0"4S@i 0@i 0  n -l LM0S 00LH0H@ @@@0dP ,0 $Ym,=iidi  AC? P0-L 1R 1 0xA00hQ 0u0T!S S00S@ 0S S00SQ00 R R 0 -R R0Q @a0AS`&5&5X&5P&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5H&5X/ 0Q00@ @ + DSBOnbptipi0C? -LMaPyB , K00Kt;0匧,`.VtǟtP@fhhwhǟ$F@`XǟX 0E`PD$0 40b#6`P0X6 @T:00C)0:`0*V0c140 ! I@9#9S &@0^:6BAD@L*T0 1`0b*V0PXw I$ITsş0 C\em:00C *00 C\U\:0弥0C05 *şl 0B10a\0TD:0 0C0T5*ϥ@ş 0B1\0a0-:0 0C04*㸥ğ 0B1\0a0:0 0C04*㡥ğX 0B1\l0a0:0 0C0L4*㊥8ğ 0B10a^0:4L*t#SA E2T PC  Z @C0PßS@ ^xN@PƠ`@&L0@  0e@~Ÿ: @w: @p: @i": @b4 9@[HB{o  @P: PT,2 l<2 0;0>0>0 a"&1 p!A  $ T1!18LML4FA8!818 414!01 B !0 4 "0 00 P<t (K\C?di|C?epep bpxibpbpC?bpcpbpbpbpepZpbpbpcpXepA?0\p!ap HXp,=iTXpUUUUZpn<4i4i 4i\pC?C?HC?P 0-SL@  @l0  "!  |ܩxک-*`ө(Bf n =B?  S  vB忩i4D?XD?|D?D? 0-LM@P |孩)㋍8`P:XP0c 0K P$0$唩xiD?tiD? -L(咊 0 h<0?i -LM0$PK@%@(D@0  p-P@ W 00;00W1  $K(PT,0K` 050 A$,t0x@,0K40 0@ (P0 0090008P 4@P04K@$0H0e/>0 ,0 009000 @Un -LMPp@@P 0  (0D `p@P V 00;00$0   '@Un -0L -0L000   p-0@`L P`@p0O50@- @$T P@  @ 00 0 00bS- 0 $400`S - L  @$B (0  -0L00p p-LM@Pㅡ0U` U U x1 /x0 03R0S48 L#ȠR6565656565 MP pP) @P <1Q Q 0RS 0R S 0 0  0 ܧ 0 ֧ x@0@0 ˧P0 c0\ 0L 廧 08 嵧mT==D?XE?D? E?tE?pE?E?E?E?E? -LM80,$ Q0 ֧E?E? p-00P@LqT0`  0 §p0D0S 3S@p 0崧5宧20940386<5 0 \1PX!X 70S9088;<: 01@qP&>Q @gP phz 0phqo20 @ ebx^p[hX20,XS LO20,E?z>(G?8F?l>>F?G?F?LF?xD?F?F?F?tF?F?\F? -0L0S S S@ 0TLH @DksP 41CcM<Tn4G? 0-00L0p0C0SPࠃ @^   0.020 ^,;5,;5h;5;5;5 <5P<5<5H;5:5:5P;5H;5\;5 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)q0h<lG? 0-@L<(0S08āPP<0 p-P@L<Q `3:QӦ R0 000 0 (0 B("(( R `00m<p `R0000 0 p`G? 0-LP@g< @p0hL< p-`L@V< P@<PUPp p-`PLH< @T R0000 0  %<p p- P@`L.<0S@  R0000 0  @ <p 0-LMP0 K@0  < R0000 0  0R Q ; R P0000 0 RK0?5 0-@LP;00CS000@@;0 p-`LP;@@@;Tp -`pL@P :PP [0P EPP , 0-@PLP 0v;P;0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 >; -@LG;8 0C8#88 S ';ho p-PL0@`` p%;0S000 `@@;{p -L@hL - P@`L;0S00p0 0@@0p:4 0-LM0@ PK00l0p0lP:l0S H0 {ql0S:p K0T0==5G? -L Mp0`$ K@$0 :  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 q8SY:$ R P000 0 0$ RK?5G? -LM@O:0S ,0 p0S h,:G? -L,Ml4`K@pP$@ P KL@K$ 0(t0=?5 0-Pt@LΛ0hep -LPpX  `ș@P @C0 `P 0tpep' -L4M0 8PK( @p` $KXK  0q@` P V@P    c,@Td`0=?5 -LpP`@P P 0000 P` %%%Ġ_0 P0pPn -LpP`@P P 000 00P 00Cp0}PO -LPp`r@P P 00 00P `؛@0V01#Z 0 pUP' -LPp`I@P P 00 00P `寛V010# 0 p.P 0-PL'@P P D0U<0 0 0 P0P00u' 0-2P LP@P P 00000 0 P0P0 -LMP `pP0@P P 8 0 0 0 pwP' 0-LM@PP@ 0$ _:.  ボ    {$  w@x8 0-PL@P P 00$0 P0 Pa0' - L@fP  ޡh5G?-  F8 -@L 0hfp p-@pL ph3 fp -LpPP`@P  4z00pP `z fpO5o< -L`pHP@P  0dz,0`pPz fpO5o< -L Mx@T K\ 0Tx@@b@T8 4$0@WKhGlmG?epG?fp -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0@PP7 04SP1Z00j 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P#PP"#P0 SP R00 0S 0 480 00S 0 480@P1= N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |?08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040G? -LPp`@P P 000$ 0"U0P  0Pg -0LS@`LPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 pN00( R00 R 0(Px0 00 0 000000C2Cp 㞚P 0 0  `P ` -0LSPpF 0SpB `P p=  {00 P600;000p PpP0:0 00 @ @[@B Z (0S|Z5Z5 Z5 Z5pZ5Z5Z50[0 R 06P  9P p 0 00[0$ 00b $0[ | Y (0%0[0 Y (00[00[0 pPspꈡ? 0-Ld\P P1\ H1\00 0`Q! 0$ :P 0ă \ #\ @ 0S@ S Q PT $xhCTP P 1=i -LM0R pO , 4 P`,  VP- 0`S0S'8 @P 4 7P0 0  .84000P 0R ,P ,(K Q-L蘡? -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@2 p "20 ٛx@T ^ 0S[ 0CS2i5i5i5ti5hh5Rl20  Rt20 Xv j5j5j5i5i5i5i5i5i5i5i5i5i5j5$j5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5,j5圛x 0. 0SP U0S 匛x 0PS@ QQ 0A0_S2l|x P0@S(K>0D!0<n42000SPbx0P @RYx Ux Qx Mx Ix 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ.z>??????D?4?<>?0?(?8?@?H?P?`????t?? Q-L@蘴? -LMp`P`' >PP` 0@00@0@T4| (0|`庠p000 0S P W`` >(K0S 2W02 : ѕ@P 3  <`: Ǔ:ゕV W`2 |000 Q <0 @R zR{ R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q`C 202202  202,04@KS!2(022003 S2ձ02ű0 4P zpPY 80S 2 81 -+ 1Xz`2 `   =}X1 -[`Rp0Sl$ >P 1!-2:2@2<2  P 0S: P 000   뼠 :㾔xxP6 40 RdْP_< : ŒP` W:5i1=1=\5j53535>0@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$$@P! 2`U,w`P2 00 0SxP G=` <= -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Z@ -L M P`0p7P  P 2 L 0S@ 0S P@(K>0 !0QP 0 0P)08 <041S,0  p @,0@S 0pS Z I > s n1=i' p-0PL2`S@2@Spq00r S\ o80Q 0Q   0CQ 0-LP@0h -L@P T, hu0  !  !u -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0ɗ03S0 @00h店@040TP H⯗xh4媗00$P夗iiP?xD?(u5?`?p? -RL(M000 `  L0 \㜒pP  !PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040,>0"0H@Qt0@uL  R  VpPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P ޑ 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  㨑@0s PH K `P`(KY0P`0P`ᏑP`㉑P`ბ N1= 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` ㊑PP p# @P p 0 0p00 R0 P0  !40 00pW00  %0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pl0 -LpP`@P P P 00 00G0P0p`0000xPJ N -Lpn`P @  0L 0'̠''D;0(T @0pPU@'@  p-L`PK@P P  0, 0f0C P0`:P p@ 0"200 0p0C0Ss0S 0@ <0= $$R 0A0 0; -pL@` ぐPP p @P p  0 0_0C p P0  0#$ 0 pW 4" 0$ R pX0u -L@` IPP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p!܏0u -pL@` PP p @P p  0| 0_0C p P0  03 0 "4 0ypKW 嬏+0u -@Lp ُP @2 ^PP @) p$00 0` S$P5Ą5055555d55p55$5[ 0  00 ;05@T0#30e@@\0 @00 30 0  BⓍ0 @:0@T00 [0 0030 0 + @T o[0 0030 0 + @T W @\0 @00 30 0  BH0 @:0@T0000[00 0""Ġ " 030 0 + @wTr03 0 "#  0 #200b[0 0030 0 + @TTO000K[00 \0#? 0o@A= [0 00 ;0`@2T-0#30 !  000  00\00    0 :0=@ 0u -L@PT 㩎`P e .@P \ T0 0x10 R0 `0  !40 00XDP@hp0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT0u0Sp5t5x5|55 -Lp P`@P P l 00 P ` C0W0000&4 0`Pa p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K ͍p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P_P0D@T ;J -LMPp@`$@ 凍P   $0K `@@@@P $Q 00  00  * K -L MP $ 2pL@1U`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @ K0 @ N -L,M@`,@ p PP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @れ(K@{(0 @o N -L M@`,@ p坌PP @( 0K ,0K@@@ p'@P,0S@ ,0 ,   ,0 0 R T0 G@3(K0 V@ N -`LepPW d0( 008,d 0@40" P T 0 00 @*00 '7<?r ,@ $P0 0bQ 00  0  1R0ы̋'88# '40$ 80 i  ߋ00ꀦ?8>WEV5? 0-DL!88#P!Xs@P 0 8( 40bS80 000hm0i -LM  046茓55 -LM) 0'6茓55 p-0( LP,@l` Rȕ5555\5Ԕ5555|5 0S0C 00 8+0@00 <0 $)a0v^$@#ph)p0 0 00Cs 0 ph800 $)a0v0K<0ph8h0@0$ 8< P@$08<0 -L$M 4 ,000 0@P^4@2] 0, PS 0 t@(0D $@0 0DD08 020@iP@@p0D64D20  Py6 0W*(( (h(%D P`@ W :;0@!0 H008 ,1 p0,l00v A00 <02 (K (Ko<0s 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,XP 0 C(Ko0u5 p-DL!88#P!q`P 0@ 0@0008 ;00< f#@"V phl0"0@0 pp CphmlpF#@"i 8 8-#TL%`q@P 0@ Rl0psu BqPU hu@l.0" "2 KfC  2<2i Q- L Q 0C@000S A  - 88LM#DP$&q`P 0@ kp0 ̠upP@0T X,@ @@S 2Tp 0, ppP202Q tk2T0-.2 Pp W T .72 02 ./pP2T02P 2p02 .p0 3i 0-PL@%@u60pu05 p-`@`0 S00Ɓ0,( L0LPN2  0\ 0Q000CO@M4 |K (d00X0phuꄀ51=xD?5LD5 -LMK 0 K4= -P L d M@8 &YppP 0@ )k@$K 9T ,9T} K0CT 0CT 9T 0S@= k9T '9T Xp9T :c h0 @\PqP 0P1S1S0ha0h1= -L0M0P<0 ,0 00 40 80 pPF0FP Pp`( @@K P 80K @@@PP @0S 0S 202 /  0 + Pp` ~@ 0 0S<0S< 0 Sk d Sh  Se (KP000~P Pp`<00S S| @3<#0S 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@<P0 P4p`<0  S S%0 48p` 0P - 88@#tLMP'd`P 0@ _P 2 _ P0 hPP p0W Z,p ppS 2WP , 0mdPQ0"42 02 h_0" W-.208#82.]PP W2"02OP 2P02..0 tP0i - 8 8LM#T%ndPp 0@ p 9_ P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,0i -LMpT2pD2@"0 S2<24$S2ס(92ǡ n, 0!0Q000OOǁ! IkX0" Z 2R PE 2=Y@ aN0 00 00`嗁0@728厁L0@K{ { %P00S 0h(K0 00   `  <Y @0UiIJ51=xD?̽5LD5?ud@vd ?(? p-2 1C`L P hR0000 0  000 @Tphtgp0o p-P@ `L0S R0000 0   ph$ 0@p-LP`Sp5h5`55555\币@ $P 28 1C0P `0p@@@4?tgp 0-0@LP 0 EPPU@0tgpDYptmN  0O   ! -- -o 0-0L00@HPl@ G`0S  00h xD?5 -0Lzp3 p-LM @0Ps ,`K z00 ,0 02K0@ $0 0 P 0W`Kp<>5 -LM ("(\`0 ,      0  P(K0S$, @ @DptG T,0Y+ 0S= T  PPp@DtGP0 PPp@ @T :  PPp  0SQ0 PPW  PPp0 PP -LMK@ K0K!(0K@ @rK -LMȠ@ K,(00K @@`K -LMȠ@ 0,(0@OK, 0S  R0gp p-0LM K [PQPRPU`0@l0K  0KP PP01K0![04"48#Kpgpxm|m 0-0LMK [@Q@R@TpP0\0 0KK @P00K0[K0gpxm|m -L$M 5@P`@PXT d0`8T#V00PV00S (KmPjUpa@^@HT~ IV 4pPWZY00 Z8 ,0 pGC@@@HTu J83pP,, W, RZ 0R0ZY40 000 S@ L < 0  0 80S <Q 4 Rk L0S[000Z 0 k PJ4XJ PJ  xWzL R @  x @Tk P d@@HTv@@HTll@@HT@@HTuu0H P4 D  P -081@P' P "80@!0<4 0! R R R`̐P`|Py D H sD00D0 Rm@0j  x @T b PR [ 0@PTP< ??x? 0-$P@LP 0t0}m -L@ 0P萧? PP-L +P)PpP`@P PP@Vp TWUNPLP @PU@T 0MP蠧?? -܏0L>@0IPPW JaP; Pn P `NAP GP #P AP P HP }U# JxPs -U .U ,0E@Tl@i1 (0E0S-0E0S-U TTxpW ~0S V> P b#P AP.U,U``\ /UZ ,0E@TY.U =9'PF =5'Pf VLU6 .U> =+3P ='4PA T|0,S 0P,o .Ua V/U?P{@ |mw uUP \Pq,0E0Sm?iPHmi ?`P4mc ?P m] ?PWmVPS,0E0Sh|0,SLHPH?P ?P@@l< :?P6GP2@pl. ,JUHU KU,MP MP MP GPlLU MU"P?PkUP P| MP0E0)US+U*UP  L0E0SVH0E0S~+zTkOu\Pq OqPU@mNi kOcP<_ X[1P VETyPPQPL\P HP@D$l>AP*@:@PXj 3P /@ +'{Pl@#P@\P P@pkHW 0(S: H PM "`P00NPP@PV@\PXi~N`P}@PyV@\P$i@wNpPn$@P @lOP% OPuF@qX1Pphs j8P  |8P MP TP TP TP TP TP  8P 7P 7P 7P 7P 7P  7P* 7P2 t7P8 P> PE PL PS PZ Pa 7Pj 6Pu 6P3 P3 @PfA;P@=`9@6T 2@/T!+@(T"$@!TPf H0E0SP Pe00LUP|@xtplhd`4e[LUY?UP ePLU* MUB LUJ!PF@*B P>d9L0EpWl0E0)US@@+U*U T+U*U0P2 W? Pd00P0]P,E4P(&P$XPc,|P@xP tPpPlh d`@c ,0E0S?ViPI ?RlP"NPb?HPb.U,U /U?<P@7b H1P@-|0,Sxb?$ P AB0b |0,S|? Px' ptIPann@ MULUl NUniMULUC NUO@`P ?jPaS=pPpaMMULU6 NU4 8X1PF !P8a C0@St`zbP ?jP`/V@\P`k @L@XP`_H gp PP> @Q10Sa HI10 SFC10S$b >; >820SLb 7?6P0tb0W.$20 S)h20Sb{ ! ! P ! @ bp  20" S bd  P @P cY,C@T -P /P`cIl30 SoPc=43PPc2 P @oPc(?xsP ?trP ?phPd ?k`P ?gbP(d44P-P /P\dh40 SPd P @Pd" P" @Pd|4PwOPdq5PloPef(5PawP@5P1iL +*+ P'j> !rP jl 3@Pjh qP^$jd?P@Hj /@l php|j b yAuBj oj;0P1j7zPj4 P*j0\@3 j*\@z[ k$ 0,0p|mxm}m -!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 ꨫ? p-LM00 KP@4 `0K(0c K"(@P @P 00 sKp00ث? p-xLP@s0`00 X04 @0P P0D H0H H08L 8@P`  ph?6D666kp 0-LMP@K dPK0 p-LM@ PK `m P@ v00Kp -LM@0K 0K @GK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @K 0-LM0@00 #\ K0PP[h ! s 0 008s8\,s00800>N0@!@`dPP > 0d 0V05 jVJZ/  IZ,K 00K噧Pp0p0L00p0 R P\0 \h , hpjVJZ0(K 00b 00i\pTXp\p@m4 -PL `,p ,@ ,J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1ohpiphp0okphp -d0L M R @Kܭ?>? 0-L@ `0P?0d0D!s "Q 0 b 0hkpkpkp(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭhkp -0L6f 0bSQ0@l  > 0bSp0 VZP帀b00C 0@ c0 ` %0 VJ0L0cR01 S 0 S$0`` 06 06$0`kpmkpkpkpmkpkp -1LM졟d 1!\03 4K P,0  "!8 4`K04@K0TT f 40SG DD!0 fÁ0`S0c!S 18 0!! A00  V V 0  {0 06 &06&0C6X 0@ 0@19p0 (K00SUDnkpHn kpMbkpAT? imm\?$i,6kpkp(ikp06 &0C6 B&0600 0 S  -@LP d -@LP X00 p-LM@P]i400  `P  xhLi`p 0@0h04 0\040 \0@ 4h0\xhl??? -00 LR 0cp3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<b@<@00 ( $@ IKp5656l36036H5646L46t?5 -Lh0040 \d -Lh0040 \d -L`{dPPU 004 ,@ 0;P0 410*0`PRhA0S 0P  0 K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```LdgDag<^g4[g,Xgkpgpd?kpiЮ???D?|? -40LQ 0 ap3kp 0- @LP P 0  4     4P@0 -RL M@0 , 40 PPEpp W@ 0  P1("(R R ! ` % `Z0  Ph0 P` P  ,4000S(KV 0 p-LM@ `$0KP K0 0K$% P$0 eKp? -L(M` @0  P (0340 5|*0P<0 QWÙ0 ,0 10 40PUO 0@   00 cp08 #0R00 <0 cp, WÙ ,K80  p@ 0<00<0 80\  ,0pQe0 40PU< \|30|30 <0\d0S $K0 @sSPP`0 0 0P  0Hd0 ,d di(?d??P? -L M3#@P `D0@@@S#0 @@@Sq08O0 0 0&30S 0S30S 0S00|3 x0m\0 K|PKhcDDc|,c,$c꠰??iC6B6tB6d??̰?P? 0 000$00 ( ,0H6H6$I6H6 0- -@0L  4cm? -LM Pp 0 4<L`, L,0K T0(0K$ K$D@$0S 0L< P@((@Ac KPP ( @ @P 0S P0S 0L<   00L< 갱?kp -0L`PVp# 0S @1@S 0   08P `V\b0P @T 8b4 0$T0 0 ,i?kpp?i@i -\0LM 0 K00   00 0 0 s00 0 0vC KdiL6 -@Lbq b0?@?00  -$ L@b hsBkpxD?K6 -40LQ 0]p3kp0  -L9cL? -L3cl? p-LP`ᅚP pN@@N^P@@e0 phؠi -LM`@LPN>00~N@1p@dDPP > 0d 0W05JWZ/ 㞗Z,K 00KP`0`0L00p0 R P\0 \h H, hJpWZ0t(K 00b 00i\pTXp\p@m400s0@i p-LM@4P 0 0   P Txhaិ`04 `l,0P x xha ?=!?R 0S p 0P p0 P p-L M8`K@P ZT080K@ 002K2K0 K1 K\08,0 rP Dva2[2[   maKpha0u?8?? p-L M8!@0PSKp8`K fZ@3@  U002K2K0K1K8 KX08,0 rP @E AQ 3E <+E<Xi 8 8-#LP(A@P 818 Q `0pE`P0S@3  0@`P D;@3`D;0@3-0 P`Xi 8 8-#TpL%@Pp P0 20p(P0T0` @u( ;*0P p *0P(ySP @`0 q@(Xi -LM  0m&b6 -LM) 0m&b6 -LM0 D 0 ",0  9ᘀ, (`dp@F Q%00 t0 &X3@S0 1A0 04! Ӹ?/@c,00 (80 A8A0@ 0@ R8T ?< 0 ?8#808#8?@ ?8#808#8?0 00  ?8#8 08#8?0 080 100H 0$! D8PPP <^(K/q(Ko6S ش? -8!L80Pd4qV 0 @)0C\h 0-<1LS@P<1 0C<1X#J<1SbP0 -LBM 14aP<0(!01KR,a6a6$b6Lb6,b64b6?@X3S(d]800 <)a0CƯ<10<1K,Q  GOK8 (?A???xD? p-DP!88#L!D?`P0@0 @30@0008 ;00< @_<V ph:l>p 08(P0@0>@> ph9p@8Xi 0-L@P4lC}0C04[6 Q-L@ Q 818g8k`8k818gD0-n 1$0   'An -LhM0<1t 8t IW 80]408!0 0#  BP]ωmK@ R@ T 00@ (P R00,S\8n8g1S00t F\{? 2 @ @@ @@;@ 2n/@H_DCHS%0P'\yO0@DPKN fTb /U088#8 ϠD K8 3KrmP (t \tL  2 0\C01$K1P0C0C0`|0 0h |`@PpHP`#H8P `DSHc0%hyO`[0@DPK DPK T08 Ƞ,ȠD0KU ?> K80 K"mP t[0   T 08 Ƞ,ȠD0K ?> K80 K mP t[0 0 p_DCHS%@ P[aAh?p??X?`6 ??(?P?FB?8 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PK3rh0 8#808#800 0 B4 p8ph p-0L @` P 0(0Rh08#808#80 8 phfK2 -L$M# 200l1 0(K@,0 fPLŸR00 y00! (Ÿ0 tX00 c oX0008 < 00i10 > 600F 3@C 8^@4@ 0  @c@Sd Y@ ,0{fP 00 00! (\ 40S 0  0#X<8@00i10 0 >@0400:@e3 X3 0004 \XPH}<,(ȯHw6?ķ?Է?\????|??? -LMp 200l>@ TP 04 @`=Up20 fP( 00  G0@6 0T R P0000r P 0 W000tU@ 0@W0@000]$KP 0  00 00xW000G000>0$ bP` 0 0@  0@$ 000$ bQڰ08\{P000  0 @2WWȯ ?l?8???? 0- L0P@Ke/0h ȯ p-PL@8`xdP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40(c0pp>ĸ?? - 0L00S@ 00S00 00Se0 0  -L M<`Kp@ PO0<0K0 60K@?4 K7@KSK00 5 KgP3[8#8 K -L M@pK0@ `sO0  @ 09 K!@0K080K4  hQPP 0l3K0P ,` gP@ Q K ^0@0K18 K40 9 K3[8#8} Q !`P 0 S0%Ll2@l 0 0!rT@2 !  0`00S0 W00P0S@T R@@1 `@#`? -@ LP  @0 0 - 0LS@ 00 0 l  000000$ 00sS 0S 0  $ mmQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0mmm -,L\ \ mm 0-0 @@ @ @ @RLP t0S pl 0t@0R Q0 0#0@00 SQ00  0000 00 S (0"( R-L 0R 0CR h :h 9h : -LM`0 QPk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K0<00 PUQ W \P\ 0l@L00Tq @PP ;(; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K  O ;q 0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLP hWD0W@ ; 80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 KpmmimmPH 0P 0Q \0SX0S  i-00 Ƞ Ƞ,1XP i -LHM\@`  #(4\ :40S P 4\! 63\k D3\ 3\ p  0lP3\ 3\ 3\ |3\@< Sh$0< S<1S7\P P,3\= 2\ 0\o 3\PIP2\ 0\z 2\2\ 2\J 2\|0P       00  0P0 0 0 0p  0lP  00p!0 %uPPC  m 0R 1  iuPP@[0P     00 Nh P$010H  0P0  =p | |PPz . 8 Jh$vh 0XPPh1W W WW @W W@WWW@ W @iW WWi -LM\ 0\ 0\ XP, ,1 P0\ 0p XQ 00S00XP ,1 r 0, Q}f~fvt|f 0-LMP@@0@0CS088@- @.@i -h0L Ƞ Ƞ,A0S 0400c00CS0hi 0-0 (("ALXPU 0 X0 \0S 0 0 PP Qi? Q-LPй? - (L(" PP#0AT PP 0SP \0SX`VP 4pi0H0PP X`RPi p-X@LT` 0 ! PaU  " 10`!Pp^0S0Sp0, ph, ph4Q000S ܹ? p-\0LSPx0SX1  X@T% 0S" g0`0CS0000 R001^0S30S*0 31C P &0Q!ژ 0 S00 S P0 ʿpP9P0, 100emA?; SP 00S6= -L@Q 6686\6ԙ6000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\ $i-00 Ƞ Ƞ,1XP @i-00 Ƞ Ƞ,1XP @i 0-D0 (("ALXPU 30X00@i -qL0PS0AT%  ̠@0`P% V !TE T1 0T0V@  Ds@P ,0 A$ LL@D? ? -L@P \0SX0S T Q0Q \0Sh -P`LMUp:@3U&4 03U' 2$3U= 0U 0CU X0S$ l@T `0 0 `@P`TV 2U 2UXP ,1 P P2U %0CU0S| S[ XQ 00S00lP `P 00 R 0R1U 1UlP \ 00  00`PXPU P`/",000bS XP ,1 r 0, ^m+ 2  @0V@@0M@X0S0Sqm0,  00OaWbWvt}f`WcW@- @.@@i  - L@pPP 0S \0SX`V 4@0H0H 88 #Q 01S 00="Rdi p-<2LS 00pdBP `F0S ph-000 0@@0 -LP 0@R 01S 0 10<P  di 0-Lx 0@R01S 0 10<P  f PP  C 0h>0diD 0R0!R00 10<P di Q-LOJd? 0-0L@010PS * R% 000 00S0 fS 00S0 0hn R <0 R 0  0 kpkpkp 0-0LS@00PS 0  =0S0h=p? 0-L@P0h p-L`P@T" @T" R0000 0      0P0S0@TW0  mkpx? p-L`P@T @T' R0000 0 00006P 00S0@T! iP(@T0   mkpkp? p-L@P P 0S pK0`  R l05*  @@ 00P0R 4zph$uR00kp mmkpkp0QD@2P 00 0-@0P@2L0@20 =R00800P8008P0 0-0 L80PS \ 0CQ 0 dP 0 0d20 0 @&$xim m -L M0P=2S @2* `2ST1 R8Ph$K0K0`Kl0(t `VpQ:J0P18T?D3cQa 0P@2 0=2@P S 0@00 @20@20 @2 `2S ^&0 @20@28 T0, 0S0C00=@`p kpMb -LlM0ğ @.`0 =rW@ 3Q 3Qz 3QH 3Qc @(K3Q 1Q 0B~S1 0< RN L@K3\` `0 XpKTp 00lPK80080 PU 00 00K0 @0^!0 @ 0 K p0 , | xp tp Q  @ 0B~S1 0< R 2@0 4p q<` 8pK00L@K80081S@ 0B~S1 0<P &  A@  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp T0PS0@E 0 8@<#8 P@ 0Z Q T0Sl K @U<  m7ό@2 0B~S-1 0< R 0@0 4p p<` 8pK00L@K8008n0S @ l K @P0diUUUUU@D6<66 -HL@ @0P0 000 P HH@6`ix?\i(6??? 0-LM@0L04 P P@@ T0S008  K0-G00 =2ܻ?? Q-L@ Q hG$008 R0 0=20<20<2P 0 <20C<2008 -HrL`PVq 0}/000DR00#`B 2 @DFT4646(6l6F0 0=20L0Fap0S0 <20<20 @20@210@ h \0`Pdp00 d00d"RJ rP00 S8 =2S 0L00L0 0  T00S 0<20C<20 =2Slr00`"R 000k#008iS60| ||@x0t @```xPnF00=rxiDi ?4?xD?i<6kpkp? mkpkpkpmL6H?0S0="R00 00 0\40  40@-00 00D Ƞ00@,Ƞ  4@ 0D@ 0-L  Ƞ ,Ƞ000  P P@% &?D04P0D00@-` V @P x  00Q@ 0 0D4`q0  D0PQ0-0R00\00^00L80 R2 1C -,0L0SL0S0S40"00- 04 P#*0 \*0S \0S P - L00 -Q  <2<200C<2<2 L<2S 00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^00 -L@d 04 p-PQL`@p @U 000ESQ 000 0ASQ0pp - 0SL*@T 0S0P $DD D꨼?Լ?? -@LP ,0P D0 0 ?|i 0-@LP0H0 @ H0P00@ 0@0 0-@LP0 P$0  ,0P0 00hD08 00D0< -D0L0@80 00 p-P@L0 0S  ,00 S 0C$0!0v03 K$ R PP0S pp<4D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@ =D) 00C0S 00S  -0LS@+0S  R000 0  B , P8e  0- LP00@P 8Pl a0 -80@ L<0HPD0< 0D0 @0 -`L@>P P#$ 0SPD  1 0%0 000SH ,0PPD01 U 0 <0 PPD1D0<bD00D01Dp$0S 0 <2S!l PP $0SU0000<0@  K<xPC0 0K K`K`K 0`K0K`K`K*P  K0Kp -L M8@#hPP @pP@ 0Č.0 TP%Y0@0P +(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `P~P*0[  @01K `2`K0K/K.K-K,K+Kd -LM@0K p-LM0@SP Kp `PPV e 50  K 0K0 B0K K 0 KPKPKK0KP 0-LM@P0  K0KKK0 KKKKKK0 p- 0LS@ ,` P 31C  f 0SpAD? p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @z 0 P 0$  0P`0 @ 0$@@  -LM } -80L 3( 1C@ PhAAL?T? -0LM@ 0K0KK0K@K@K@K@K@KK p-LM~@ATCd KK KKKPK`K@K0KKp p-L@MPAd K!  K KK0K`KPK@K@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0  K0KKPKK@K@K@K@KuK0 0-L@MAT 0 K0KKPKK@K@K@K@K_K0 0-L@MAT 0 K0KKPKK@K@K@K@KIK0 -\0LM@A0KKa0K0KKKKK@K4K 0- 00B1 0LM8_@#\ #8KKKK@K0KPK@K@KK0 0- 00B10LM8_@#\ #8KKKK@K0KPK@K@KK0 -LM@ _0K0KK@K@K@K@K@K@KK -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L@m0 4 R: Q 0 Q05:0!S S p-LMP(@`T   00x -@L40(0S (0,0 @,000hGii -L$0S h 0@0$0S0 0 0@ h'i -LMP`p1@T(@T 0S0S: 0S:( pR,0,0,0  B @0e @P 0 P` p0  0,P e i(K 04P00 0 P 0P@  8 0ii -LM@R@QhB` u@P 0$0@7Pp R-@ 0Ka@P+ 0$@ 0 00@S00  P  00@Q 0 0 0d R 0SXiP0 S  0 S   S0 S00p@-0`4 \P*0 S @  ^:0S ^ 0Sp0S@@VU  -L@p`PP 0S 40S P P P S P S:\  R @0S B40Pe Z p-PLP 4P L0`V@@V4e >LP e 8XP e 2 0 10 e< ph( p-PLX0P` `@[X0`@PV pp -LP`p4e >@PP pP`0 0p0( p00 PP0@ e -qLMP@` -K 0pP @$K(`P  0TTP  @7,[Z* [+0[T  @ 0@}P  @ p-LM8P 0`Pj@P;Px -LLPp4@P@ 2`@TE  e 09P; L0 T$0P pRS 0S+ S \0 \*S 0S|=P e I000S 0S@0 R 00 P T0 p 00@ S 04S!4000脽???x? -LM@A 0 K0KKK@KKKKKK-<2S\0 R 0@F404 ,/ #30I iAmMb̽? 0-LP@P 00h 0-LM@A0 K@K0KKKKKKK@WPP K0 -LDM 0`Sp L0PU@@2U4e Le 0 040L0w* ;K 0SPP: [R8[90[ePP @ 0>PP@ T e ^(KLP0SPP00  0 \+Y P @   08Pb< P > _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[  PPp e 0P4P L0W 0@@W  lPP @TJ@TZ*KP*0[ Խ? -L ! 01 R101 01XQY QP@S G p30+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\  0S 0 4 \\T 01[O:1H 0KhP!  -L^KBM@KPEp `0 0  P72V@ p = p<0d 72@E0;:PD`d  Td72@d !2PeP 72@ d2` 0 7$K踾??о?>ؾ? - LPp ` ;W @T  7Qq \7qP7W  g,7q7x>???h>@-  @ 0 4$(8XX"(#!\ R0S$0\ Q 8=Xd;= -LM@0 T0偡LPN p ` P 0 0  < 0K;05P  37$K0 \P 0Ă        0 0  [P  H70  $60 0S0?8?? -LMT0P0PwD0Sv 0 0SYT 0SS`@I P T0S00`T  0S@0 8 B@0Sp 0080  P0Pt p 0 | 0S00p0S 09P@ 0 a- T60D ,0 {60S00, r6`??? p-L`0P@PT T\  0 1 Q0800080php4ph: -00LTpW1 44O \ ` P@ 0`SP 0 0 \P f <P f P f f0 0T0 -LLM@P0@ $P5 Q4Q7 0S VpK NT`[P00V00Q [S[Sゐ`sXV85p<P f W P f f 0T0(K 5 0SVpK T`[P00VQ [Qゐ  f P` f 0*`pP \` X "2Tp 0P `0S00S 0S$ , KP,P? 00S Xl5 8c5AMP Z5 V5}B@f _P<x @, 40 PbP 85_fo05W+00>0S S\f 0PF V8p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pp8 0'pV8  P = 0T40 R 0D0??6?p??4?86??? -@L0S 0 S 0 Pi0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt -L~ 00s ^ 0 Q-L@4q 4?? - p0P0aLV@/ 0P+$0S ( S ( 090S p pt00S | xP l0< 200Sii -LM@@Q LDH04  wDP K07 -L M`Pl@1 RR@p 0?P @ N$KT @P },@K(K  0 t0\  0x| ^@(00Cs(0 ,0,0 p( ,]3P  T3i(?00(@TP t0pp @   XP  R? t0 00b @̃tyNK,=L ,0 0@ 0TK<L0 0L08L0 0@L06L0 @2@"0 G 0 K I8SF0tt@"\!1 ťtjH@0PGT t  t t0S X l(1@PL E>ttx8T X0P@ @O0@0)<0s\\@D0D0XA @0X0 l@0XPD PePH 0NP\i+ii -PL\`p 0 AT 0PP(0P0000 0P0CS0Ei P@ 0 ?S $0R@-@ H@\  *0lO 0$@ D0< 00b0lO 0$@ p- 88 #D$20QL0`EP1020!0D0 1s s p @00S S S`0<0 00S@@0<0@d00`p0<0piiii 0-@@PLN4 R040 0S000h - 88#DL$20Q`0pP020!0D0@P "0  RE` R R `o`A` 0S ;`A` @ H0Si -LM0 KNP q -LM@p0%T0T0P `0$ K-@P`$0`S DP$ 0 31"0 0 00 @R$A`P$0S $@DP0$ 3à1"0 0 0p@0 @R -LMR4 pE ,0K @0HS=:0  0$0 80 @T D P `@@`U@1 &@0D 0S@0<0Pd@0U`00080X00 0 4G4 00;(K,0QD @T<0% d 0 H@H0%0 0l 7 -RLM@ R R K0K A< xV 00:0 0H -LAMP0@PiTP 20!0D0` L0SQ3 QP $K0$pPL 0B^KDT@!PET = 8#0PP L@ P*@P yTP TP=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WI@=7,=7<7L=7<<7p`P@HD@ ,0S 5*0JS?7?7>7>7H>7@,0`S Z 񟗶(@74@7<@7D@7L@7T@7\@7d@7p@7A7A7A7j!a 0R@S Z 񟗓?7$?7?7?7?7?7;7?7?7?7?7H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h 5(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h 0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h c04X04\<$21C01 0z10` !10!` n h 0G`\X #`0 p@-0@SP S`1 `#01^0P5@10L\!N 1" 0f0#RppP p-P`L@ @8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*xPcg0P$K - 0Lq 0Q 0`00d 0-LMPP\0@ @X  @ @X@PK0P -L M@04 PWP@$ X pp `0P" X G%8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K  Z -L M@04 PP@( Y0 #P'  pP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KP(K @H7R00R0 Sp-LP@` <0 @ Q``F 0  Xph  -LMR@80 pp 8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKpP00P00S0,0 Y G8c ,(K -L MR4 @p ` ` Ap E8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KP @@X (K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 Q Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@* 090p PBUpP#TP TPXP XP@P @PPP PPP<P <@>?xD?hE7?O7? -LP@ P 0S0  P@ P0 ?S $0R p-0 (L("a@0P1s s pD0pP<0@`00@Zp0pP<0pi(i8i 0-@@PLp R0p0 0S000h: -0L Ƞ Ƞ,Q@0`P@ ʳA p@ P0S@l|-i -LMP0@`epPd1T X1T$ P1T:  0p K1T 1T 1TQx xP 0x00 xP ,1 Q0$K0P P @48 0K@0P|0-0|0|00|0}fpUAUvtnU~f 0-LM` @.Q@@0@0CS088i p-LM@0PPD0`V x LXP xL048 `Px 0-\0L Ƞ Ƞ,A0000P0CS00g0i -LM|0P@p @@K48 0m@0P` $K `̲`P0S P0)||`0qP$V |00|0 P pKRP@0T0V0S T@#T@! G `P #``? 0-\0L Ƞ Ƞ,A0000P0CS000i 0-H0 (("ALPPGLf GxP0i 0- 88 #PL*0AT 0P P0PPP GDf ]|0L0|0xP0i 0-PP@L G|0 l+xP  0h0|0al+xP0 0-90L@0Q!ڌ 0 S00 S P0 ᔍ00P0CS0P3aB R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ )D1S BT\1S `DP ]K0 \  iD@T;(KK D_W - 1LSPp @`1"  1 S`@ !b1S 2S i/_ Yi 0-a1LS@P \PPP  v0XX 0 `?kp 0-DPLMXa@ $K 0$ P  D\K0Hiؒ6 -@Lp`PP DnW30, Xb10Ya1P ?kp@g7 0 kpQ Q 0S 0-@PL/P h1l!PP @  P@T0X= 0-@PL/P h1l!PP @  P@T0&X= -`hl1pPQL @ ,P@T iX= 0[ 0-PQL@ Үp00h\p& p-T2@SLPP`0CT2S0L P2ph p-LM@0PaPD0SKp`KL P 8 40~ -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ 0P` L`PU php p-1LS@`P 3SL phop 0-@LL90P0 -T3LM<00P40`,K00( K80@( 0,@( 0,D( 0,H2 LRpL 0,@(@ 0 $ @P#h2 R; \2R 20#Q01(BS,0&!P K0 S1At 1S 1 @M0zSp0,$K(p!PA $0> 0?C0C5S5q7p7p7p7p7p7q7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7p7\03 rL03 m<03 h@m7SxD?W=TW=HiW= 0@S<0S =Q X0S| S~ 004 D0APS4< @0:PLX0St 00`@ P`@> VX 0BSP2 X RW .:R,1T0Y 0BS777777d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iuiX@Y@\@`@Y0PX0.Bzi`is>0S7=}`0T04> H0P ??<>|???pX=?????4???dX= -@L0y 0 4JS00X0ĵX0ĥ -L@4h0S 0d 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#85 |X= -@L00h7 -@L֤0S00@+S000(0RR00(0(00 (0SP( P0(0 >h0(0 -LM@Q` $pSJ7(747P72 %㼠  00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Kog`+0(00(Ko00 0!0(00(0d74?80S880͵ -LM@P4`0P3 pW00 00 0! T@  0 P0(Ko0+ R  RW\0(0(Ko|gT@$ 0AP(K7\? 0-LM4 P0S K00K @K) P,KR)@K0R L( 0 qx|? p-PL ϳ@`@ @0m02408P40012` 902`p,77i p-LM`2 <2PK0@!2 00004  G00CS0xxf5 p-LM`022 < ;PK@ 2y00004  00CS0xxf5 0-L(M@0PP=0 KKP4K KK2 K0PKPPKPKPKPKKK0 -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@KP64K,KP6L -\ LR`p@P<0PS 0\ <0R@ -LM0S  0 Ƞ8,Ƞ#8 MP \^= -LMP@` P d0:(K, KpP 4 08 Ƞ,Ƞ#8 6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` 'P6 = [>0[4S\00\0  >0K 0S/꬟7777780[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !1\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,0P  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l  T ,S+Sj(??\^=i??l77<>0?(???D??@-@0 , 00\#^? 0-@LPt20" 0 0-PL$P 2S BT v0@T=t0 0-LM@ ?P  \ K0 ?P  M  \? @bPP  T6 ̠ 34/ P|??7?07 -2AML@` 3Pp0 :S  0 #C40 3O``  UP G 4 K<30<3't7? 0-PL@P%3S" 61S WrfP8  P 6;601S WafLP +6 ;&600  BQr0C 00S: BQ  10R\!`!  10C10 -@PL /P 6h p-L@"P_ f`\s3S 2 20S 1 S#ph詟p0z -PL`p@P =9W;I9 WW" 0 0@0@ h6 W i{0 0@0@ : p1S0@ii? p-LMP0 0@0@`X 0 K@ 1S@Kp蔇> -L`PP 9@ U UUpp,#R 00@`0@ 00@0@P30P3PUhPC 0 Ps? 0-3P@SLSS P P  070 p-LR`P D ; 0 0 @7 @p7:@PL 7p+K:1 u 97p; 000? -1L$M8KpP`P 9@ U UU$KL30L3|P(UR ̠PA0 L  @  ,0KPP 0, F,0S0 0@0@LCq 0 L'KA *%0[@T%@K,0 0C,0 0 07 c7P @0?`=07`? 0-@PL(S H7P 3S P $P  070 -LM0S 0S  0 Ƞ8,Ƞ#8G dP^= -@L$H30CSH3h H3 0H3 -L M@p`=P K@0F@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`@pP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`K{P[ 0-LP z@@T T ?  ~$ f& ~b? (0h~ V '? 0-9P=@L9 YC ?P P5RP P202P P02$P 70$3P 03P 703P 03030 4y  s  m ??? p-2LP%6I9`@O p00S 0@TnH30CSH3ሜpl -L`   9 8#8  )2S<9 9  h@@ TxP ppOQP@@0$oW -LP@P ʜp'n @WT7P" 7P$  D =o2S 9@0;9h @h,h-P h?? -`LP@p0P@ s01T 0CT!  00V@4T& Ἓ0T 0T0/J@ @ %@608#8@6 0 R @6@@@ y@Y@0n+@Pi 5i 6i( -@LpP` & % (@@T ( T hY ,? -LP@`pP U %~@ (z@@T ( T &@,H$,? 0-@L. T20S7  I26S$  > 7SPP? 0 08#8 0hgu m  0- L P # @@T #U T !0h*mD? p-L`@PP@4U0@p -LM@ P2""`l3#ptx吃唃 08 Ƞ,Ƞ#8G \?R!^0C @/@]0pS@00S"0@SPP   0P" P"0@S2S 2S  K p2S &@KoP $' 1!9|!1!x1!0` h0 20_0p@"2 A 0rL 0.n"R  @ l\"0".Ԥ77`?^=?h??7\7t777t7̠7772S -@PL +P h -2 @SL"# P P 7 - 3 @SL## P  P  7 0-L4@P +51P ; 00C204@ -D2L$M`PB 08#8႒Ⴁ @ j"K2KT,K @@L20 20pTP j@R 2/.  p圾7P c(K0K2K,K pꂒႡ j 2 2p(30(3'87 0-PL3@S 61S WK^P8  P1S W>^LP 6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -pLP`P LV VV& 0 0@0@R HV i荗9i;9 2 `1S 0 0@0@ix0u!H? p-LM0 0@0@P`X0 K@+/ 1SMLKpd? p-D3LP4PAP>P;⟹✹֗H3`0CSH3G9@O k00S 0@H30CSH3.p3M 0-@LPj20" 0 0-PL2S BT m0@Tnj0 -LM`Pp9P @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$KP K 0-LMP@0( P(h3S  0P \ H0PS  08 0CP B 0P<9 H0P0 0P (0P" -LM`@ 0S RPpK0\ pn![P04"48#(!K[#<U0@KR -LM&pK@d 呼P K 0K4B [0[48!#8 -> ("(0! 8#( 2S<8 #8( "h908#h 0p 0x08P#h PPj0K Q 0 U Aa=  p-LM@z-^` 0b7Pi 7P 0P=3( P3 P3 EPl 0K-> [0[ [ 0 .>P B X?ᇕKp3#4 ?PP B| $l '΄0{7P[3 / Pƻ a9@0;S9E3Y2 R,7 ??a?$7? -PL@`pɕD1T% 0CT-  00@4T 0T 0T0/@4T6@ @ @ @608#8@6 0 R0$@@ @@i 5i 6i( -p  0p00LM @9@ 2#0S 0S S" S036->0 A0S  S 0 8P (hG->  ? p-@PL ܺP_  `h3S 3phop -@L⏦H30CSH3hxH3 0H3i -LMP@p᧺`PX $KG4%0K&pKh 0`Q&K 0HJ @40`CT ! ? -LMP@r`PsW K"`K!`K 0`"K0|  @d0`T ->!["0[X   0? -LM`P 0`"Kx 00\ `B[L2BKTR 0< `(n$4Spm <`K @ 0@\0 @KS 0@J W0 @ 0@> H0@5 04@ , 0@ K 0`(p3` 0 0 308#8  0 0H`X ( 0`O  " -LM0p2P0 2 08 Ƞ,Ƞ"#8w3@-nX3\s`CdCt3Ct3xs|C!3 P/P0P<`3 " 0S;930S@00S"0@S̹P   0P" P"0@St 9·0p -N0u c 0&PKd-NP0b 09·@4Y0nsYPK' ] 0ph1!91|!x1!1!2!1_0`@"2 A!1b 0f"R@  X3 H[ 0 K0&PK-NPd0 d0]px|03pj0o"0F"^`=7H? 7 `02??>T77D7777777P?`?h??? -@PL XP hA -2 @SL"# ٺP P 7 - 3 @SL## 徺P  ˺P  7 0-L"-@P +;-1P ; 00p*0,@ -$3L0M8Kp@P`P9@ T& TT(KpPT (@0}#0hŸ     ,0K@8,Q0 0@0@#0Q O"88#QW:8#8SD0 H <@ 0 0@0@D< 0A8#8 D0 < @d1 0`0SE0SBH <@>$(0))?@ [P @0C *2 08RR#820 2 h*y p夺o0 0@0@dcDHD<D0@  Sa=p7???? -LM0S 0S  0 Ƞ8,Ƞ#8 Pa= -L P h蕒 p-PL9`=9i3/P iP6bP `P402P VP02P +03 P 0 3P +02P 0203pBp <Bi $Bb t?,?P? -LM2p 0PS: S S@` .j 2၁C0 , @0K  20  *0`LP r 2/.  `勶&P `(Kl,00 19,0   `(3 0(3?'h7 0-PL3@S 61S W?VP8  P1S W2VLP 6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -pLP`P @V VV& 0 0@0@R <V i聏9i;9 * `1S 0 0@0@il0u? p-LM0 0@0@P`X 0 K@/ 1SM@Kp? p-D3LP4P5P2P/⓱␱ʏH3`0CSH3;9@O c00S 0@H30CSH3"p3O 0-@LPb20" 0 0-P0"LR3 BT e0@T`bP0 -LM`Pp*P @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$KP K -@L֠H30CSH3h迹H3 0H3尠 -LM*pK@d cP K"K4 0! ["0[48 !#8 ! (  "(2S<8" #8( "h908#h 0p&Ġ 0!K"`K{x"08P#h PP 0K Q 0 U Aa= ! -LMPԎpt`K`l (0IE7PB &7PD {s@Kx 0@60[[\Č Ƞ,Ƞ Ƞ, ,Ƞ 0KK@%J .> P B K ?@P B ݍ׍э3 d/ @< ׶9@0;C9ọ3 !4?X???p7 -PL@`pKD1T% 0CT-  00.@4T ᔍ0T 0T0/"@4T6@ @~ @ s@608#8@6 0 R0K@@ @!@i 5i 6i( 0-p  0p00LM P9@ 2#0S K0"0S S S03M0S<8# S 08#!40KKyK< "0<@`T !?6 p-@PL \P_ ⠍``3S 3 php -LMP@p<PcV KG4!0K"pK1"K 0,@T |!|? -LMP`pPCT K 0KL @T [0[W Q ? -L M`!pKT 0p< 0p!0[@003#K &0#@K"@K  &0#K"@K 30!Kpd $0!@Kp~ C0tx" [#0[48\##8S  4 0ph![Q Q Q5  K 30!KpT 30!KpLdػ &0C"0[#@[ DH$HJH$̠&0$H`"K#@K2㾻P30'0KL <0& K%K$0K(K(K  .04P U0!PKpR T0!Kg@p 0 !@Kp 50!@KpUh 0"K#K0PH $0!PKp$ $0f@Dp7 "0#K"@Kf "0 00   0!K 0V0(0Kg0C&0K _0'K% K$0K0O (0K0C' K&0K8 B0C% K$0K|! ? ?Q -LM0`2P0 2 08 Ƞ,Ƞ#8干"@->X#\c`CdC嶜2Ct3xc|C!2 P/P'2P 0pS S S:3 l K:30S@00S"0@SPi   0P" P"0@S㰋03b&@K0 @%Jc->0MH(h'  0`hi@1@!9<1|!8!x141!0! 1,1"(!_20p0@"2!1r 0^"R  U3 ᲊ cz93{]|Z"0"a=7?X7?`2?>L787t77\77L777P??? 0-L%@P +%1P 0%@ -P3 @SLX#L`# 0SPP `PT Pz7 -83 @SL@#4H# 08P8 EP< 8_7 -1L$M(P;0⟧0✧օ2`0CS2G9@O Y40S 4@ۿ20CS2.p p-LM@㥅P}7P% 7P(  2>P  Kph ?`P  KphфKphʄ}KphÄ T3P\/ `/Pʭ9@0;9Kph訄|???? 7 -PL@`p?D1T% 0CT-  04"@4T ሄ0T 0T0/@4T6@ @r @ Ig@608#8@6 0 R4?@@ @DA@i 5i 6i( -RLU@p` E -P F%# EpE P hh`?? p-LM0@0 P`cE P |I[x%#EE PF K6[xF K? ? 0-LM@ ?P ޶ K0 ?ڮPP ϶ Lw̠ $3,/ P+ Ƭ|??8 -2QMLP`3@p0 *C#0#C40 3_``  噬P  43ŦK83083'84? 0-PL@éP61S WIP8  P1S WILP v6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -@PL vP 5h_ -PL`pg@P ⬃9W;I9 WW" 0 0@0@ hW i0 0@0@  p1S0ki؂儬? -LMP`'pP K0 0@0@\s`0 K @ 利  1S᪂7ꔇ> - 3 @SL## 别P  㕫P  寪7 p-LR`P D ; 0 0 @> @p@PL%7p+1 7p; 000? -1L M0Kp@`0P$0 妨P 9@ V VV K@30@3P/VO ̠DA0 L @埨: $0K` 0$  @0 48#8 S$0 0 0@0@@C  0|@$00 0X d7P 㐂@0ℹ含lb=8`? - @L,#J7P 3S 循P  ˪P$ 7 7 -LM0S  0 Ƞ8,Ƞ#8  P Hi 0-LM?0@ PK0KF0K0K@K@K@K@K@K快PK0@L? -L MPp@R P ,K!1 @/@1!\3x#`sdh|s K_@P C0PS00S"0@S 7P9   0P" P"&@Kځ`jP ' 0 9|!0 x1!0@ 0phᴹ Hu 0l?!8#8??`(8L888P? p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KPKp -LM`p3PP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KЪP [0[ -LP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K度@P Kp?0F!0KA0!K K KK0K@K@K@K`KxP[ -LM@嚦P K@0  K0KKKKKKKK[Pݯ? 0-9P=@L9` Y4P ۨP4RP ҨP102P ȨP02(P 0(3 P 0 3P 03 P 0 300 4޲ ز ??? 0-2L@5%"\9P@00S 0@oቶ04 0-LMP 8#8,2S<9 0@\2  =8 0@Q2 xP @@++!0T 8d #8 )@< =Z8,и;;1" "Ti -LP埥P9@@ p" S'ngd @MT9`   D~7P( A7P z$ 6# 2" . *2S 9@0;9h@h~,h~P h~?? -PL`@p<P@ d1T# 0T  00c4P@ ~6@(@ ~& = S2 @S# @ 6@3606b0 R @ ~@ ~0@@J3  `$ `3 ` i 0-@9=PPL9Y s>P4RP j5P102P `+P02P s02P q02P g02P e0200G 4A ; ??? 0-LM@ +>1P & K0 ?"PP  L̠2,/ Ps|??H18 -2QMLP`2@p0 rB"_ Ϡ,͠0 ?  lC4B0b2\\  ?ڦP ̰ 0t=K202x.8? 0-PL@P61S WCP8  P1S WCLP 6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -PL`pᷣ@P }9W;I9 WW" 0 0@0@M hW i:}0 0@0@ O p1S0yi(}Ԧ? -LMP`wpP K0 0@0@\}0 K @أ 1S|Eꔇ> 0-2P@SLRR إP P 070 p-LR`P D ; 0 0 @ @p1@PLz7p+E1 o7p; 000? -1L M0Kp@`0P$0 P 9@ V VV K303tP2VN ̠@A0 L @句 $0K`H$ R @<0  $$ ($0 S0 0@0@C_ 0l0 0 h7P |@0ڳ;|c=H18`? 0-@PLR M7P 2S P  P 070 p-3LSPp|`P f ㎌029@ 00S 0@ἶֲ03{pq -LM0S  0 Ƞ8,Ƞ#8! ;P xb= -L@ YP/ǢP z hu? p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KҥKp -LMp儢P6 0 4S ,K0 KEP !0>(K8,P 1 ̠8Č#Č"̌ 0P t d  , <̠ČL8 ČD"̌#D!L  0@P Q P,<4("!4l̠ <($Č"Č%̌ 0fP - P  ,㤋 ͪ<???,?T?|?? -L MpBaP K K@P ܡ0PS00S"0@S СP   0P" P"\2S 2S8 (| )0P m2f 0P& M{)N@`۳P T' f|0| 9|!t0t x1!0@ 0ph%03z,6???P???=8D-8x/8? p-`PL@ P b!P0 @/D0@ R phN(ph  0phNnl?$i78 -(L"M"(@0K K0KKKKK K Kd K -LMP 2S 0$!08#8  Kh -0x0Q0" "2p488S@`  T` "2p488S@ 0!B! M0,0•)0 0P" Kh -LM9P@` Ktz@'΅ 0p@9 -  00 00 n@ j7P {7P w2S 9@0;9KhyLTKhy4MKhygP Khy?? -PL`@p۟P@ zt1T# 0T  004P@ hy6@(@ `y& = S1 @S# @ 6@2606p0 R @ Ey@ 0% @@X2  0L   2  =  ("(  i -RLM R R K0K ݟ峢 p-`LPXP p0 0@0@phꔇ> 0-2P@SLRR СP ݡP 070 p-LR`P D ; 0 0 @ @p%@PLn7p+91 c7p; 000? -1L M4Kp@`P(` P(9@% T2 TT 3S% TK 3@!fz3 S03TTA0  @~$Kƞi c (0K `(? (`(``F(` V @ (0 S 0 0@0@0 0 Y7P x@0¯#xc=xA8\?@? 0-@PLR ?7P 2S P  P 070 p-LM@xPq 2SK 7P 7P  ?P  DKphw,KphwKphw =آ`P ͪ uKphw2/ `' 9@0;9Kphwτd )> @rP  ,FKphw|????xA8?8|? 0-@9=PPL9Y yDP4RP p;P102P f1P02P y02P w02P m02P k0200M 4G A ??? -`LP@pၝP@ w0T 0T  00ᨱ4P@ w @ @w608#8@6 0 R0@@ i@ i -邡ႂLM0j`@P2p f/00 \  @00 0! Q " $K0j 0 @j@b0"!B 2/LL  巟P $K202c='J8 0-PL@P61S W<P8  P1S W<LP 6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -LMPp`ᘜ@P Kv9V;I9 VV. 0 0@0@- V) v$K 0 P . `$0S 0 0@0@1S0ku0 0@0@域? p- 3LSPpv9`@ 00S 0@ᜰᶬ0 3upK 0-LM@P PP  0 Ƞ8,Ƞ#8D  P 8P 80 SS8c= -LIMp`rP农 08 Ƞ#8,Ƞ P?8@K8P pS /P 0$S0S? 0SpPw (0S@(0@SқP$0AP 0S$0!"弛(0@Sʰ2S -02 `R@0Sڌ2s P  @ 00S0"20Sʰ @,P0pS@P ""0`S0@0S"0SPg   0@0S"0Sʴ2s 2spW2s 2s uZ` =K0K0C PKX 2$K'N0` DK< '$8 #44"<,K ,0 0u2@ m1!9|!1!x1!0@ 0Ph.Bᜯ0 3t Z0Sp J$K222SC? :640 $00B SAB Qa0B7 BSW B? p2"0 Pp2'N TH< c=*?LG8I8?8X???Ty>?,??? -@LhP30CSP3hQP3 0P3BP0u p-`L@0P}P6@0 ?  #0 0 3S 00pG20" p0"00p 0-PL0YP?  2S BT J0@T0hmG0 -qLM0P 3@0` e$C;QA40+ @ /0 3 3H   4P30P3̜P3@0CSP3T ᷦ d_07 K < a<0>᳞H30H3 W8? 0-PL@0P%3S" 61S W9P8  P 6;601S W9LP 6 ;&600  BQr0C 00S: BQ  10R\!`!  10C10 -PL0`pᒙ@P s=W;M= WW" E? 0@1A( W isC? 0@ 1A * p2SxvisP3H0P3嬜P30CSP3? p-LMP0 0@0@`Xs0 K@寙 1SBrKp蔇> -3 @SL$#(# 0尛P $彛P  ך7 p-LR`P D ; 0 0 @e @p@PLL7p+1 A 7p; 000? -L2L M4pKP`0ϘP&U& UUpp h0l0h0MPCUK AD0  @͘P3 0P3eP30CSP3'$K(0K  P(0S 04 C( 0  G? 0@1 A R"A? 0@1A=h@' 0hpP3D0P3忛P30CSP3&Pl0R @(00 0_  D7P r@x⋩qg=Z8`? - @L,<#,7P 03S 0ǚP0 ,ԚP4 707 0-LM@0PP K0P340P38 D0ÜP  `PP30CSP3ᾜ4< H0⮜PP  HKP<0D43,/ P0嚚|??Z8 p-LM@PP` 0їP Kp@ĠF@0  KK 0KK`KKKKP3 0P30 K⋛P3P0CSP3p -LM@P`P 0増pP KLN@0 ' K#K(0K%pK!K&pK$K"KP3 0P30(K[P3P0CSP3@ -LM@P`pP 0rP K@$L?0 KK$0K!K#K"K KKP3 0P30$K,P3P0CSP3 -0PLM @ K@b0P[ -LM@PP`p 02PU  @ JGĠ0 K KpKp  >   7q p-LM@PP` 0PU xm @      K0 kG [0[48#x p-@PL 0ږP_ q? ` }@0PふphgppD20 200S0#R00S 2 S# x p-LM@0壖PP KpM `K  Z= 8#8  -2S<=4 =  0# 0[<<P0K PP K?0 Q0 U A 0-LP0N@P 0 h `qT @ 0hq' 0-6@=P6LVPTDP ×D厘P+DPHP H兘P0H08P 0830P ˗003$P 0$3P 03030蠢 Hꚢ B??x p-L@P$p`0/# x0 7P ^opr7P SopX P H ?  H0S D0S 6@0;6(oP<pBWP op?? -`LP0@phP@ o41T 0CT!  0x⎩@4T& n0T 0T0/€@6 @ @608#8@6 0 R @6@@@ @:@x@1i 5i 6i( -d0L@x`$007IoP3p0CSP3=@? _  x0S OinP_ lB -LM0S 0S  0 Ƞ8,Ƞ#8  ÕPg= -LMp P@` 2`30@dshl24`|3s儃刃 0 Ƞ8,Ƞ #8 |嘕?4080@0<0 PR>@S/ 0@S4 P* 00S@8<0S80s" <0s @0s n*@K  0`P m@`0R$KL8  xp`1!= 1!!11!!30#xP O3"0 R/0    0PA"R  "0ϫ"BᜨP TmTy>a8?e8g=P???@?U8g84X84a8`8R8`S8S8LS8d 0-@9=PPL9Y JP4RP vAP102P l7P02P 02P }02P s02P q0200S 4M G ??? -LP`ቓP 9@ V VVpp202PVhÖB 0r? 0-LMP ?P  K0 *>P  @. ?@ P嵗@P  Tˠ24/ @=ؕ|??4o8?8u8 -2AML@`Pp 2;R2O\\  展P  0KK202s8? 0-PL@ܒP61S W2P8  P1S W2LP 6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -PL`p᎒@P l9W;I9 WW" 0 0@0@$ hW il0 0@0@ & p1S0yik嫕? -2 @SL"" ޔP P 7 p-LR`P D ; 0 0 @ @p5@PL~7p+I1 s7p; 000? -1L M0Kp@P0`$0 P 9@ U UU K202xP:UB ˠA0 L @哔$0K PL @$ B$00 0 7P0 0@0@l@0UkB[ 0䂆g=8u8`? - @L"Z7P 2S $P 1P 7I7 0-L@yP 0kP7P 7P 2S 9@0;90hk@0hkP 0hj0hj?? p-PL`EP p0 0@0@(O1S phIꔇ> -`LP@p#P@ fk0T o0T s0CT@ j& ("(8#8@@& @j@ @@@x -R0R@p @@ i 0-@L+k9P@00S0\|j0 -LMPp P R KaPP E0`S00S"0PS 9PA   0P" P"2S+ 2S( 2S% j0 |101>`x!90p h|0@0@p0 0P p1ᮢ0j4 $l??x8q8Dx8m8?P? -LM0S  0 Ƞ8,Ƞ#8 HP i 0-@9=PPL9Y ّ夒RP ґ坒RP ˑ喒RP 02P ߑ02P 02P ӑ0200 p-`LPP p0 0@0@phLꔇ> -LP`P 9@ V VVpp 3 0 3cPVh#B| 0# s? 0-LM@ +>rP g K0 ?cP X  ? @PP A T̠24-. P坏8|??}8?$8 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0B 2o\\  [P  0 K2028? 0-PL@!P61S W/P8  P1S W /LP ԏ6 ;&606;600  BQr0C0 00S: BQ  10R\!`!  10C10 -PL`pӎ@P i9W;I9 WW" 0 0@0@i hW iVh0 0@0@ k p1S0yiDh? -2 @SL"" #P 0P J7 p-LR`P D ; 0 0 @ @pz@PL7p+1 7p; 000? -L2L M8K`@pP,p DP9@ X XX(K2 02忏PaXn ̠A0 L @?ڐ ,0Kp哎,pWP084 0LT 8 bT ,p084 0Y0 OY  @ a   b7P )h @0~g0 0@0@B{ 08"r $h=$8H?d?`?,? - @L"--7P 2S <P IP 7a7 0-L@呍P 0gP7P 7P 2S 9@0;90hg@0hgP 0hg0h g?? -`LP@p[P@ g0T 0T  00Ⴁ4P@ f @ @f608#8@6 0 R0@@ @ i 0-@Lag9P@00S0f0 -LM0P2R`ቍ0pS@00S"0@S|PI   0P" P"0@Sʤ2S4 2S1 2S. g0'NPK0` :' 50u2坟@ 0 10)|1x x01x!0@ 0`hCJf8 (*Pn?8Ԁ8X}8?P? -LM0S Q  0 Ƞ8,Ƞ#8 倍Pi -@L?xP30CSP3h(P3 0P3x -@PL 0ZP 0hC p-@LP0`KP 6@00"00p920" p 0-PL05P2S BT ;0@T0hM90 -qLM0@P ` 3F$C ;R' @ 3H /  P30P3崎P3@0CSP3T ៘ TG07و K <bP<័H30H38? 0-PL@0ϋP%3S" 61S W+P8  P 6;601S W+LP {6 ;&600  BQr0C 00S: BQ  10R\!`!  10C10 p-@PL 0P_ e`83S 2 20S 2 S#P phepx -PL0`pU@P e=W;M= WW" E? 0@1A W idC? 0@ 1A p2SxMidP3H0P3oP30CSP3֏? p-LMP0 0@0@`X]Je0 K@r 1SdKp蔇> -3 @SL$#(# 0sP 」P  嚌7 p-LR`P D ; 0 0 @) @p@PL7p+1 l7p; 000? - 2L$M8KpP`0哊P&U& UU h0l0h0P4U^ ̠AD0 L @告P3 0P3)P30CSP3$K  ,0KP܊ 0, ,0SA? 0@1Ah@ 0h &KA% [&0[4  ,0 0C,0 0 0; \7P sd@xgcP3D0P3pP30CSP3׎lh=8`? - @L,<#87P 03S 0嗌P0 㤌P4 70弋7 0-LM@0PP K0P340P38 D0┎P  1PP30CSP3Ꮞ4< H0PP t HP̠0D43(/ PЉ0k|??8 -LM@PP`p# 0塉PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"KP3 0P30(K[P3P0CSP3 K< 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 09PU T T Qt0T 0d dThT T4 $ 7`?d?0??il77??? 0-LMPP @P00T0S 0 Ă\ 0\- 0\ 0S @K0 0 $R @ 0 4S @0S0S@0K K K0s 0 04SQ @A#a6S@00RA00 0-@PLP 0 0S00 0S0000s|0 Q `0Q1!P P R 2999꓎¿ _,lh=+8#+ p-LM P` K,A K 0 SGT 0T@ T80Kp9#9 @7`P`"1P8h=ظ@ -LMRH0H`i@0pATF@0 $K$0K#K!KPK"`K pK@K@KAK -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@K Spp 0 -L Mp01Pg80Sv f*( K R xʖR KRd, ,`@FT0N@0 4K40K3K/K2`K1PK0K.@K-@KPC ;PZ   \\< SP ASPHP0J@0ED ` 4K40K1@K/K3K2PK0`K.K-K廅P0@1K2K 0< 0 @20K1 K20K10K@00@4K 4K3K0`K/@K.0K-0K圅P (KS(,Kp SP  SP(,Kp R ʖ R K R0,0 0,0 0,0 |0,0 yKR R0,0 r R 40R 0,0 j0,0 g0,0 d0,0 a -L4M`0@zP,K0D4 @p'0K,K+K*K)K(pK&K%K;PP $K=̠X K00 P 00+0K 0C,K(pK'0K*PK)PK&PK%PK P 0-L<P\@010< < 0000 0-L@ @QP @ADڔ 00C00A0` `0S -@DLP 0D0 -L4M0p00 `4 0 S0 80<  S S  0 080< 80< 04P0 L0 v0PS/@ P 0 @4S@0D0 0S"4fP= 00S R00 SR00 S2 L 0 <4S@00a<0 0@SP0s& L0s' 0DS00T0 <0@4P@ |8 TKp p00@ ,P ( 4 $` 崧D KH0嚀4( il774?\??? -LM0@S 0S  08 Ƞ,Ƞ#8H& jP ,0R 0R0S h=Rd00Qe00 p-L0@PH`CPU UUpePdP `0e0ePe0e0 0 0e0e0e0e0<<0e0e0phדDphr 0-L@0PP DP D兂PHf 9jDP0跌 _? -LM@0P?@0s D0Sf L[jLH<@ D0 @`P$hPU30$`K0D @p"K K$pK#PK!0K0K0K0K坃P0 0!K KKKK"0K$pK#PK厃P K0 0 $pK#PK"0K!K KKKK|PH8 -LMh@^0Aa@0 K0KKK@K@K@K@K@K`K -QL!0M# 0K"0C KK0K800@@C K@KK0KKKDK -LMX\0~Xs ^S  8p@0NTGd!0" $K$0K#K!PK`K"K pK@K@KK0^ \0\0s  0Q0\0Q X r 0q03R0#S0Q0X0R R R 0-LM8P@0E@0 K0KKK@K@KPK@K@K߂PK0 -LMPp@` OP@ K8P0ED!0 (K #@K(0K'K!K&K%K$PK"K市@P T p-LM(0KC̠C0K`C$00K@K: KKKP0K  000K0K< S00K  S00K  S K@P 0\0s X0s KpS00K/00K 0-@DLPP 5DHf h0D0`P 0`00 -L4MpP0@00pD T0 X0 @P  0m~(K0~P9 0~P 0S 0@S?0Ch0 h@4 ~@P4~0`80 R)0S&4~P  @ 00S@ 0 4L0ڊ 0.~ |0(~ u0!~@0sZ 4<0SF ~0`80 R@00ST 0@S 4~P   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P"  ,0}i&0}c g~P4 o 0}Tx0}N\K` `0ɤ`GP0}A<0};l????Tih??8??l77?? -LM0S  0 Ƞ8,Ƞ#8( ~P |r=R`00Qa00 p-L0P@H`k}PT TTpa@`@ \  0a0a0<<a0ph Dph襀 0-L@0L}PP DP ~DPHf lgDP0 ? -L Ml2P#P_K QPp0 a QP p0 u QPp0 K Q[P p080+0K04`K30K0C@NĠ, K.0K@00K*PK)K/K40K,pK2@K1@K-@K̀8P 0030K@0EĠ, K40K0/K0PK.0K,@K+@K*@K)@K2@K1@K-@K巀H480+0K@040K 0HJTHȠ30K0, K*K)K/PK.0K-@K,K2@K1@K0K埀(KU 4 (0P pQPp0 KQ 0pPKQPp0 QPp0 QP p0 00QP p0Pp0  0-L M8P@0K0ED0K?0CK KK@K0KKKKPKMK0 -LM@0q|P K@0s D0S Z0f LfLH4@,D0 @̀P8 0- L;@@ P  @@< S@  S@  S@((d@0 -L @hQd0d@ 0-L MW0XS 00\8P @00EDK0K ?0CK KK@K0KKKKPKK0X0SXW0SWR R R 0-@DLPP }DJ~Hf f0D0\P :0\00 -L4M@0!0#@0D L0 P0 :PPp a  0{ K02|P^ 4 E|PP N 0{4"|0`80 R0P0sR L0sU @0sX 3 #S0W T0 0X <0 < D <4 @0 @1, (0 4 8 0 $@ FTK!1儢\00SL 0PS4{P  00S 04SP @0 4L00K{ l0D{X0>{D08{002{{??il77????? -LM0S  0 Ƞ8,Ƞ#8 |P 0s=RR00QS00 p-L0P@H`zPT TTpS@R@0XV0  0R0R00R0 S00S0S0 0S0S0<<S0ph肎z "Dph~? -LM@Ƞ(K,h,Ƞ 0P@p0%K$@K#@K"@K!@K'0K&K(pK}~@P&0 &̠0$@K#@K"@K!@K(pK'0K&K%Kl~@P KB ? 0-@( LK RP^ ږ RW )ʖ RP K RL 0RP 'KRI R;     0088#(#(< S& SP00 R" 0R R KR S  S08#(;P 008#(08#(  p-LM@.\ .@0` K0@K@K@K@K 0KKKPK}@P  `Kp?Q@!Q0SQ550055QP0SQ550055PR R R 0-LM0@P 0KKK0K0K0K0K0K0K}@P m K0 ? 0-L@0yPP 0DP N{D|PHf cDP0K ? 0-L M?0@/PK0 K0KB0@K@K@K@K@KK0KT}@P - տK00x4jy0`80 R0P0s[ L0s^ @0sO 0504QPT0 h1̠@ < @ 0p , (0 4 D 8 $@ P0 e  0x00SL 0PS44yP   00SP  S@ 0 4L00x 0xTKl l0土X\׾0xHѾ0}x~4˾0wxxl??ih???l77??? -LM0S  0 Ƞ8,Ƞ#8 SyP Xs=RN00QO00 -LM0`@DP9xPT 0Sp@ PN 0O0 Ki݋TT K@ Kir{pv0 @p@ e0 S0 $0[??v$u@1p K0C B=0K< K60 `;0K: KD0CD B@P0K90K8 K2@K1PK&4Sf  Ss 1 S  S000K 03@K/ K.0K7@K6@K5@K4@K SV @S$ SC 4%u0PS.@  00Sp0S"4uP@ @K S03@K00K/PK 0 /0K 0. K-0KN n04@K3K0PK, K+0K7K6@K5@K4 0Ky@P0vPP? v@000K/@K7@K6@K5@K4@K3@K000K0C/@K,0K 030K0 K/@K7 K6@K5@K4@K 0 70K0C30K1 K0 4@K00K, K'K6@K5@K/K.K-K+K*K)K(K?070K030K` 04@K0 K/0K6@K5@Kv`P@ ?K ㈳  0P@ @&tv@P wvuu{  x -@0L@M 0K ?0CKK0K@K@K@K@K@KwPK -0L@M0K 0CKK0K@K@K@K@K@KwPK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KxwW0S W p-LM0`@LPsPT TT"Kp0S PL@ 0 ѹ0 S *S<Kph!HKphv 04SU@T@ >0U0U0 0U0 U0<J p`P00hI. 0-0@P00L000. 0-P@LQ  0 S 0  000S:R   B. <0   0hG  0 00h>\.`. p-L^ @`P  ^* ^&0 ^"1 P 0S pl0P T0 ^ 0 R 0Cp 0P<'t.x... 0-LQh@PT0  0CR0 ᾮ00 \<'.t. 0-t0LP@;oPT TT T 08@-000}r00CS00hs\'' p-0PL@oP p]IT` TT { \bT phHphH<@< 000Lr00CS0s\'?'|' -LM0` 0 2Pp@nP"T" TT; T9 TB =Q 0A%͠ %L @n000zq00CS0%K  0K@-o R0 QF Q? 9CS9999$9$9l9|9J{0 Ts@-000q00CS0Es۴״ : e\''9`?L?t? 0-L@ 0P0 0qPz 0x塴h P00CS00P 0D ր, P0P ] ( C0?`% V Pq%-\X$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SF\ 9T 9L 9 9D 9< 94 9 9 9 9 90D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&W?F K4KtP`V000000 R  Bh1! M 0@] P `l 0@P @ d0 R08#Q 0*@K2K0"K2K?      <'0$'?'(0t#x#'|''9`. -2LM ?Rp` 2RS 0RD Bi2"p 0 00@0zT2T"@]0P8B8Ÿ   @l- 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 4$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0AS9t9h9\9$9$9P9D9$9$9$9$9$9$9890 00 00p p <8# 0$ '\.`.'|'9'(' -QLM0`(!(廱$K1p 0 ?% X00DP\Z,0 @  粪e૪ᨪP 0-  HkmP w0( L{ 8%=tx=(?x.l.p.''|''9?? -LM?pd0 \`,0 N \D1Q  A1,A,Q0  U0 10Q @/0 p0pᴠᶐ,0@000>0 ]@0P}@ (p  @j _\0@P@ (K(Ko<<'t.x.'d.'|''9h. -02L PRc  R 00 0000S^DAp0P Q00`S` 0@~z1 ` BR /o1Q 0A!la \AP 0T0 10Q ,AP klP+00AP klP,00MP klP00C剰C{qD`@p0v Xwv Dqv 0k'. 't.x.'|'L???? -1L`P| 0`@ 0C (0CX!PT1 @ @@pj0pS 00S1 0@ScjP&   0P0  P0@ 0Sʴ0  /P hP P phd hThH0H  huR\' `'..l'p't't.?d?h??'p8 -LM0S 0S  0 Ƞ8,Ƞ#8' yjPv=-0S @Q 0 S  0S i?#=?c1P20`<Pr0` -LMp@iP (K1^ hL0p 0 F͇ p0 @01 *. *PH1U@?0l8 0`h1!91x!|1 ! 10@!0wÙ2 ?" 妗0 E ?/X0/o -bE @㹤0 F @00@ ⯤0 @00hAed含 ?8PX  >  0 -L@v4P 6A0AS 4@ -L4MPpK`4 ?(@P00FKP0KNKG@KL@KK@KJ@KI@KH@KOPKMPKڟh0(`0 KQX0&PK d0@%K% K"0K70C4 K@K0K$@K#@K!@KJKXV 0-LP@`P?S S 0P Pv:@00h9h0h00@ 00CSl=9t=9|=9=9d=9=9=9=9 P P@7P,@nPX@l`0 $H0AhSw|?9?9?9?9?9?9?9|?9p?9?9?9?9?9?9p?9?9?9?9|?9?9d?9?9?9?9?9?9?9?9?9?9?9?9d?9?9?9?9?9?9?9?9?9?9?9?9X?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9X?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9X?9?9?9?9?9?9?9?9?9?9?9?9X?90 0 R Q Q0-L@P    0@T  08#0`08#0@jPjA9A9B9A9A9A9A9A9A9B9B9A9A9A9A9A9B9A9A9A9 B9A9(B9A9A9A9A9A9A9A9A9A9A9A90B9A9A9A9A9A9A9A9A9A9A9A98B9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9@B9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9A9HB9A9A9A9A9A9A9A9A9A9A9A9PB9      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BF"V Ƞ ,4V 0 $8000L0Ba21C0aT  Q  R ,{0 0 颋.PLD9TD9\D9dD9lD9tD9DD9DD9DD9DD9DD9DD9DD9DD9DD9DD9|D9840,($ <>D>L>T>\>d>l>4>08 R0-LP 0h肤0 @0C 00h @ *0@ ( h^P 0C ,0h|0?4 -LMp]P"]88?`(K $K(KLP L0P'K@N#K0&K%K"PK!K ^`v78` KD9 0-AML@P0PS _000U00 -LMHP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KuaP Nj  K|? -LMPH.l$|.@0 $H(K(0K'K&K%`K$@K#pK"PK!PKQaP *j ң K|? 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   .V p-X0$(  Q@P PL0@`[o~ z phu. -X@L jh8#<,"(c, _4(R  hWfdh -LMHP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K`P i * K? ,0- PL@0N  (⹑[@Q \00HS X00 0R B0HSQ\P 0C ,0hZ{ p-L M?0P.L.`"K K"0KB0!KK@K0K PKPKPKY`P[Kp/i ע? -4L@9$   08 #(hD -4L@$8$  08 #(hT -LPp`@  @Thh蛢T @46%CA($H"(0H$(1 0pt>  -?LS@ (0 )0 @ h $ $) (0-"(LXPl@Mb @T(T0T S0? -LPp`@ME @T,h6T $("(h9갋> 0-@LPT  T  ?0C0S 0h p-`LPV@ V@@/0B0RS@ L@  ("(,$  ("(ph p-LP@@7dT mP dT8ѡp,`@0 @}@Tp̋>x= -L@0b#`P00V0SNPFh3/Pp1p#R,Q9R9XR9XP9R9TQ9$# 3!3yDp V ""2! "48S 88S FV  F"No6i@2!\ $""2!#)D !!1!#@ !1!#)D zVL! -tP!oL1!j#@  c 1!^#)D X0V  Q L H0!C#)D = k -74 380!. * -X0xy=y= z=Xz=x=y=@y=y= -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0K&^P f 姠 K? p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0,>  0,0 <0xd` 0-0h 60LSP0CS006 0h蹊(E00 @0@0(> 0-A]@LP [00PP 000H 0- @PP6L=6V 0 | l P s[_P M[\_P F[\_0hD -LM00@D! @ @  @壑P 0` D!\Q0 0 Vd *PPHCA- 0 ß  P0Y[P [(KL3 P$X 0!R RD8S S0 | pq"D0820 00\q$X 0p0@@ h@@ `@H$H@H$(@n4 8 41S#< 7 0@$(C <'Ό< Q00/.000b 0q @B `P2DAM0 @0082DL!040 84\p '.0 4P?! 0 P PX$[P@ ) T 00@@g @@H$@گ8a 4 < d00/.0ʠ< 00b0XtTPP_9t.,> p-LM6P=@S`2 x88S1SS WP @2 R{ʨ1SR W@LP  X KͲ@P dP  X gPa1  060 Q Br0C  BQ h1 RE0G@T/0S*00 dP  X ;P x 1ASq Bx 00S:A BT  10R\!`!  10C1 10R'|'  70C700 dP6;6xxQ00 0@0@x -RL@ ZZ +d ӝZ& 0 0@0@10`p hP儫 0@D0 @ m0Z? -LJMR`p \\ \7 ˠXB0L  @KWY(K ,0KW, #R0 0@0@0@ TD⠐PPh +71aTZ @! P hQ  0T48<#8@!:#:0 051< 0S(  F= 1hp 0 p0C 0E=80 01 1 0 ,1 (0KⲐ@!t> -@LZPp`RC tC ,t:`uS p-L@}VP60`88Q+d9d9hd9hd9c9h8p48hXS =-'  48S" K4(Rhp8sh}: ph8ph8p7VP S< ( C t(f -L@VP  V88S hwX0i 0-0@LXA=P XP PP + 1  \0 0L@ 049(51<HD(?H?>> 0-0AMLP00 @PUXPp bXC=P 0@ T08  0  0 l?? -LMp`(S@0 @DTD@D@1dT_ >SdTV  "PP@  Khl8p0h(Op,0 NnH i 021C! c&- P0UWP@( >0 Y@P a 傛|~@>0 Y@PH@P <ma (gcP [@ AMˠ0*< UWP@48S  6 n ~ I60;@064(R  @f B@`<&YLx="VS??@? ??`?DP`9D? -`LP@pTP@ T.1T, t10Sh1TH 0%h@4T@ @1T" 81T  &4P@" +.V606 0S06@ @@ @ 4P@48S 6A0AS@@ 0&h@6A0ASl@i ϖ1i i i -L@#4P 6A0AS 4@ p-PLs.0` +< .PBX00S 0@^dP U0?P UzVP UtV0-pC )r<  C ,"r -LM _P (Ko6. yT@P^T //0PSʧ0@0S/0SOTP   0@0S/0S?s ?s 8828"0 C  p 2 "` C `, p  B1P'pOaf0 pי1(8 80h4ht @\1`2.VN>0@<1#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0loLTfh -X0L@luo 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00hhL0& h\0  L( 0hL0& h\0L0"h\0  L0# h\0  L0# h\0X 0@ X h00<0L 00hX0L0 h X0+0 Bh`0  LX  0h0X 0C+ uh`0  X 0@ X h00<0L0 0ch`0 x 0-TL,0@ 0P 0P go0S|0 oP S | 00PP0S -TP 00LR`p @$<0 T ,00*@[h), \00Q0S 0-(0LP0*X0@08X0 T0$4P0T 0h) p-X0@L$!;98 T8}+P+dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 X4bI0@+}T 8 T0$4 @ @000l@X0 ~l}n0A?P|9 0-LTP 6& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{GY$8 80T$8 8X0@80T$ 8 $84  X0  hz=? -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ESH9`99<90& 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P x{= p-`L@P  x嬓(0pL0 P8 TP0 X0h T$8 40 \pphx{=?l{= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@Pꄊ9x9x9x9p9x9x9x9x9x9x9x9\9x9x9x9H9x9x9x949006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ESP9h99D90&X0070 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P {= p-`L@P  p媒(0hL0 P8 TP0X0T$8 40 \pph{=?{= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ESꄎ999x90&P00j0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S-p -L P {= p-`L@P  pݑ(0hL0 P8 TP0X0T$8 40 \pph){=?{= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESꬑ9đ9990&7000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Scp -L  P |= p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pph_|=?{= p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p6@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS(9@9990& 0 8T0 $4T98$ 8Xppp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U h%T0$8 4 P8 T0$4@ R\ &RZ X0`0B%S&99999999999999999999999999999999999999 &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 80 < T0$8 4PT$8 08T -L P 8|= p-PL`@  嚏(0$L018P0 0T@?>C2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`phX0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@08|=?,|= -@L8T$ 1<8 0-(0L@P0  L0"SU U U 6000& c.p0E0巏T? p-@LP`(0L0 P8 T@00X0( R Xph֎ T0$84  \pph+|?(}=? - 0LT@NP0 3@50  S R ? ?Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 ܈P ׈P8T0$X 4 000 0008T0$ 4 00@ 000  000? @ -(0Lp L0,S@R R R (0&  T08$4! 0&.R T0 8`$@8P0  0T$8 8g兎? 0- 0@ LhPP 00 3@5 ? 0;P  6P00@}= @? p-L@P`uP  凍(0xL0 P8 T`00X0T$8 40 \pphi@}=?4}=? -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ES\9t99P90&U0040 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P }= p-0L P3 LP@`( 0P?> S0P0  噌(0L0 T`8 0P X0T$8 40 \pph?( P 0 3L|}=}=?p}= 0-0BPL@ S 긥9X999 L0"S0&800 L0"S 0 L0"Szp -L #P }= p-`L@P  t*(0lL0 P8 TP00X0T$8 40 \pphu}=?}= 0-(0PL@  0ES89P99,90&^#00=0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P }= p-`L@P  p尋(0hL0 P8 TP0X0T$8 40 \pph}=?}= -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ESꀪ999t90&Q00k0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S.p -L P ~= p-`L@P  pފ(0hL0 P8 TP0X0T$8 40 \pph*~=?}= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESꔭ99990&=000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sip -L P <~= p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pphe<~=?0~= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESꨰ99 990&x000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L MP x~= p-`L@P@  tT(0lL0 P8 TP00X0T$8 40 \pphx~=?l~= 0-(0PL@  0ES꘲99990&K00e0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S(p p- 0`@LP 0?.C""ވ(0L0 P8 TP00X0T$8 40 \ \0 `0  ph$4ph蹈T0$8 4`h??~=?0 3$ A5S ?>S @ -T@ 0LP 0, 00•_ p,0S,0`0,02p , 2` , Q( "0B0 RSQ20 ,000000000020 , 00600 0060000000  @  \0  006000 , \0 @- 0060000060002 SS2BPp \`,0p 006000\0  006000 00000 -TL0h @”R`\p,0h 2R`h \@,0h  -T0X Lp Z @}Ty 2` ,: S@@2R@0 \`,70 2R@0 \`,<0 2BPh \`,0h \0 4—p 1\2R@h \`,0h 2R@p \`,0p 2BP` \`,:` —p 00\X00X0 -LM(0p R R1 R  ` L0"S'  L0"S6 @2` ,Pd@d0h 0Sd0X0d@0X0' L0"S6 0X00š0 ,0q,Q,  Qb Q{ 2R@h \`,0h 2R@p \`, 88p 06S\ 2R@p \`,C2@0( L 0P80TP 0h0X T$8 40 \pph[~=?~= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40S999999999999999999999999900660000 5;00@ 005<000000000 0000000000 000 -@LP0X )  `0> T$88< 0R# C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+OX0 P L-+0OxP2\L  0mOxPX L# 0OL#,0OL&*0OL0&!,{OXL00@ rOL00-jOT0$8 4`xP 2#(x0(Rp0P0y h0Rd0P0t \0P0qL 50DO0E?=? =?W8= WD=,= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S \99D989 L0"S0&^0z0 L0"S 0 L0"SQp8T0 $48;T$ 80 -L P p= p-`L@P  t|(0lL0 P8 TP00X0T$8 40 \pph=p=?d= -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S `99H9<9 L0"S0&N00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L *P Ă= p-PL@`  1|(0L0 P8 T`0 X0h  T$840X  \\0 pphwL' 0vML' 0nMĂ=?= -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 {T0$8 4 000 {8 T0$48@ T0$4 000000000000000660000j7?>?=? -1`LQPp@(0 0GS @99X909 L0"S0&X m{L0 S  L0"S0& `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@pj=?7 p-L`P@){0 R$(0L0 P8 TP0 0h X0( R pph{ T0$84  \pphg z ?j=? =? -0 3B5L  ,0~uP ? ? -@0LSp D0S8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(he A` -L@h 0-@0LSP D0S@X0T 8 T0$4@ 0$T8 ;8: -@LP0\ X0,B# 0<8T $8v8T <$8m8$   L0"S 8 T048;T$ 8 L0"S 0& P0T$8 400S.x999(999999999999990& PXrP>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, P @ -L P <= p-`L@P  w(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  P0pT0$8 4`<=?0= - pLT08$48?N T$4$0 0rP$} 0I+S,\999\99999999999999999999999999999999999999999, o6wZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: T?X? -L!h -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P l_v0P V0PT0 8$40 0S  <00H6P0P|? -RLpP`$ R5 R  00R ^, W00R0SP L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0& n 0S:h9`:X:h9h9P:h9h9h9h9h9h9h9h9h9p9p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8L0S (K0K4KDK,0 `P0Q ,0Sp l*D0 P 4 0aP P,0P 04 0aP,0P P0H0 0H0 `0 0P0 0 0 0@NZ@0d Q0 4 R P 0eaP P 04 0\aP 8K< @0@q0 0xSP 4 0BaP 8K< @0p@q0 ,0 0400 @0  XJX00@$&&Q020a00#40 540 %0 P Q 4 R 2 *0*Q020a00#40 540 %0 P Q 4 R$ 82 *0*Q020a00#40 540 %0 P Q 4 R@P Q 4 R8   ( @P0Q0U0S   d0`P 8< @0`0Nq8K< @04@Eq0 ,0 P0 ,00`P 8K< @0@'q$ 00`Pu 8K< @0@q0 f0p`P{ 8K< @04@q 0l$?P???|? p-LPO`P TP @ T0T0p -LM<8K 0 0 K40K   P @(K    3("(R R 40dpH@4 8DL@PPX`0 h00 00 0 8 00| h0 0` x L  X t@ pP l` 儀 d0 WT \ Pp l0p 0H0 D Hp D  <  4 RH00C000@ K@0K> K?K,K  <0KP ,0 h 0 00 R( PK@P00\00S T _i<   < @P  pQ d: T0pS0T 00T0QT0L (3 5:QQ00     <Q`P  0@  4 0  PR`ʨ0S+,<S S!80S Kt t0P@    0 0 ,80`0 :: -LM`0, S`<@F`0S@0\  P 80Sp 0("(R R  !XP  pYpP U0\  ,0 P00SP  -\PL0pS` @0 \@ P0SHj p-L0P@`0oT`000 4 080 < 0@0 D 0H0 L $0P0( X ,0\00 d 40h0 ,`80Pl0< Pp  \ 0i^ 8L (HP 0 Pph@xD? ::kp p-LAM`QP FOK8<̠0  \n0 ,PnKp,0 FOK0n<8̠ 0 nx> ?> Q0-L@P Q Q 0hKK@0K@0l0hK 0-0LP@2iP  0q, ,QP00 p-@LP`  p p -LM@ P`,0 X 1 0  0   p 00  W% ,0S$ 0,0  0  p 0 ^W -RL M@PpA?QX@  ,   `<  0  8 0 X04 00 P<QF, z @0 Q (KnX] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZn40 rQ ?T 88Q #Ƞ   Q 0RS0R Sᐊ= -LM Ƞ Ƞ0!8 ,Ƞ 4 p0 <0 !lP,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!lk f<00! `(KobkP@T 0S 0W0S 0S @40 <!Gk8, 0Q0R0S <  f _f0S( T \ < ` +k Of<0 `00(Ko!k Ƞ,Ƞ4 <l l0kP<T `pk<0< `0pkꠉ=?D????4?|???? p-X0LP\` 0 T@0 Tpk(m@@ -P0L @R 0 T0 $k(mP@ p-LM`@PT x0SKp0K"0 0P80  P j k(m mp@`@8#8 S- H 00S P\^ 0\W> -0L8 $0EW0S. 0" $0P`@! Tp$0! @@L@0 @`@ àP 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`8<T0 p 4VP@ 0 0  00  00 00 00 3101 4P; X8 @0K8KP@KHK0  @GPZ7 <0D4  0 0,K$P9 XiQ 000YlZ  40<L (K@4Kp?0@xD?@@@P@@`? -mL0@Ph(lq -<L8[P -0L@ @A0 -@` L@PpA $ 04 |! 0S  R R Q0,Ƞ\ Q0 S R d> -8@8 #8SL P 0< "<S "8 R R RPR 8 SB 0-L8@PP|00<0p0 x5:P5:5:5:6: 0-L @P 0 pQ h 00p00 -Lx0 | -x0!L|$ -Lx00!|T -x0!L| $ -Lx0!0| T -Lx0! |\ p-T0L`0C@P #20010 %p p-P@00L$ ` p  @0@ &$ 2$0$ &$ 2i>i>i>i>A-08 `P@ ^0@ 0rP|0| 0QTT 0<T0< ,110008i>i>i>i> @0 80!$0 0!i>i>i>i> 0-0LSP@ lP hLl0P hU0hdlW h@l0W hI -L 0@ 0 @c<0@$21C0a 1 0 !  $ 0-L0@P 0 @c<@0T021C0a 10 ! 0 T0 -20 1C0aL1x0D $ -80L L ax@0D T -20 1C0aL1x0L $ -80L L ax@0L T -80L L ax@0T \@-@8x 8#8S  \ Ƞo Q 0 S <0S! Q0 P 9j,m84 8#8S !8S<0S9 p-x0LP|!$ x0!`| $ 0x00|!Tp 0-@PLxQ0| Tx0| $0 -2`001p" P5L@ x0| $ 1x0| T5%$x44!0 |\ h -@"|!BP1L0bx0`::::$;:l;:;:l@ p-`PLP@00H H0 <0<<0T4@,cT phc@@@@@@@xD? 0-3L@, 0P 0$cT0r@ -L M@1`pPP@(KT , > 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ Prc@( 0Pjc@ <@ @ -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 0b |@- e -2@001"L M`5PSp (K,0K(080K 0,pP  0Tplb=00 0 8K,  04pP=008 0 pP  0pHb 0pAb% 0pP  0pp0b 0   pP  0pb@,@@l@@ -pL`@P30  0 t0S#PUO aP3003 -L$ML @ h0l0 h0lD , h0lH 4 h0lT < LL P Š000lhB q `gE  40 0<0` @D0 ,0@0 `@@ L@8 H pS7 07  R8! 0 4>&>\ 07 '>>07  06@:A 414!D0Ǡ1ÀD @Ό@ `VOph0l@ h@H0lD hD0lH h@l@0T (K8d0  \  0)1H  H :Q0:0L  AY>FY>LY> -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@` 0  $`v@@ -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3kP8 p $`8 PLR@(@ -80LS@-Pp80PSp$x0 |$0S`3kP 8h`x0 |T80PSp(@ - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @NkP80 0`80P<@ -0pL0@ ,80 PU@`$PU@` 3B@ @kP80 0_80P<@ -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@jP8  4_8  ,  hMhbiMu(@ -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3jP8 $0V_8PLQ@<@ -80LS@-Pp80PSp$x0 |$0S`3ZjP 8#_x0 |T80PSp(@ -`u Lhl8 R$@ PPLR@ڰ5pS5 3 jP8  $^8 PLR@ (@ -P `lLhW plh8 R$@P 3iP8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xh^ 0$ 00 P $<xhw^,0( 0  ,0xhq@@j -LM1 P$$!`p0ba p  aH1@!  0 P $ o<^04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( Xq04$,o^$o]f>\@pj@@ p-4LSP`p @(0@TTp -pA Lhl8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ hP P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@hP P X8 -L@qPhh -d2 @LTH` D2p\4 <\{0@ ,0PS,c:c:b:,b:b:0 i2] i-]0S@   V0S> 000`@VT330033J \0#P P\ i\ i\\  0T 0 $  $ 0 $ 0` $@PT@@0@H@xD?@<@ p-1PL$+` 0\ $+ 1\ $+ <\` 0$+,0Se:e:d:e:d:0 ph{\ phv\ 21CA@c@$0 T 0 (  ( 0 ( 0 P (@:UT330033ph ph<\pPT@@@ -t0 L@Pk XpX`$ H0\S $ <\hGP#20 0p-L!0 00P0@!Q%`oPP p% [pDi>|@#200 1t p-Q`L`@ń`oPP 05p%[p@@@ -0`L0PSp  0\h@0l hPl0 h p-0L P0`S 0 ,Ppuh@0l h0l P -B"100a`10LxP\"T,100`10x "100a10|0pSk:j:i:j:i:0 i9[ i4[0S@   ]0S> 000@XT330033Q [0#P PZ iZ iZZ  0T 0 $  $ 0 $ 0 $@f>PT@@0@H@xD?@<@ - 0L@p4 PP0`b@D@ 0SP :0S:  Dh  @ 04  0480 ` -LMP` [2p 4 >04 @L 84 ( $ 0@ P OZ$K00 EZ@Zy0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  Z80S P@ʯ80PLS@P #20010p5S X\YPYW @YYP@@xD?6::i:T`:(@<@@d@`?`f -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:0881 # -L@`p]# 000  083 08P 00B8090908 \^ x!0| Th{ 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti: 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@ye>e> -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ hl` @f0h!2# @0,@ 0 Pc@+ 000  :P! d00@ 00, 8 ,  #0  0$0 / 0d8Q 00B90809008  P@Tό00S x!0 |Th0lX h@l,0` (KoT 908 Q 0dж#ѽ 0d e>e> -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH~0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~e>e>e>e>e>e>e> -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 f>e> p-L`@P3P UOphD303P -LHMP V (7 0K$P T(K 00 (H 0&Q 6Q e0CQ   D 06,p6QK0CQT:  0D   P6,pp0S. @x|,K  0 @@PPtT 0p 000 0@ @@PT5%00\ 0 405 0t%60X <45P9 [0CP =0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 :hP @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ SU4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vLgx04@CQ1P%0CP*z>CP01` \080!1` d0D@ SS8pD@ MS8pD@ GS8p0P 0P0` \00P 0P@t55V:=|U:@@|>:d:3J:?:?:h@j(@<@@@`?xD?s= f:c:@@@@p5 - L@`pP 3  0UP/^ x!0| Th 0:0S0:0… -Lp0t#QQD d3QA `@P* Z 0:e03 (3  (Ƃ83#00P0U05 h  !` lPUOV x!0| Tmx0| $hl@P ;: Q-2 dQ1 :0S. 03Vʠ 0e91 0 0(Ƃ W1  v"R:0SQ0v2 Q :0Sv"וR0 v2DžQ41 ( 020x0| T 0    9x ! |\O0 K  00S0v2Sv"R:0S0:0Dž00S0:0Sv"ׅ0R:0 8M0M f>f>f>f>rf>f> -LMPZ `lh@ 00CS4:::::Q(Ko!ܡ0 , @p3 pWOX  x!0| T||!|0 , 0DSGTK \!\1\0 ,0  h0  !@ l3  03 0bY3:# 01  h!@ l 8 R90S0B909 0, 1 800 1:Q0:0ą P0PP00 , 0  00 , @jjj8jLjXjtjjjjj j -LMh0T lP$0"00 g` p2 @ 001.0#A#0 0^8 0 ^4 03@0  ! :\ 00P8֕I 0\!Z 0 hlpWoh0lT Y  x!0 | To9 80P808SP0@00909 0R8 @@hl/B0P :0S0:0ȅv2S0v2ȅh@lK , 00,K @8r!f>'f> -LMB0 h0lD 0 24 , @pP3Z_p4 R 004x! 0|T(Koh0l h 8 l000! #*80 \8000C9090,80!h@  1l h8  0l#  4 04 :L08 # #4  0*984  \Df>,f>8f> -Lp` @ 3 F81!0P h  !D l0 0  !E hlXOY:Zh@lPA 0 # 00A x0@P|pA@ T`$0 8 R 9h0h 0 2P9B0S9 x!0  |Tlf>qf>yf>vf> -LMP`20`,0 @p0 3 0,,\ 괙::::: OpWO h!@ 0l0 R  0x!0 |T(Ko ,980 S8 80RQ8,, 0 00 81 *0#8 0 9:S0C0090903H hl 02 :0S0:0ą, 0LSꔚ:::l: P O,0:0D :04 :$0  @f>f>f>f>|f> -LMp`P@,` hlW 3@@p 8 80D!1h! l0`VO,0S  x!0| To980 S8 80RS0C00909,  0&, 103 h Q l|: , 0, 0080! 1 :\0:0ąf>f>f> -LM010p,0 `uP@3  0v90 90S`80 4 21 PU@h0lL 0u290,0v`P  Q10Y  x!0 | Tf>f> p-@PL`$ 3  0 P 0 PPR @0 100b 10t KphD f> -LM 4 8 hl ! 8P`p8 000    @0 < I : 03R  :0S0@ 0 100T0C`  PŸT i:@"008#0 8 0Ō<@8 `PU !  08P 4 x!0| T(Ko < @9 Ap1@ @ X@D@00  ` d0 ,4  ^8 08 <@8 A@0 @ \@D@, 0  ` E,  ,4?: 008#"` B   #0:0  :0S0@o0@m00   0@0:0_di>^i>Ti>ki> -L`P@p# 820 000PQ$9 1 00hSlWV T  0pWOX  x!0| To3W[ X 9 0S0A9003 h!s l:\(60S007 00!0s hl l!s h 0!l0s h8hly P0:0:\070 i>i>i> -LM`Ph0H lh0lP 0"0c2#p@r3  h2 qp@ d, + 08 00 C9080\ #,  02\ 00B9080908 Ѹ1a 0 # 00!p@DtZ  x! 0|Tph0lH h@l 0P    #0儁0c@0< <6 R! R& R : 008:0Sv2S0v2Ņv2S0:0ŕd :008 :D 008:, 008ri>i>i>i>i>i> -LM`p0h0l00 0H ,0 hPlP 0dŸ0c2à h@ < l@ 4 @8 Pe2 08 00 K 0,1#QPf 9080\8  08080 \ 00B9080908 p1a 0 #T 00!PEuO80S  x! |Th 0lH h@l<0P (K  03400(::Y0:0ąa@ !0!X8 00!<< 04 2K3803 ti>i>i>@ -L MPph0@ lh0@lD h0lH `8 h0  lT H H41 (K  00$!00` H0 <` c4 0 , , 00 , 01D @ 88 0 8 0@  @$4QQM 4Q( 0Q% )0Q" 0Q ?0Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4Z,0`S  88,`⏏, I 8H9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (Ko50<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 )H 9b<00<0 {%&$vJ$K$$i> 0-@LP3 0 3 h0 0@ 0 R 400h  @ r  -LMp @x2hl$ P  $ 0A P mI iIU dIbI K^I6YIt0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U!  I0 R 80SP80PS #P 3B@@A@@]DHP \`,7  0\@d@`?xD?@6::Ta:T`:(@<@@ S2 4c 0-L @P 0 pQ hc0p00 p-LM@`S1 x0400@ cPP$HT(a:0@ 0-@LP[4S 0h0h2#0010Px\ p-80LSP`@3 80@S0P  ph+p -LM@pPU`c T 0ph0 4!   0Pp p|PP! 4!  N0PP Pg`P $H 0 (K$l H0 00 P  0 0$G 0    0,K$P G 0, (0 p ,p0 ,PPp 0\ P PGpPs@G00S ,G(G@@`@@(@<@d@`?xD? 0-LMP@  0?4S8 l4S 0 $0( 8hZ -LM< 80S 4040  2ሓ4   80 !81`4X@ `^[P2pP@4  0h@l/T4 0 408 S 00P% `@6G,0K0K 4 @5S(K  40k%(G@@ri>@@@@@T`:@ -LM@hPlQ < "80S"4 4P @ rc  !|1xUP@0L!Q U5ň50010%R> U 5 001 `p05 0 5S(KZ0010@,0K0K @ 5S P U0 4Q  0%(F%F@@Id[:@@ -<@PL$Dd`pF@0 <00 tp8g80S@ ]80@S@ -LMp`4 @P T 0t0YF2 4P K 0PPPPt' 0  Q#* 0x|@P @ P~p3t0P0 H0H H0D0P L0D`K0!F(FtPFd@J:G:86:@@@@ -LM8 <0`#4F80t0 S0  A> 000!1\ H00401 X0<6 5880S$Pp80p\SP P h0@ l"9 4 %E80p\SP(K#2001080  5S @,0K0K8  @5S 8 0 P 5S X5S4 h 00l@ @6:J:O:@T`: -LM<0P#4`vE t0 S0 C0CS ::::(:(::0601X0<x1 R080080`P80PlS`( P #20010pA0K  ,0K@Ŗ \  0" 5S 80PlS` (, 0 0@Pd `:9d (K0S060060@xD?6:4:T: -LM0`XH< PP+ xPA 8P> 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 @<000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 88g0%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 .P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 45S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q P 0`"QQ:74 < 804 0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* 80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 280p\SP 80<[80p\SP0CRIF0CQ07' 4)%?80p\SPʰ060s0CQt080Q07xthMhbiMibu@3M6:0M8Mp:: sE s X:=:TI:pW:@ -LM8 < "80S"4p4  00S S S S S 4 0BSP>8_@>t0 S0 ,#,3\ (#000X <04504  SRm6800 R{08080`P- P! 0 2ᅃ0010 Ÿ8, K00K;5SE @@A0 @@1!Q80PlS`Ss!P hlC@%m>80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ %(K8 0BS06080SR4 R060R .>40ASh@lPQ 0Q h@lPU 0U hPl@Z Z 00 @Y0K 8,0Ki@xD?6:0:Y:@@ -LM`< 4 =<yt0 S0 40S0004 00R;00L#L3\ H0h@lP<#040X <85S 000S h@lPP 00P h@lPC z0C h@lPM o0M xh0l h 8 0l h0l  8n40S]80SGPp %t=80p\SP: ~P 0S #20010<0  5S 4 P1RLA0K@<,0K  @5S VP-5S  0 <^80p\SP(K 4 0R000C60J40S006060Ch@lPK 00K 8  40h 8 80l 5S@6:`L:đ:@T`:Z: -LM<0P#4< t0 S0 \!\1\ X!000840<56X (18R:0004 80S4`p80plS`+ P #20010 0 5S @0K  ,0K@Ŗ\  080plS`(KX@6:D:T`: -LMp< t0 S10 !00\ 0hlT Qh@lPA =00A Ex!h040X <85 l Dῠ8 Al@ h@@0lh@ %80S4P`80`\SP+ LP #20010 0 q5S x@0K  ,0K@wŕ\  0;80`\SP(K@ <:P:l_: -LM< plJ h< 8 <0#4040 P4`@T 0S 00600;;<kt0 S0  3#00\ 0S3000 40< 850S0:0:0::::h@lP@3X0P 0P hPl@R v0R 8480STP` 80%;80`\SPD4 P V VB ᆣ 0010<40 5S 4B,0K0K<4 @5S! xP V808 0 8 80 hlJ 8045S X80`\SP(K< 40e8 h@lPP1X0I 00I h@lP1X0R 00R zhPl@W 0W 0 Q00 060%;U0 606@ @hP0000  006060 ,m<:p?@6:Ț:@T`:0:U@<: -L M`@ 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! P #20010@,0K0K  @ 5S X80`\SP(K 04@  04@ (9:P@xD?6::i:T`:@ -`Lp@9,{9t0 S0  1 B00 16 \00<00 4 5X08hl| 0?0hl :h@lP &00 .80S@P80PS 5LS@ 3+80PS<@xD?6:: -< L"80S"4p`@P P 4@ PP9t0 S0  !00 |!Q7 t1QF 0CQd1\06 0<0T1 X04 8580S@P80PS 5LS@ 380PSlhq 0h0 0006 \0T0 006 T h0\0X0 00P06 \0hls 0hl{ 0@HI6::8: -L M@ < p"80S"40@< <0 80$#Q :4Q= 4Q: 4Q7 @0 (,  h0@ h0 P <S  @,0S P4%P @4P 0P \2R:0R60RP0CRH0CRV:00000#20010840 5S A,0K0K84 @5S8 40\d1Rz 1R |1Rs0CRp*90CR060l4P"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CS@6:$P(o&$.0H;H:@&$T`:v'$qʄ -LM<0p#4 兀4 O4t0 S00A0\000406 0 `<80X0 580`S P 3B@@A@@PP(0K,K  P80`S$K@xD?6:::T`: -LM< <0p#4@ 4j4 ,4R <t0S0 \40 t@@ 08<00 4@5@ <8P`Pß00K<, K5S"8`\PPv HP 02C80 0010,0K0K< 5S 0< ]5S 0010040 DP㼢 h0l h0l @4Cht2Pl0 Z 0%<305< 00, 8 RY 00 5S 0 1!4G8`\PPt0S5 P3` PUOZ!80`S'چ2#0010@ P3   P0 3 050 80`S(K0 330300 5S4 0@dl30 t@Tg3t0S 0 @0+ \00 @dY>@T`:@@@P@ @@@6: Q-LP Q# hqp@p@`h0 l`XV@0#Qg 3Qs 3Q 3Q 3QE @@`h 0`lXV@ T3Q- H3Q* @3Q' 83Q$ 03Q! (3Q 3Q 3Q 3Q 3Q 2Qu 2Q 2Q 2Q 2QS 2h h0 lhl\ h0l` h0l hl l hl hl h|h0l hl@ uh0lT mh l0h@l0\ hl` 0hl0 h@l 0hl0 Ghl0 Bhl 0=zhl0 hl@ 0dghlT 0_:<::::;;$::x::0:H:T::t@P -0LS 2@ -LM`h0@ l |2"209R@7 P"0@T u29 S0!u2%0K&0K900}"0x&[Pp @Pp3F@T_W  x!0 |Thl0@ m p!0 u8\1\!0%KQ&K4 &@K8@80S5t"R%K&0KtƕS0!t2%0K&0K809t0 0&KQ%K %@KtB3d43 0t0 0Qp0p 0Qt2&K%0K8%[ 0$ K0S ~ri>i>i>i> Q-P L Q ;@ y; V p-@L, 2P`S_ _ ဘPj Q : 080*4p -LM P`p4  Nⰽ@84 0P @PdP 0  @PPXP_ 0,K$@P 1(K, (0P,  0`1,P W 0<040 @寻P9T!0988#8S, 84P 0T804S $9+ !84P 0T8!(? ~P 080*40!Sx0804S T8 004S T,0U 0@$!9T@@`? - 04@, L8x0("(R h0R ` h-P0!SL0  P  R (0!S<0 S7i>27$95%Q0b 5% -2LPh^`" ,2@P<"C.,T 2" R  ,2"qaR@  ,T2!,2@!,T2|!,P2+,2@0+\2"R  5\2"R  5\2 5\2 5\"0+\2 ,=0 @5E帕88844(4 404 -D0L R 5% c>.Q@p3 0-LQ@4 0\4PSTT4\TS L4TTS 3H$LT03P$3X$ 0-LM@\# Q (PU $0 B  $  8 00 008 -l"L0PTPEL" 2,p\$^P`"0 \2"RB.+0\2^!0 \2P!0C.\2@SE*2p0Cl!S00"A.\2P0!4-\2S00C$QS(%Q 4S4(52 ,"4 \ Q00+\Sp0Sd02\ 4\2&(8$8888 ` ` 8(8 p,80@-@Q: ; <0! 4S04. U0,Ŕ000!00 0 04AS10 0 S&00 (52 0 0| 8#8 0C8R #80%000 <0$ 4S04000 $& p-2L`,0\"4P1"B/\Q 4S2 z?\"@0Q@Ŗp"F/2,P\Q0@08"E/\2"R. +0\3#6I@R0A@Sx5C SDH @  SDH @  SDH @ #1R @Q6QF 0AQS Q "0,\2P(!.0\2P!t5J/\p2 ,"4 \2*,"<*\Q2@  0\28 4\T (|((((((,(2S 0 02@ 0@02 0 0  0 202 -2L@ ,"1 \ -2L 0\ -2LS 2 0\2 0\ -Pp(0` L@P8 8  (#8880P  0-0L(@PP  800 - <L0(8P#8  - L(@0P0   Rp@-P`0 0  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM2@0CS( 0KGPK4  (20CS`%;`%;8%;8%;Ĕ 0(  -d2L M\ p R U,200 !C0(@8 T#8@,0 Y`  $0  B 200, 0K U9  0PS 00@0@(0 S05(@T $005 $pZ000!00"UPB,5% U`~- 0"0S P 0(\  $0  B X0 U X9;ô9R09 00 R098 #80(K P&$ -LM@ 1 PP4Q0c000‘ 0Rp`R$R 0 0 0 $$Vt$$R000$R  K$ 0 CnC`FR p   K$ -LM`%L3R8 K< P<0 <ŕpe(@T #0@2 pX5" Y ŕ1B(`@V  $0  Bŕ $` V `5"K0C`50 Q0aࠑ2K20CS0A8ࠑ#蠁 0B #P0@@0R00S \S_ 30CT&5P05 kY055fY!p`5WpS<ŕ(@T X!0@2 8K0pu(K 30T^0N8# * K5S, 101[Q % 00a 0"[00b05`e0 00Y E  Z8K_W3T 30T 00eet5 `%a+8l>|t@ -LME`T0 0 R&p0pS  5(PU $05$X005`0 @ RʀET  3055S05P X055| -LM,E`T9 0 R/p @Q (0S0Ŗ(PU  $0  B0Ŗ $P X00Q 0%00D0p R,ET  0,505S005& -LMÐ@p  p 0` PP  <)00 0(K 000p p *,PP  0)0 0 04PP  0)0  0Ø0  P00PP`  ()0 8@@$@d@ -L MAP  0$P) `K0#S%@p0` @Rڄŕ 00 0 `Pp  Le)<(\ ` @ $0  B `|@@ -@0@L  0P,A) &@ -LM%r1G@`PXU  8))7+WP5705; 00 #0CR6Ŗ 0P*(\  $0   <(\ 0@ 00 P" ,0@<(\ 0@ 0 0 HWT<@ -x0PUL tE0`Pp p`VtEp 40@ T@P `50f`5| p-PL @"X#`P p 0BUQ3t5 pePP p (p|l@ -L MP5P%@!0#S0%,Ep0 R0ŕ?0 0 ? 0 `Pp @ p`(  KH0 0C Ņ Ņą(@ T  5 &@ -LM20CSO K{ Kw![  1[ ; S 1[; S ($ S1[; S@@@ p-LM4@S2S xc3S 1  $R R<  R0$4_`K  51[S  .1[S  '![  10 1K$c3 S$ $P P1[<8#8 1Kx_`K  1[:8#8 1Kc3S$$P P1[<8#8 1Kt$F p-@L h]"1!1 Ô91|!!LAx1PP0! 10@0`P P P0 1F^,1$!20CS- 0# 0 0& 02S 0 00 0   phy2`S\0 0+@.@ 0&R;T;Q;LC;xP;#&0.+ p-LMo@405 P PS PE"0BRSR R R  K00b8![,10 1K2*, 3?;C0C?;c? "]>@R 0C/000 /  0 3";6PP U x&xMPT&xxP4&x#x&xNJ@@@ -L M(p P &(K͇  0O PPʹP {& Q- !|20S' @S@@'T 4 (0 |DPE·>0OEn   `P囹P L&0AS4( ` ;&E·E  0O_ 0P`wP 4,K$PP D!&꜒s, (0@,  0p1,P  &T &&p%2S h(4K 00K廰P 0 ė 0 (02h 0\2L 0\D8@T@pp@@@U;@`?xD?p? 0-4PL( ,ĕ? ,D0( 4b(, \0 6.5P "R,4#80b3 0BS020 %Z^@ 0-9P=9I0L9 @ZKWT[<3$0h p-LQP0`4 0@DSOc}p -2Lp ,0 4S 00C0SL1 R00004S% 0S 00iMN@M. q"0S 0P 5`E$ 0@00C0S$0@0@x0x 0S"0BRSR2-,"6-\@B p-LM@Po)%0 04Sx  20CS00dS& S0 S#0 R 0S x2&S 00x  K1[ 0<0x@XF 0-L@〸PxI 0hѷ -LM2@SX 2,,98#8 `2S+<8#8 `9`"0,\2S K2,,"0,\z?  h|"RxP2K 2KPpP GUp|"0 2,,? P "0,\CC -2L`^! ,58 X# U+ p U' %20 0!X PP("x ;P0–@h\d  \s Up5EK0 @5Em88& 0-LP㠷@0h -LdM,E,U 0`R _2 Sf %,21C0 h  t 0Ŗ0 @P T 5052 S7 (K|R@P0Ŗt 0@Pt (P$08#80CQʌ2SS;S9 S7 S5 , K00K2 %50%05t$27@ S(\  $0  B 0R57@05(\  $0 B 0,0 00 t%(0URS th@ x | #%,0@,Ŗ00(%0000, 2 @ R @0 0xP PPt |(0S| ;^ ,dpK0 0/Pp $2 R plP 2 lP R} 5,Ŗ00 ((0"80, 1 @p0PUpP @W 0 0 lx %RUC T!00j8#800h 0t000(\ t $0  B 0 400,%x2 S@ (\  $0  B 0 R 2–@\ 0 \ @t0@( 00b8#800h@x0 Q@$&88 -@L>p2 0CStN;tN;N;N;N;N;N;N;N;N;N;N;N;N;N;N;N; 3 S0("0*\ ';PP$ "he #x1R 3#,3 ,#03#5%" 3 S   28 <\ 1 _`P !Vh,&P !GhD9I@0;9 %d03h@ @@ Q0-L@P Q 0h9@ 0h90I0 0-PLd$0 S 00SQ;P;P;\Q;P;P;0Q;P;P;P;P;Q;P;P;Q;P;Q;x!@C00| c3 006S`0 00c#e3e36S40 0c#e3e#0 c3/00<@F 0-@L2P , 060;!5050X@ -PL@p`1TP 1T7 1T(  00@4T(6@@\0CT* 0T8 @A y2S> D@0F.@4T 7P  @6 0 R0 D@U> 0+2@@ ;@06nk@i 5i 6i(|@ p-LM6@=@SP x4S 2 S (\  $0 B 1`S W:zP PK1S3 W-zLP 061`S0  BPr0C2 S (\  $0  B V 2^| 5 \x 00S: BQ  10R\!`!  10C16;688 p-2L@ ,2PSP 9@0`0 @5`059@ 1S+Vp8P 2P J/t5\p03M @5`059@ ~ ` 02V ( -@LMT I  K  "R4 0Ó4Rp4, |$<0t4/ @ +cx%„ĄfÄPP("0BSa0 0[P? `2, "<0 0K c Z 2[ " 2" 3?< 3RD03P"On0`2>0 0'P (,2 3: 385X5P #X 2SS  ( S& S$ S#!  PQ'^ X' 03uDP3?2S2 05032 , P[;[;[;[;8o03u0 0 0@ p0 `2S0C5<D;H;&|F$@@@t\;>8AA p-L@d3PP S3(ph5PQ 0TSOphlA *i>-8RV 8R ;7R0CR*30CR  0CR 0CR 0R0 0!]0CR7R MB R*0CR*0CR0CR*0CR  0CR&:000`00 \07RA0CR0#0%*0CR 60CR0CR*B=B?0CS000 \0h0M0CR | 0CR +6R z0CR 0R  T6R 0CR0CR* 0CRy B=B 0CS 6RI0CR*0CR0CR*0CR 0R  5Rk 5R0CRY*U=B;0CS 00P!!0 0CS0^;0^;0^;0^;(^;(^;(^;(^;x`;x`;x`;x`;x`;^;^;^;^;^;^;5R 00CRf000d0h k4Rf 4R| 0RU00Y4R0CR 0#0%S*0CR0CR9: 00J|4R0CR*0CR8 0 0@00W@4R -:r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,~c@ 0 0 0  \ 0-L@P08#XH0U #p 0U00 -h0!XSL@hd0Si{ip0,0 T嫧pW eP<  0 \\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@b0 ,30#@0T # 2RS  @0 \H0 0 \900@ 0\ 0 \0 -L(\@!h"x V:P\0w03 fW0SP H0S 80S S5 S S PPH0SWP WP  0,0 X  1 0\LPP  V%ԑ;ԑ;ԑ;4;;4;4;4;4;4;4;4;4;4;4;;4;4;4;;4;4;4;4;4;4;4;4;h;4;4;D; RPP 0P0 HPP1P0{ ?PPa?P0r 6PP0P0i -PP@1P0` $PPZ Ws P#2$!,0PUW] 0m`PPF4SVQ # !$W>  4P4W03P Cr -LM0PSD10208#x 0CSp7@`"K! 0P`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0ps p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS:;;;;8;8;8;8;8;8;;;;;t;t;;;;;;;@;;;;;;; 0480 0 0444#0 $L0H0P P080@0L3H8 R 80S;51K}1[ R028#8ʼ38)#8 0 480#0 0 4$440L0H0  0 8020#4,0@ 0#4#4080@03030 420L 4H  0  480#0 0 4$44 0H0L 0 , 0R80;HL3  0    \ 89))90b06#1&$ 0v@030KP1[;#5S1K01Kq@0w 8 0+#V 0\L -L(\P!h"x V:@0w03 fW0SLQ' 80SM@P0S W  V 11p02: \0 *0 000\ 0@P @W@  \@P0 Z @H@ 1@P" T@P80S@ W1 VP8<#64SVQ #!$0 "! 08#H^P W@t^W@# ("($ B("(W- #!$ @08#HT# 0 ,2 T 08#Z# ("($ B("(@@,' p-LM0P@`K1K![1[?T08#K  0xP@x 0K a c P80S S x)x%0 , : \p꺺' -LM `0BSpK40BS RPP 0@@@1[  @P1[@Q08#X 0 08#P@0U  0KqzP pKpK0 1[  # 0[ Ɍ #0KOX 꺺 -l(LP@"h3pP  8804 \N -鈀LP@`pP  8864 \Ѣ04 ,N -LM K0@0b`pP T1[1[001K1K![pP ⥢0 ,0P , <@ ;\0 9\ア 0 \ 0 \p - L0@6 \0 , hW - L0@6 \0 , h@("(  B0-RLM0@p ,U! 4`K0& 0 066 0  0   \0 , P -0L@B,, 0B,\0 , 0 \0 ,hݡ -LM0@0CSԥ;ԥ;Ԥ;Ԥ;Ԥ;Ԥ;Ԥ;;Ԥ;Ԥ;Ԥ;Ԥ;Ԥ;Ԥ;;;;;;;;;;d;d;d;d;d;d;0 ,-1 R45 Q8 9 S0,0  S0,0 S00,0,0 0000000 04 ,00 40,  KP1[0?>C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP50S4 S"x0 :380 \@0T* E0 ,@ 00CSp x ppD 0| pdp -LM`pPp;0SS0 ,0L@0 \0 , 0 \0 , R R( R0٠0S S4 02. L1SV SV SWWd@@T 0#, 0,, <4<,\ R 0S0 ,#,3PP( C@, P0 ,@DP@$d1U@@{T0 , < \0,,@0T", 0,,2P0ࣇ*K$pPqpPm["[@08#XZf@@H$H 0 @HpP$,0K  P G W\0\!, 00!\09 1?P p40 ,0@ 1\0 ,0S 0 \0 ,0SL0dԟџTp'IMP[N -QLMP@0(0Sw S% x0:38 \P1Ub 2㤟0 ,P QT00CSY0 Lx E0 , pK 60' \0 ,`P8#h 0 ,0 8#h$ 0PU0`0D 0d70 -LM @KxdP`!p ZP "[00 2KP"[ ("(P+&(0  ("(PW P, "[  ` - LȠ ^,Ƞx? ppP`j@PV  b@T0  @ AA -LM`pPP*28#H2TF  T0#03x0%x05&80  T0@8W# 0 S VW  %@ @ *"(PW t0S x0S0  $ K<0bC0~P  0%@ -LM0P0CS"K` K0@XqwP @ 0SS S S( S @"[1@0t0SV(*("(@P V("(@P @T0ST(*("(`V 40@(*("(`N -L@0LSP`0i)\\  P p 0SSUBS) S p pS0 ,t0SU(*("(ApP pW0SW(*("(/PU p("("pP (*("(P -LM 0@ 0CS@ KP P1S1[1[::1K1K![` -LM0`@ ,0 ,TP| $A0AS|@ " KL@P2[ @ <2<2K2K"[||@P 0 \" K0@P2[\  @P  < \"[@R` 0-LM KP@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 0<P1[UP 0 S S ,aP x|A,WP x P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;8#8# S01Kq$$ P +8@ a -LM8 K@lP1[;8#8 1K0` 0-0LS@P 0sPPd PP 804 PP$ PP PO$ -LM P@P t!@P @P`pK @P  @P1[0S 0F8#h @P @Pݛ,@P՛ x@P r@P` @P @P(1[0F8#h@BP 0-LM@ KPPPT1[1[001K1K1[;8#8 1K98` 0-LM0P),0 ),0 t),0 X),0 <),0  ),0 ),0 (,0 (,0 (,0 (,0 x(,0 \(,0 @(,0 $(,0 (,0 0CS0',0 ',0 ',0 ',0 l',0 P',0 4',0 ',0 &,0 &,0 &,0 &,0 &,0 p&,0 T&,0 8&,0 &,0 &,0 %,0 0CS0%,0 %,0 SK00t%,0 P%,0 4%,0 %,0 $,0 $,0 SS0$,0 $,0 x$,0 S0A,,0 0$, 0 0CS00CS0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ]08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, L@K ` \ X T P L H D x@ l< `8 T4 H0 <,&@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@S`PPP0S5 0( ,0.,p KPP1[ V !K @@01K1[01KP1[;1KT![+P0,,H@01K1[01K` p-LM0@SS  `x0,P Kf`P1[+  PPR1[9 S\  S\ 0 \x -LM K@CP; 0SE   K:P31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S;;;;1[;1K![P 0S  ![1[;;1K1[;1KK -LM@\p`0S\?0Ǒ00 PU! 0S= S 0Sn 0 ,?0@d0 00000 PU0S "K P2[P  P0dS S2[@00\0Sl 0 P2KtP0A., ?0 0A.\$ KyPU2[2[;;2K2K"[\00S[/ N5.n>Lm>6n>Ll> 0-L M @0BSGR R K00S kP0SS0S PK FP @P1[   K7P K1P![  1[  |0S! 0(0K K+P1[S(00S; S  S |0SS 1S0 0(0(01[; S0(01[; S -L M0@S0S(0 ,0 `, p0BSP#RR1SER R 0BSR PK K" K1P17S @  0^/0\ @0 \010S0^/,P0 , P`K PP ~PP[0 !S@  0 S! 0S t$U=A0C8QS\4Q 0SS S SS   S S S  0BS0BS&0S&0S 0 \0 , 0 \0 0\0S  0SS PPK1Sk $K& KPPB2[S 1S_ 0,, 0,\ QN0^/,PE Փ0-,0 3715 rP0P0  01^/\0 , A0 \JPP 0-, PR0S 01@(PP6 & KP=2[?09PPo & KP.2[ 020)PP[PPP YPP PP  1S 0 1,, 0,\ -0LSS@6P Q P h6 -LM<@/0S-0A B8(#8"(p-08#8 1K$    ,| pp h \? P N[/s q!y012 p-LM@PPP  R KAP( Px026  P! 00CS80S) S- SS0 ,i 1[98#8 1KP(P0 P0P0 'T[ 0-LM0PS@ 8 0BS@T7 R R 0S @P0 x0b@Tl K@PT [R@ 0St00CS+E@P+?@P Rt 0BSR!2 .!* &!" ! h! L!  0! !      ot 0BSo @P\ @PV R`t0t0S SY-R@PB F1`#$%'5439`1DP` -LM0@(@ P,`" K@P8"[şQQ ;2<<K2K2K0A0S2[2[:L@0ÓL=Ã2K2K 0 \ 0SS S SS S S &K @P  K&K @P"[40 2KO@P2[92K"[F@P⛐0SK BK`$pK 0P 0P2[80F8#h 0SSS  P P @ P2[` 2[\ i0P c0FP8#h 0SS+ S) S S UO@P0"[LS00K2K2K2[08#8 U2K@l"[20 2K@Py a )@P[2[p08#8 2K@PP @PJ1p R2[2[;;2K2K"[@P;00CS70S40S1@-&K @P&"[00 2K@P3 &K @P2[`08#8 2K_@P @tSS> @P"[D00 2KD@P  A?$AA p-LM@PP |`K00f PP ,Xx1[;8#8 1KPP  QKPP B?x![10 1KPPV QKPPR1[08#8 1KPP X QKPP=0 1KPP8 QKPP49 QKnPP.1[:>08#8 1KPP QKZPP QKPP h0 1KPP LD}<z4w,tAHA$AAN!lAAAA(A -LM0`0CS.PP K KPP2[?08#8 2KPP0 ,0SZ @0; \Q QQ QQ Q Q Q01Q 0SSG SE SSP SN SL Sp SSE SC S SPP0S5 kPP@pK PP PP !["10@1t08#H T a= \JPPz1SP PpMPP kQ00CS$@K XPP]p d<R P2[;2K2[ @R 0K2K R@02K R`02K0"[S0K2KP2[;2K"[PP2 0SLt0S-p ;R)  PP" 0S 2[t p08#RK`;p RX;0; H;0<8#8 2KPP 0S S' PPO0Sh $ K2[08#8 2KxQ>Q.2KPP č 0BS 0S 0BSfR7"PK PV0 S S2[ :2K "[JPF0SE X0P@S0XS0C0< S9   P2"[ 0  00TT0O TI T;2K"[  P P "0KLPP2[,)9C8#R5: PPz(PPQ qPm1S$ K_PPd2[#;8#8 2KPPYt?@PPQ 0,\1S 0S(PP9$@K -PP2"[70 2KPP(0 , 5 \ PP;P2[08#8 H2KPP4 PP"[ 70 2KPP PP2[08#8 2KtPP8S0,, <4<,\ R R 0BS0.,0S S 0CS 0.\0S/ S  $ KPP"[50 2K*PP0BSC0.,00CS 0.\0S S$ KrP"[ 50 2KP Pk2[08#8 2KPP\ QPPV2[ ;2K$ KFP$@KU >PPC2[08#8 U2KPP8 -PP22[#Q "K Q 0`02K2K"[0S0K2K"[PPPP1SfPP $ KPP2[#;8#8 2KPPQ "[20 2KPlt0S wPP qPP 0$ KPP PP2[tŸ 08#8  KTPP$ KPP"[$20 2KBPP2[!Q 00:"K2K Q:2K:2K"[10 2K&PP2[08#802Km$ KP2[08#8 2K $ KrPPw2[08#8 fP"[00 2KP  VP"[00 2KP PO:2K"[:8#8;2K"[ A A A:40R -LM0PSD1@0208#H|P`>( R Q ( 9 Q7Q| ' p0S6  R`00CS)0.<\ 00CS(0@0P,Z/0\0P,0.\ K$1S ( Q0x0x00AS R 0BSQQ0 0QQ| Qz 0&@Kx0x00Sx0/ P2[p及$ KP2[p 0 Lt0pR < CQ P0CQ T4Q L4Q 0 084Q$ \ p4Q 0 0R 3Q3Q  3Q  3Q  3Q 3Q 3Q \0 0#3QQ =Q x3Q p3Q !>Q0X#,>  x,3Q t0S0 02Q 2Q 0Q |2Q 2Q{2Q h2Qt s 0 0`Pp2Q4 2>CQ' )h2Q `2Qq0 082Q C 0CQv 0Qd1Q H 0CQ 0QY0 0g 0 0d 0 0a 0 0^l1Q <QG 0 0U 1Qk 1Qh 81Qb ?  "0KP 2[02 \1Q2 0Q 0 0.0Q) 0Q%|0Q :7A9>CS0 0 0LS0 0 Sg ( `!h!@_;`?B' T A@M AP A0 A0 T AT AT A A A AAPT -LM0PS 40S  0BRSR 0 0\0,0\ 0+\0 @, A90 , p R R 0BS%RE Rf 3 \P Ro RPm Rf0 0A S  Q R Q Q Q 0 0\0 , R 0BS0&, 8p&\ 0BSU0BSI0[,, }  8[,\b@"50Sq 0l@  0\0  3\02  㝆0 , : \0 ,}ㅆ0A S  Q Rx 0$, :$\ Q Qh0,, <4<,\QT0P$D4\K ~ %? 1S  3 \40S1S0#,I# 3 \l0 1\  0BS0,, ` 0 ,\0,,@ }`V 0 R0*0\0|"0\ <  CP" 00CS @ 待0AS帅0 , @TP ⠅0 , : \0 ,0 6\L1 S03$08#$0KG0 ,1[ 0 \ P0qS 0D , "'0p XP_eeeeT[ Na -L M pR\ 0BSsRRPPU1S 0ESU 0ES| h R 0BS``R`FN R` R R `FPQ@0;! 0\0 ,0@ S @0;! 0\0P ,U: R 0BSP P@ R6;S28 #8azw0,, &0KPPE RB[ 0D8s0BS22B@2K2K1T38#8 LR%<%<%<%<%<%<0000 00 8 \C(02I 0000 00^\0000 000000 000[,, ?00[,\*0 , 9 \0,, 3,&@K\ RP2[  *P, 2[  \0B[TT0@2Kdoy?_(9T[:d(8PAP!F7`0`aaQ`4` P"[P00 <8#8 2KPx "[00 2KP 2[:8#8 2KP "[00 08#8 2KnP$~,hP 42[H!H \2[X!@ dUTP  -HQLUp J@`!C@88< \@@AT 2ㆀ80< ,Pā?T῁ 0m>A -HQ0ULp7 @`Jὁ8A8< \@@AT 2S80< ,Pᑁ?T᠁80< ,@ᄁT 8#} 0, 0 AA< "< S "80S"4 0-L@PP Q < 0]t"R0l2ptR0 p-@L~0`=2ZPP  Xl”pt"< 0ph}} 0ph^A6 -LM'N_p@ P` 0  P4}@P (Km~l–0p X\0h2 ,K$P il2t"p }, (0@,  0`\1,P F DL: ` P0`2 P0`2 P0`2`@lB pt2  B l–p0 X8~3P<  h0=2 Z}3 D 8T ($A@ #?+$?C3<A<A16@`?xD?? -t0L@Q 0C 0L0 P40P? <<< 0-@L{0P  0hWz< Q-L Q 0 < -LM8p8!#8S`K !1 0圁?  4 Wx@Ά ,0^P @@zP 8 K 0$K$P0$ (P 0@$  ` ,0P 80!0 (R R |0Rt P0 h0R` 40 TT D@Pj<<A<p?TA(j<jlA`?xD? /r>n> -(0L@0  XU\U - 0L0 XU90K Q-L Q 9@ T -L@0  0XU`U -LM0p? 匁` 41 4 wPΆUL d@0P @PPXyP $ K 0$K$P00$ (0@$  0`0,0P  0 0 4, <0?8 |0"( Ƞ 0|XPT @<XU\UA#`Up?= -L_A -LYAOpenBSD5.8RAMDISK#44 @(#)OpenBSD 5.8 (RAMDISK) #44: Fri Aug 7 20:27:50 GMT 2015 OpenBSD 5.8 (RAMDISK) #44: Fri Aug 7 20:27:50 GMT 2015 miod@enfer.gentiane.org:/usr/src/sys/arch/armish/compile/RAMDISK %2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|z>Ԃ>>> >8>P>h>>> > ̃> > > >>>>>>>>>$>$>$>$>D>D>D>D>>> >!X>"X>#X>$X>%p>&p>'p>x>0>8>ṫ>4ԇ>4>D>$>D>H >\>$ >$,>48>D>tP>0\>8h>@8t><>@<><>H>L>PĈ>@؈>@؈>(>(>,>,>P,>@>H>|X>d>t>>!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5:: u <<4400$,,0,,H((`((l((pLJ p eSL#< @p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2`"ll#a#[# n bwi_mac_testexpand 32-byte kexpand 16-byte k n;AvXaM ְdx %P%L%%X%T%`%%Ԏ%h%x%(%Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2015 OpenBSD. All rights reserved. http://www.OpenBSD.org %D%%%%%P%8%0%%%%x&X&i $$ @ pp0px0r 00000 0 0000 00 |iiextent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????Uxr*f*i*Tg*(h*g*(g*f*8*(f*n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPP0><>H>T>d>p>|>>>>>>>>>>>>>>>>>>?>ieee80211_newstateV@ >@3,@0 P@G(@9$08@0d(>40,>`0>RD?ULDP@p4>T8>|<> \>5L>X@>RD>H>?7L>6@7D>7P> T>$@X>72\>@7`>6d>7h>l>6 >0,p>@t>Xx>!T|>>6\>5h>t>7x>d@@p>l?R`>7|\?7>A>H>C>J>K>>>@>I>>E>E>>>>5>x>7>7>н?d@>0'>>!>>.>>7B>7*>"@O>\p>`@J>h>7v>l>7Xd?z>+@ >>@7>B>7>6>8G?l{@E >6@Q@6 $>0(>G$,>:0>7H@Z4>E\@:^R@V8>w<>@>7D>@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ijH>TP>UX>Sd>Rp>x>F>I>V>E>>G>>B>>X>>D>> >7>@>5>>2>6> >8(>00>8>9@>H>4P>X>`> h>3p>hx>@>>>>"> >!>>:>>1>>H>@>J>K>A> >C> >$>@$>`>h>f,>g4>`<>aD>bL>cT>d\>ed>ip>jx>>>arpresolvearp_rtrequestigmp_init}E#(DoKgpqrstuvwxyz---d-PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@m/h/_/p/T/]/[/V/xV/LR/PS/R// ext2fs_blkfreeext2fs_dirbadentryH0h/>0p/T/<0:05050h30N030/dt0l0l0m0h?p0m0t?l0l0?uao_find_swhash_eltiXiiiiiiovmmapbsy\nd6_storelladdrnd6_rtrequest0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs-4|)4|)4 |)4#4 #4#4 #4 #4 #4d0?t0?z>0?0?0?0?0?0?z>   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dma_busaddr_to_paddrA4?=A4?= A4?=`A4?=A4?=`A4?=`A4?=`A4?=PT4?=A4?= A4?=D4?=D5?,=i 5?l= i5?= i5?= $i$5?,=0$i45?,= ,i$5?,=0,i45?,= .iD5?l=0.iT5?l=!id5?= !il5?=)id5?= )il5?=-id5?=Ait5?= -il5?=Ai|5?,=Ai5?,=Ai5?,=`A5?=`A5?=PA 5?=pA 5?=A 5?=A 5?=/A 6?=?A 6?=A 46?=A D6?=/A X6?=?A l6?=OA 6?=A 6?=A 6?=/A 6?=?A 6?=OA 6?=A 6?=A 7?=0A 7?=0A (7?=pA <7?=pA L7?=A `7?=A p7?=<>7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?$8?$8?,8?<8?L8?\8?l8?|8?8?8?8?8?8?8?8?8?9? 9?9?9?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?8?|9?9?9?9?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?8?9?9?9?9?$9?,9?49?9?9?9?\9?d9?l9?t9?9?9? 9?9?9?9?9?9?:?:?L9?T9?\9?d9?l9?t9? :?4:? 9?H:?\:?p:?:?:?<9?D9?L9?T9?\9?d9?l9?t9?9?:?9?:?:?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?9?9? 9?9?9?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?9?9? 9?9?9?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?9?:?9?9?9?:?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?9?:?9?9?:?:?:?:?<9?D9?L9?T9?\9?d9?l9?t9?:?9? 9?9?9?$9?,9?49?<9?D9?L9?T9?\9?d9?l9?t9?x4x=?X4=?x4=?X4=? 4=?=? 4>? >? 48>?\>? 4p>?>? 4>?>? 4>???@````` ```H?0H?w?>0w?>Hw?>`w?>w??w??w??w??x??,x??Hx??dx??x??x?? x?? x?? x?? y?? y??8y??Xy??py??y??y??y??y?@y?Az?B??z>? ?4?8?D?z>L?X?z>`?d?z>L?l?z>L?x?z>z>?z>??z>??z>??z>Ȥ?Ф?ܤ???z>`??z>????(???z>??z>??z>?ȥ?z>إ?ȥ?z>??z>??z>إ??z>إ?$?z>4?L?T?z>d?l?z>x? z>z>z>z>z>z>z>z>z>z>z>z>?z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>li|5tiT566t6666\4\4\4_4\4\4]4@`4]4]4 ^4`4\4\4\4`4D]4l]4]4`44^4\^4^4a4a4 a40a4@a4Pa4^4^4a4a4_4a4a48?@? @? H?P?ABCDEFGHIJKLMNOPQRSTUVWXYZx`6ܺ66H6?(?4?H?T?\?d?p?|???????̿?Կ????X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@@@@>@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^H766H766777Ll7(:7*7ugen_set_configttU7Q7O7P7U7_7P^7=0?=RA= NB=]bB=C=RD=IE=$F=J4F=RF=7lG= G= H= H= :H=KJH=H=@#H=H=H=H=H=H= H=H=H@H= N0I= _I=J=K=\M= 8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    tk74k7 k7l7k7Hl7Xq7m7m75dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRK`$y7\w7w77Č777}77|7t|77(  2 v      W 1 Q `  7@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   \7  L+ L 7L2 D   O  {7o  A f d7d77fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |7x7<7 B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- 7P77  JK0 r7H77788$$0$0$$$$$$$$$$$$$$ $88$8@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0L488:8382V{%1" `"'`~%ZP ` L8`M8LL80w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- j8j88i8hF F hF fF |8,z8y808T88ԡ8488url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@888L8D88`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ```x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !R R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l(8|88G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h8T880    \8<88   &  l! eT888@88 8 B  Q  X88h8=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < ??P????? P??=(?=8?=@?=H?8=C?=T?=\?L=l?=t? =|? `=? =? =? h=?Ԉ=?= >(=?X=??)g?:g?%h?2h?6h?rh?3i0?ri@?qT?qd?q|? q?0q?4q?5q?6q?#r????'? ?,?34?5 @k? @k@ @kA @kB @kC @kE @kF @kG @kH @kI @kJ @kK @kL @kO @kP @kQ @kR @kS @kT @kU @kV( @kW@ @kXD @kYL @kfT @kgd @khd @kit @kj @kk @kEl@8 @8 @@푠 @홠 @ @ @ @  @0 @`@p @@$@0@<@H@ T@0`@`l@px@@@@@@@[@!@!@!B@! @!B$@Cu5@4@L@P1h@Q1@R1@T1@U1@P>@T>@p>@6A@7A@DA@EA@FA$@GA8@HAD@IAX@JAh@KAx@PA@QA@RA@SA@TA@UA@VA@XA@dA@pA@qA@rA@sA@7B,@BB8@CBD@6CT@7Cd@ACp@BC|@EC@GC@HC@IC@LC@MC@SC@TC@XC@aC@bC@cC@eC @gC@hC@iC$@lC0@mC<@nCH@pCT@qC`@rCl@sCx@tC@uC@vC@wC@xC@yC@zC@{C@C@C@C@C@C@C@C@C@C@C@C@C(@C4@C@@CL@CL@CL@CL@CL@CL@CX@Cd@Cd@Cd@Cd@Cd@Cp@C|@C@C@C@C@7D@TE@BG@DG@IG@LG@MG@NG@OG@PG@QG@RG@SG@TG@UG@VG@WG@XG@YG@ZG@fI@gI@nI@HJ@IJ@JJ@KJ@LJ@MJ(@NJ8@OJL@PJ\@TJl@iJ@HK@IK@JK@KK@LK@BL@DL@EL@FL@GL@IL@ML@NL@PL@QL@RL@SL@WL@XL$@YL<@ZL<@dLP@fLP@gLP@nLd@FMt@LMt@DN@EN@FN@GN@HN@IN@JN@KN@PN@QN@RN@SN@TN@VN@dN@gN4@hND@APX@BPX@CPX@DPX@EPX@FPh@GPt@HPt@IPt@JPt@KPt@LPt@MPt@NPt@OPt@PPt@QPt@RPt@SPt@TPt@UPt@VPt@WPt@XP@DQ@EQ@FQ@GQ@HQ@LQ8@MQ@NQ8@OQ8@WQ@XQ@YQ@ZQ@^Q@lQ8@ERt@FR@GRt@KRt@LRt@HSt@KSt@LSt@MSt@NSt@FTX@LTX@RTX@`T@bT@dT@HU@IU@JU@KUL@LU0@MU@@NUL@OU@PUP@QU`@RU@SU@TU@mUp@JV@KV@OV@RV@SV@TV@UV@VV@WV@wV@0X@1X@2X@3X(@4X@@5XP@8Xl@@Y@AY@PY@QY@RY@TY@UY@WY@XY@`Y @aY@bY@dY(@eY<@iY@tY@uY@xYH@zYH@{YH@|YH@}YH@~YH@YH@ZT@Z`@Zl@Zx@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@ Z@1Z@3Z@4Z@6Z@7Z@8Z@9Z@?Z@AZ@BZ@aZ@bZ@`[@b[@c[@d[@e[@p[@r[@s[ @t[@u[0@a\@@c\@@D]X@H]h@I]|@J]@L]@M]@N]@O]@P]@R]@W]@o]@r]@H^@J^@K^@L^ @M^0@O^D@m^X@O^p@o^@f@f@f@f@f@f@f@f@f@ f@!f@#f@1f@`f @cf@df,@ef,@gf,@of@g4@g4@g4@g4@g<@g4@g4@gL@g4@ g4@g\@gl@g|@g|@g@ g@!g@"g@#g@$g@%g@&g@'g@(g@)g@8g@9g@>g@@g @Ag@Bg,@Cg<@DgL@EgL@FgL@GgL@HgL@IgT@Jgd@Pgt@Qg@Xg@Yg@[gL@]g@_g@`g@ag@bg@cg@dg@eg@fg@gg@hg@pg @qg@rg,@xg<@ygL@{g\@gl@g|@g|@g@g@g@g@g@g@g@g@g@g@h@h@h@h@h@ h @h@h@h@h@h0@h@@ hP@!hP@"h`@#hP@$hl@%h|@&hl@'h@(h@)h`@*h`@+hP@-h@/h@0h@1hl@5h`@7h@8h`@9h`@;h@=h@?h @@h @Ah, @Bh< @Ch @IhL @Lh@PhL@XhL@YhL@h\ @hd @ht @h @h @h @h @h @h @h @h @h!@h!@h,!@hD!@hT!@hd!@h|!@h!@h!@h!@h!@h!@h!@h"@h"@h,"@h<"@hL"@h\"@hl"@ht"@h"@h"@h"@h"@h"@h"@h"@h"@h#@h#@h$#@p0#@p<#@qH#@qX#@qh#@q#@q#@q#@q#@qH#@ qH#@ qH#@ qH#@ qH#@q#@q#@@q#@Aq$@Bq$@Cq$@Dq,$@Eq4$@Fq$@GqL$@Iq`$@Jq$@Kq$@Lq$@Mq$@Nq$@Oq$@Qq$@Rq$@Sq$@^q$@_q$@`q$@bq$@q$@q#@q$@q%@q$@q%@q%@q0%@q0%@qH%@q$@q$@q0%@q`%@ql%@q%@q%@q#@q%@q%@q#@q%@q%@q%@q%@q#@q &@q&@q,&@qD&@qT&@q%@qd&@q|&@q&@q&@r&@r&@r&@@r&@Cr&@Dr&@Er&@Fr&@Gr&@Hr&@Ir&@Jr&@Kr&@Lr&@Mr&@Nr&@Or&@r '@r '@r '@r('@r '@r@'@rP'@rP'@rX'@rh'@rp'@r%@r '@r'@r'@4x'@5x'@y'@y'@y'@y(@y'@y'@y'@y'@y (@y(@y,(@?y@(@Ay@(@By@(@lyP(@myX(@ny`(@oyX(@l(@l(@l(@(@(@ (@ (@(@@(@A(@B(@C(@D)@F )@J0)@KH)@Ld)@Nt)@P)@R)@V)@Z)@[)@^)@`)@bd)@j)@k)@z)@{)@)@*@*@(*@8*@H*@X*@h*@x*@*@*@0)@*@*@*@*@*@*@*@Ô +@Ĕ +@Ŕ8+@ǔH+@ȔX+@ɔt+@˔+@̔+@͔+@+@+@+@+@,@ ,,@H,@\,@l,@,@,@@,@O,@R,@S,@U,@W,@_,@-@,-@H-@`-@x-@-@-@-@-@-@-@.@.@,.@<.@T.@•d.@ĕ|.@ŕ.@ƕ.@Ǖ.@ɕ.@̕.@͕.@Ε+@ϕ+@.@/@/@/@(/@4/@D/@@T/@Ad/@Bt/@C/@D/@E/@G/@H/@I/@J/@K/@L/@N/@O/@/@/@0@0@,0@D0@T0@d0@d0@t0@t0@0@0@0@ 0@ 0@0@0@0@0@ 1@ 1@1@,1@ <1@ <1@ L1@ \1@ l1@|1@1@1@0@1@,1@<1@1@1@1@1@1@1@ 2@2@,2@<2@L2@\2@0@0@1@1@1@l2@2@2@ 2@(2@02@82@P 3@X$3@`<3@hT3@l3@3@ʜ3@ʨ3@ʴ3@3@PG3@C3@P3@4@ 4@!4@4@ 4@(4@04@04@04@04@04@04@04@84@@4@H4@#P4@$X4@'`4@)h4@*p4@+x4@,4@-4@.4@04@24@44@64@4@04@4@04@(4@04@4@4@4@ 4@i&4@iH4@ib4@ic4@is4@i4@i4@i4@i5@i5@iH 5@i` 4@ib 4@i5@5@(5@45@#H5@#P5@@#X5@@#`5@@@h5@0!p5@P!|5@R!|5@D5@D 5@D5@D5@;Y5@`5@ `5@p5@5@5@5@5@V6@4@v 6@6@ 6@9,6@:46@;@6@<H6@=T6@>`6@l6@Ax6@B6@C6@Dd@El@F6@G6@H6@I6@J6@L6@M6@N6@O6@P6@S7@T 7@U7@V 7@W(7@Y07@Z87@[@7@]H7@^T7@_d7@bl7@cx7@e7@h7@i7@j7@k7@n7@o7@r7@s7@t7@w7@x7@y8@z 8@{8@}8@~(8@48@@8@L8@T8@`8@l8@t8@8@8@8@8@8@8@8@8@8@8@8@9@ 9@9@ 9@(9@09@89@@9@L9@L9@X9@d9@p9@|9@9@9@9@9@9@9@9@9@9@9@:@:@:@(:@4:@@:@?L:@X:@d:@l:@t:@|:@:@:@ :@ :@:@:@:@:@C:@C:@C:@C:@C;@C;@C;@ C;@!C;@"C@$C ;@%C(;@(C0;@)C0;@+C8;@3C@DC@SC 6@WC@;@XCL;@DX;@D`;@'Gl;@Xt;@X|;@X;@ X;@!X;@"X;@#X;@%X;@`X;@aX;@bX;@W;@W;@W;@W!?W"<@WF<@P<@Q<@n <@o(<@x0<@y<<@tH<@K@T<@K@d<@K0p<@tcsg|<@}<@}<@}<@}p<@?<@%<@% <@%!<@%"<@%#<@%$=@%%=@%& =@%0,=@%18=@%2D=@,P=@,X=@,`=@,h=@,p=@,x=@,=@,=@,0 =@8=@=@=@=@=@=@=@=@=@>@>@>@0>@D>@P>@\>@`h>@`|>@`>@`>@7#>@7@>@7A>@7B>@7C>@7E>@@>@B>@D?@@?@B?@C ?@F(?@G0?@H8?@I@?@PH?@pT?@s\?@d?@1l?@1|?@$1?@11?@21?@5?@15?@qNC?@ ?@X@|@F?@@@ @@20@@30@@40@@@@@p@(@@@<@@@L@@@\@@@p@@@@@@@@@@@@@@@@@`@@ p@@@|@@@A@A@)|@+(A@20A@3HA@4XA@5lA@@A@CA@i|@l@m@A@A@00A@`A@x B@(B@(B@0,B@P8B@HB@ PB@dB@3pB@6pB@@@C$B@/B@xB@tB@rB@qB@B@B@B@C@B@RC@C@$C@Y4C@YLC@YdC@DpC@E|C@F|C@GpC@C@C@C@C@C@C@C@D@D@ 0D@@?pLD@pdD@pLD@pLD@p@8D@D@D@D@D@D@D@D@E@< E@xE@xE@x$E@x,E@xBJ@$ J@$0J@$PJ@$Q@@$J@$%J@$J@$K@$K@$ (K@$!8K@$"HK@tqXK@tPdK@tXpK@]xK@]hK@]iK@]xK@]K@]K@]K@]K@]K@](K@]8( L@]((L@8L@LL@o#p@`L@8pL@?|L@?L@?L@?ĀL@?ȀL@?L@?L@RL@TL@XL@'L@'L@L@WL@WM@WM@WM@W(M@W8M@WHM@WTM@s\M@s hM@stM@M@M@M@M@M@M@M@6M@M@M@N@N@FP(N@p0N@8N@<HN@<XN@<hN@< xN@<(N@<)N@<0N@<1N@<HN@<TN@<N@<O@< O@<O@<,O@<)@O@<*LO@<.TO@<hO@< O@<!O@<"O@<#O@<$O@<&O@<(O@<) P@<* P@<!4P@<!HP@<!\P@<!pP@<!P@<!P@<!P@<!P@<!P@<!P@<!P@<!Q@<!Q@<!0Q@<!DQ@<2XQ@<2lQ@<2Q@<2lQ@<2lQ@<2lQ@< 2Q@<"2Q@<#2Q@<%2Q@<02Q@<12Q@<22Q@<32Q@<42Q@<52Q@<62Q@<72Q@<82Q@<92Q@<:2Q@<;2Q@<<2Q@<=2R@<A2R@<C2,R@<E2@R@<G2TR@<I2hR@<J2|R@<K2R@<3@<3R@<3R@<3R@<3R@<3H?<P3R@<Q3R@<R3S@<S3S@<T3,S@<U3@S@<V3TS@hS@pS@X6@xS@S@S@S@S@S@ S@3 S@3!S@3"S@38@3|@3@TS@T5S@T5S@7!S@S@T@T@ T@,T@0T@DT@PT@ S@"XT@.@6`T@>lT@WtT@T@pT@T@@T@T@T@T@$T@T@U@ U@.U@:$U@<0U@j^@@^@C^@H^@I_@J_@K _@L,_@M8_@P^@Q^@R^@S^@T^@U^@V^@W^@X^@YD_@^P_@_P_@`P_@dX_@e^@f^@g^@hd_@it_@j^@k^@u_@v_@w_@x_@y_@z_@{_@|_@}_@~_@_@_@_@_@_@_@_@^@^@^@^@^@_@_@_@_@_@^@P_@P_@P_@P_@_@_@_@_@_@_@_@_@_@_@_@P_@`@`@ `@,`@8`@D`@P`@\`@\`@d`@l`@t`@`@`@`@`@`@`@d`@P_@P_@`@`@`@`@_@`@`@l`@l`@l`@`@a@`@ a@a@a@_@`@$a@`@ a@ a@ a@ a@ a@4a@0f@Af@pe@qe@re@$f@$f@4f@4f@Df@Df@Df@$f@ $f@Df@Tf@Tf@Tf@Tf@Tf@Tf@Tf@Tf@ df@"xf@&f@-f@1f@:f@;f@=f@Df@Ff@If@Jf@Sf@Uf@Vf@Wg@Xg@Y g@],g@^8g@_Dg@Pg@Pg@ Pg@`g@`g@`g@`g@pg@g@g@ g@!g@"g@#g@,g@0g@1g@2g@3g@8g@9g@:g@;g@<g@@g@Ah@Eg@"h@# h@##,h@h@0#Dh@2#Th@4#dh@5#dh@B#ph@C#ph@D#ph@E#ph@F#ph@G#ph@H#ph@I#ph@`#|h@#8h@$h@$h@$h@$h@$h@$h@$h@ $h@!$i@"$ i@#$i@%$(i@&$8i@($Hi@@$\i@B$hi@C$ti@D$hi@E$i@F$i@H$i@I$i@J$i@K$i@L$i@N$i@P$j@R$ j@S$j@Y$(j@]$(j@$4j@$@j@$Pj@$@j@$dj@$xj@$@j@$j@$j@$j@$j@$j@$j@$j@$j@$j@$k@$j@$k@$ k@$,k@$j@$(s@O(s@0(s@1(s@2(s@3(s@4(s@5(s@6(s@:(s@?(s@A(s@C(s@E(s@G(s@I(s@K(t@O(t@P( t@)0t@))t@@)t@B)t@D)t@F)t@H)t@J)t@L)t@p)t@q)u@r)u@s)u@t)(u@u)(u@v)8u@w)Hu@)Tu@)`u@)lu@)lu@)xu@)u@)u@)u@)u@)u@)u@)u@)u@)u@)u@)u@)u@)u@)u@)v@)v@)$v@)0v@):`~@@:t~@B:t~@D:t~@F:t~@H:t~@J:t~@Q:~@U:~@`:~@b:~@d:~@e:~@f:~@g:~@h:~@i:~@j:~@l:~@n:~@p:~@r:~@t:~@v:~@x:~@z:~@|:~@;@;@;@;@;$@;0@ ;8@ ;D@ ;L@;X@;d@;p@;|@ ;@!;@";@#;@%;@&;@(;@);@,;@-;@.;@/;@0;@2;@4;@6;@7;@8;@9;@:;@;;@<;@>;@?;@B;pV@D;pV@F;pV@H;pV@J;pV@L;pV@N;pV@P;pV@V;@W;@d;@e;@f;@g;@<@ @< @< @< @< @< @< @< @ < @ < @ < @ <(@!<(@"<(@#<(@$<(@%<(@&<(@'<(@(<0@*<@@,P@?P$@@P@AP@DP@EP@HP@IP@R@Ră@EXԃ@e@e@e@e@e@e@e@e@e@e@e$@e$@e@e@e@e@e0@p<@pH@ pT@0p`@qh@qp@q@q@q@ q@!q@"qĄ@#q؄@$q@%q@q@q@q@q@q @q(@q8@qH@qX@qd@qp@q|@q@q@q@v@x@@ą@؅@ @@@@@@@ @@$@,@<@<@<@H@H@T@`@H@H@l@Ąx@ń@ʄ@˄@@Ć@؆@@@@@@@ @ @ @ @ @@@,@8@8@8@8@,@H@T@`@l@x@@@@@@Ї@Ї@Ї@Ї@@ @Ї@Ї@@@@@@@@@ @"@$@&(@-(@18@:H@;H@,@Pd@Qd@Rp@S@T@U@V@W@Y@Z@[@\ğ@]̟@^ܟ@`@d@e@f@g@h@j(@k8@lH@mH@nP@~d@p@@@@@@@Ԡ@@@@@@(@8@P@d@t@@@@@@@@@̡@ܡ@@@@@@$@8@L@@\@\@l@@$@@@@@Т@@@@@@$@4@@@@L@A@B@D\@F\@Pl@Q|@R@S@a@e@gģ@pԣ@q@r@t@u@v$@x8@yH@z\@{p@|@@@@Ԥ@@@@@(@<@P@`@p@@@@@@@ĥ@Х@إ@@@@ @@,@<@L@X@H@H@H@H@H@H@d@|@@@@!@@@AĦ@BԦ@D@G@P@Q@S,@X@@YP@[`@`p@ap@bp@cp@d|@e@f@g@h@i@k@l@mȧ@nȧ@oԧ@pܧ@q@r@~@@@,@$@8@L@`@p@@@@@@@@@@@@@@@@@@@@Ш@@@ @! @"8@$H@&\@'l@(H@)H@+|@,@-@0@1Щ@3@C@G @H @` @a @b @c @d @e @f @g @h,@i8@j8@lH@mH@nT@p`@qh@rx@sx@t@u@v@w@x@z8@~@@p@@@@@@@@@@@@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ȫ@Ԫ@Ԫ@Ԫ@Ȫ@Ԫ@Ȫ@@@@,@,@8@H@X@X@d@p@p@8@|@@X@X@H@@@@@8@d@d@@ī@ ث@!@"@'@(@@,@A,@D8@E8@FH@HT@I`@Jl@Kl@L|@M|@N|@O|@P@Q@R@S@T@U@V@W@X@Y@Z@[@\@]@^@_@@3Ȭ@;ج@A@B@C@G@H@L$@M$@N$@O$@P0@Q0@R0@S0@T<@U<@V<@W<@XH@YH@ZH@[H@\T@]T@^d@_d@`p@a|@b@c@h@i@j@l@mȭ@nȭ@oȭ@ԭ@@@@"@$@@4@H@X@Q@Rh@St@T@Y@Z@[@\@]@^@`@a@b@c@t@u@v@w@x@y@z@{Ȯ@|Ȯ@}Ȯ@~Ȯ@Ԯ@Ԯ@Ԯ@Ԯ@Ԯ@@@@@@@@@@@@@@@@@@@$@4@4@4@4@@@@@@@@@L@L@L@L@X@X@@Eh@Gx@I@K$@L@a@c@lȯ@}د@@@e @ @ @ @ @ @ @ @ @ @ @ @ $@ 0@ @ D@ D@ D@ D@ D@ D@ @ P@ P@ P@ P@ \@ \@ \@ \@ h@ h@ h@ h@ t@ t@ t@ t@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ а@` @h @i @v @y @z @{ @} (@ 4@ @@ @@ @@ @@ L@ L@ L@ L@ X@ X@ X@ X@ d@ d@ d@ d@ @ @ t@ t@ @ @D@E@Fȱ@Gر@H@I@K@M@Q@@,@@<@L@\@l@L@|@@@@@Nв@ز@@@!@EW@EX@Eh@Eh@E!(@E4@E<@E"D@EaL@1 T@d@l@t@ |@!@@@@@@@@@ ȳ@г@س@@ @ @ @@(@8@!L@#X@l@ @h @ @@!@B@Myx@Mx@д@@@@@@f(@f0@f@@f0@f@@f P@f`@fh@fp@f@f@f@f@f@f6@f@f{@f̵@fܵ@f0@f2@f@@fA@fB@fD@f@f@f$@f,@fd@f4@f@@fL@f\@fh@f t@f!@f#@f%@f'@f0@f4@f@@fAȶ@fBԶ@fJ@fK@f@f@f@c@c @$@4@H@X@ h@ t@ @1a@1b@10q@13q@14q@15qķ@11rз@Pܷ@f@f@f@f@f@@0P(@4@v<@wH@ eT@`@l@x@@@$@%@2@3@G̸@Hظ@@@@@@$ @2,@H8@$D@P@P\@h@t@Z0 @Z8 @Zu@Z3@Z3@Zq3@Zr3̹@Zs3ع@Zu3@Zv3@Zw3@Z5@Z5@Zp5 @Zq5,@Zt58@Zw5D@Z=P@Z=\@Zs=h@Zu=t@Z ?@Z0M@Z3M@Z8M@ZhM@ZiM@ZuRȺ@ZSԺ@Zhbܺ@Zib@Zf@Z f@Z!f @Z&f@Z)f$@Zur0@w<@w H@w"P@wX@w`@w@l@wt@w!S@w"|@w#@w#@w"#@w"$@w2$@w%@w"%@w2%@w0Ļ@w"0ػ@w20@w@@w"@@w2@(@w"T<@w2TD@wcL@w"cT@w2\@d@l@t@|@@@@@H@5@@@`0@b0@0@0ļ@0̼@2Լ@2ܼ@b5@5@5@S@@@ @1,@`8@pL@1X@d@0p@`|@!`@%`@1`@@`@``@a`Ƚ@ RԽ@'R@)R@IR@R$@R8@RP@)d@9l@)t@6|@8@9G@g@h@i@r@@@v@xľ@|C@pC@о@#ؾ@6@6@e@f @u@v,@w<@xL@!\@Ql@R|@@"@2@C@R̿@0ؿ@"@#@2 @R@z ,@3S1VD@3SL@3ST@3S`@3Sl@3Sx@3S=|@3S@3S@3S@3Sˆ@3SÈ@3SЈ@3Sш@3S҈@3Sӈ@3S@3S@3S@3S@3S @3S,@3S4@3S@@3SL@3SX@3S d@3S!p@3S"|@3S#|@3S%@3S&@3S@3S@3S@3S@3S@3S@3S"@3S$ @3S& @3S*4@3S+L@3S,d@3S-|@3S.@3S/@3S@3S@3S@3S@3S@A@}@M$@M0@M8@#@@OH@OP@OP@H@?HCX@H C`@HDp@Hx@H!@HC@H@H@@!@@@@@ @ @ @J@J @J@JF@d$@,@#<@9l@9D@9P@9\@9H@9h@9p@9 @9 H@9@9@9@9@9@9@9@9@9@9h@9@9%@9@9 @9@90@9@$@9P,@94@9 @@90H@93P@95X@9@`@9Eh@9Fp@9Hx@9I@9P@9Q@9R@9U@9V@9X@9a@9b@9q@90@93@95@9@@9A@9E@9F@9H@9P@9Q@9R @9U(@9V0@9`8@9ax@9 @@9a T@9b \@9c d@9d l@9e t@9f |@9h @9@9@9@9@9S@9S@9U@9U@9U@9U@9qU@9U@9U@9U@9U@9U$@9b4@9bV@9cD@9c@9%c<@9&cD@90cP@9p\@9pl@9px@9p@9p@9p@9p@9p@9s@9u@@@@@o@o@o$@o ,@o4@o<@o D@o L@U0P@U``@UaP@Ubp@Uc@)@)@)BI@) a@M @M9@M @M @M(@0@<@H@L@X@X@@+d@Ph@TTp@UT|@\@@@@@@@@ͫ@@@@!4 @#@! @!4 @ hq@ hr @(@40@8@@@bD@X@`@h@X@ep@W |@=!@=!@!@"@ 0@0@0@)ܴ@ i@@;'@;4@;5@L@L=@L= @L4@L H@L\@Lp@L@L @L!@L#@L$@L%@L&@L'@L)$@L*8@L+L@L.d@L1x@L2@L3@L4@L5@L6@L8@L9@L:@L;@L< @L=,@L@@L1P@L2d@L3@L>@L?@L@@LA@L@L@Lf@L@L@L@L$@L4@LD@LT@Ld@Lt@L@L@L@L @L!@L"@L#@L(@L@@LA@LB@LD@LF @LG0@LH@@LIP@LJ@@LK`@LL`@LPt@LQ@LR@LS@LT@LU@LV@LW@LX@L`@L@Y@ @/ 4@/ <@//L@y@y|@yX@y l@y@y@y@yJ@y@y@y@y@# @# @#@# @#@# ,@#@@# P@# d@# x@#P@#`@#@#@#@# @#@@#%@#`@#@#@#P @#P@#,@#8@#`H@X@h@x@@@@@ 2@ 2@ 2@ 2@ 2@ G@@@@ (@ 8@PH@PPX@Rh@RRx@SPW3@`@`@`@`@`@`@`:g@`@`j@`@`@`$@`,@`4@`|@`<@`D@L@T@`@6pL@h@|@` @`ɨ@@8@X@Y@i@@@ @@$$@'0@6<@QH@ST@d`@l@x@@@a@q@v@@@@@@ @@,@<@H@T@d@t@& @@@"@@8@X@Y@i@@ @@$$@'0@6<@QH@ST@d`@q@@"@8"@X"@Y"@i"@"@# @#@$#$@'#0@6#<@Q#H@S#T@d#`@z( @{(@|(@}(@~($@804@@0D@C0T@D0d@P0t@Q0@S0@W0@X0@Y0@e0@h0@t0@0@0@1@1 @1,@1<@1T@1`@1p@1|@1@"1@#1@G1@H1@I1@W1@d1@h1@w1@x1 @1@1@2@2$@20@2<@'2L@02X@82@I2l@J2x@K2$@N2@S2@X2@Y2@i2@2@2@2@$3$@'30@63<@73@C3<@D3<@I3@Q3H@S3@d3`@q3@r3@z3@{3@24@B@8B@XB@YB@iB@B@C @C@$C$@'C0@6C<@QCH@SCT@dC`@8R @S@$S,@'S8@6SH@7S@QSX@SSh@dSx@rS@a?8bH@b@b<@'c@ScT@dc@r@r@s @'s0@6s<@SsT@ds`@8r@Xr@Yr@ir@r@s@$s$@QsH@1@5@@$@S @@ @,@8@H@X@h@t@0@Е@8@'@ST@d@@@@@@h@@@S@@8œ@'ä@S$@dì@ 0@8Ҝ@8@S$@8@S$@%tq<@L@`@p@@@@@@@ @ @ @ @ @@@@@@@(@4@@@L@X@d@p@|@@@ @!@"@#@$@%@6@7@8@9 @:@;$@<0@=<@>H@?T@f`@gl@hx@i@j@k@m@n@o@@@@@@@@ @,@8@`D@aP@\@h@h@l@x@@@ @ @@@@@@@@@ @@@p @t@x@y@@@@$@@,@w@0@8@@@L@X@1d@1l@2t@B@@J@P@P@@P@ @Pe@P@PZZ@Pf@J@E!@E$@SX@ @!,@@<@]H@]H@]P@]P@] P@] d@]P@]|@]@]@]@s@s@s@s@s @s @s @s@s8@s @@8@ @@W`@ a@{!@{! @{!@@=$@p4@W@@uH@T@ \@l@t@@@@@ @ @@@@`?@@"@#@%@(@) @+ @,(@/@@1H@3d@6h@7x@9@<@B@C@D@E@H@J@K@L@M@N@P@T@U @W@Z @[(@]0@`<@a@@fD@iP@kX@q`@sh@tp@w@x@}@~@@@@@@@@@@(@4@8@P@`@l@p@@@@@@@@@@@@@ @@@8@H@T@l@t@|@@@@@@@ @ @ @@@@@@'@1,@74@8<@<D@?L@BT@H`@Ot@Y|@]@c@f@r@y@@@@@@@@@@@@@ @(@<@L@T@`@h@t@@@@4@?@D@M@YT@[@]x?`@l@o@t@y@z@ @(@4@@@L@T@\@h@|@@@@@@J@M@Z@`@q@t@v@@@@ @(@0@8@L@T@`@t@ |@@@@%@2@=@E@M@O@a@b@@@@@ @@ @,@4@@@H@X@$h@8l@;t@b@@@@@@@@@@8@W@`@{@}@ @(@4@<@\@%D@7L@ T@;`@Th@}@@@@@@@@@@@@@@#@$@1$@W,@i8@qL@{T@\@d@t@;@@@!@6@K@o@s@@P@@@|@3@==@@@3@@@@@HC@OI @J<@FPD@SPL@3S@rS\@SXd@tcp@ff|@@@@@J@.@@@@@@'@Y@@ @ @,@}}}} } > > > >  >> ! >> >;2:";0$:.$:v$:p$:q$:4$:q$:ʄ$:$$:!$$:J$$:K$$:$$:$$:$$:$$:$$:$$:$<:$<:%$:%<:%<:&$:o&$:S&<:Q&<:R&<:'$:'<:'<:'<:'<:'<:'<: (<:!(<:"(<:$(<:%(<:((<:)(<:*(<:P($: )<:!)<:&)<:()<:-)<:.)<::<::<: :<:&:<:&<: ;<:!;<:&;<:(;<:-;<:.;<:<:<:<:`<:<:<:<: <:<:<:<: <:<:<:<: <:<:<:<: <:<:<: <:!<:0<:1<: <:!<:(P<:&#<:#<:: t:t:At:it: : x0:@:C0:F0:H0:I0::1:5:@:1l:qT:qT:d1T:T:$ST:T: T:T:I1;I2;;7S;rS;I3;d:U:;;;;::)R::::::3M:8M:0 :0M:hM:hb:iM:ib:u:uR:ur:3̂:3̂:q3̂:u3̂:v3̂:w3̂:s3̂:r3̂:=̂:5̂:=̂:5̂:w5̂:q5̂:u=̂:t5̂:p5̂:s=̂:H:H:H:H: H:x:x:x:x:x:@:A:B:J:K::e::::S:5:e:n::H:`:l:Y:;;;T;U;6;>;f;g;~;;;;;\;];^;_;P;Q;R;S; ; ; ; ; ; ; ; ; ;::IC0:iC0:vC0:C0:C0:nC:yC:zC:a# :c# :e# :f# :h# :Px::pY>_"]>,^> ^>L_>9X_> _>_>_>Pa>fa> Z_>b>- d>8d>{d>d>d>w! ]G4" eB"   w! ]G4"    XD31P@0qw!! rq! 2r!qq! 0          JtT4$&(`& 0&0 0 `"0 0    @DHL  @DHL  4@<@D@L@2""  222CC @ @WD2?2?  YCC6higW xv|w   &'(yz{u^_`}~&  3678{|9:;ZY'8:<@ !"#$@EALJKMIL)@PDPHPAPEPIPqqqq (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrr;Y2w2(w2Xw2'w28w2Hw2hw`0b0000b555C C!CC$CCCCC%Ctargetlunsizewidthxintchanneldriveconsolemuxconfigurationinterfacevendorproductreleaseportnoreportidphydevfunctionwsmuxbioloopbpfilter%s:%d: %s %s(%s:%d:%d): %s %s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %ddrive at %s channel %d drive %datapi type: %s c_bcount: %d c_skip: %d missing untimeout%s channel %d: reset failed for drive 0 drive 1%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d wdccmdwdcxferwdctagged DT %s: target %d now using %s%s%d bit async 80.040.020.013.310.06.675.03.33?? MHz %d REQ/ACK offset xfers %s: bad offset in siop_sdp (%d) %s: ppr negotiation for target %d: no DT option %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: rejecting invalid PPR negotiation from target %d %s: rejecting invalid wide negotiation from target %d (%d) %s: switching to differential mode %s: switching to single-ended mode %s: switching to LVD mode %s: invalid SCSI mode 0x%x %s: timeout waiting for DIFFSENSE to stabilise clear fifo failed %s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d siop: can't find my sync parameterssiop: resel switch full%s: can't malloc memory for target %d %s: can't alloc lunsw for target %d %s: can't alloc siop_lun for target %d lun %d %s: untagged command already running for target %d lun %d (status %d) %s: can't allocate memory for command descriptors head %s: can't allocate memory for command descriptors %s: unable to allocate cbd xfer DMA memory %s: unable to allocate cbd sense DMA memory %s: unable to create data DMA map for cbd: error %d siop_start: bad status%s: request sense failed %s: unable to load data DMA map (for SENSE): %d %s: scsi bus reset cmd %p (tag %d) added to reset list cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)%s: unknown imtype %d%s: reset never completed! %s: PHY write failed %s: PHY read failed %s: stopping TX poll timed out! %s: stopping TXQ timed out! %s: bad phy register %x %s: tried to map busy TX descriptor %s: tried to map busy RX descriptor %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100ERTL8100E 2RTL8101RTL8101ERTL8102ERTL8106ERTL8401ERTL8402RTL8411RTL8411BRTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8168G/8111GRTL8168GU/8111GURTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8168EP/8111EPRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: can't map mbuf (error %d) %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: timeout waiting for MCU to initialize %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring %s: could not load 8051 microcode RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found : 64bit bus space not supported %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %zu %s: invalid firmware (%s): size mismatch, fw %u, real %zu %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dbad paddr 0x%lx impossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map %s: can't allocate %dth RX buffer unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d : could not allocate TX mbuf bounce buffer : cannot create TX mbuf DMA map : could not allocate RX mbuf bounce buffer : cannot create RX mbuf DMA map : could not allocate ring DMA memory : cannot create ring DMA map (error %d) %s: can't load DMA mem %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem unsupported bus space type %d%s: %dth TX ring DMA alloc failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: mps=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: unable to allocate pool descriptor uhcixfer%s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x ohcixfer%s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehciabisoc xfer suddenly has 0 bInterval, invalidEHCI root hub%s: port reset timeout ehci_open: bad device speed %dehci: opening pipe with invalid bInterval ehci: zero length endpoint open request %s: halt timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: disable schedules timeout %s: run timeout ehcixferehcidbehci%s: unable to start background operation invalid data blkno%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %dcould not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d%s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s: %s partition too small%s: %s partition too large%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume state%s: %s: invalid volume state transition %d -> %d %s: %s: %s: invalid chunk state transition %d -> %d RAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: specOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitpl%s/../ioctl %lx tame: pid %d %s sysctl %d: %d %d %d %d %d %d tame: pid %d %s syscall %d f_type %d v_type %d bad fd type /tmp//etc/localtime/etc/spwd.db/etc/pwd.db/etc/group/etc/resolv.conf/etc/hosts/etc/services/var/run/ypbind.lock/var/yp/binding//usr/share/zoneinfo//usr/share/nls//libc.cat/etc/malloc.confcpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmppreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbosev?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodeNon dma reachable buffer passed to VOP_STRATEGYvn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfszunhandled af %difa_update_broadaddr does not support dynamic lengthegresstoo many interfacesallsoftnetunable to create softnet taskq%s: can't handle af%d looutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqactive node flags=%xrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrrtrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentryroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodeactivepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaeazbgbhbnbybzcacncocrczdodzeeegf2fifofrgrgthkhnhrhuidieiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route contains no arp information arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo %s: %s: incorrect arp information arp%s: bad gateway value: %s %s: malloc failed %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_rnduaddr_hintuaddr_kbootstrapamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaituvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_pgrmkm_alloc1wkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requesteduvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_map: kernel map W^X violation requesteduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. cannot add prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on inteface %u cannot forward src %s, dst %s, nxt %d, rcvif %u, outif %u assumption failed: hdr not splitnd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 scope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens %s: %s: incorrect nd6 information ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionmainbuscpuNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4ARM Cortex A17ARM Cortex A17 R1ARM Cortex A53ARM Cortex A53 R1ARM Cortex A57ARM Cortex A57 R1ARM Cortex A72ARM Cortex A72 R1CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97se98max6604mcp9804mcp9805mcp98242mcp98243mcp98244adt7408stts2002stts2004stts3000cat34ts02cat34ts02ccat34ts04ts3000b3ts3000gb2ts3000gb0ts3001gb2tse2004gb2at30ts00at30tse004gt30ts00gt34ts02lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02stts424%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dunable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x OK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %ldiq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notified, no media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenri%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: pid %#x rev %#x uslhcom%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out auemii%s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s %s: not supported usb bus typeaxen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii AX88178a AX88179axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed %s: setting config no failed %s: getting interface handle failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodemuftdi%s: failed to set configuration, err=%s %s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaq%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d umsmwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter down%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S/8211 PHYRTL8251 PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%lx/0x%lx %d:%d:%d: io address conflict 0x%lx/0x%lx %d:%d:%d: bridge io address conflict 0x%lx/0x%lx %d:%d:%d: bridge mem address conflict 0x%lx/0x%lx %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04x (unknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationssysteminputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG6753CRPAG175V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249M524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200AABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 15/1xh Link CfgAMD64 15/1xh Address MapAMD64 15/1xh DRAM CfgAMD64 15/1xh Misc CfgAMD64 15/1xh CPU PowerAMD64 15/1xh NB PowerAMD64 15/1xh HostAMD64 15/1xh PCIEAMD64 15/1xh IOMMUAMD64 16h PCIEAMD64 14h HostAMD64 14h PCIEAMD64 16h Link CfgAMD64 16h Address MapAMD64 16h DRAM CfgAMD64 16h Misc CfgAMD64 16h CPU PowerAMD64 16h HostAMD64 15/0xh Link CfgAMD64 15/0xh Address MapAMD64 15/0xh DRAM CfgAMD64 15/0xh Misc CfgAMD64 15/0xh CPU PowerAMD64 15/0xh HostAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System762 PCI761 PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3U3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200BARC-1202ARC-1210ARC-1214ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1061 SATAASM1061 AHCIASM1042 xHCIASM1083/1085 PCIE-PCIASM1042A xHCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioMobility Radeon X600FireMV 2400Mobility Radeon X300FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850Radeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9FireMV 2400 PCIRage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 8670ARadeon HD 8730MOlandRadeon HD 8790MRadeon HD 8530MRadeon HD 8600Radeon HD 8570Radeon HD 8500Radeon HD 8670MRadeon HD 8500MHainanCaymanFirePro V7900FirePro V5900Radeon HD 6970Radeon HD 6950Radeon HD 6990Radeon HD 6930Radeon HD 6970MMobility Radeon HD 6000BartsRadeon HD 6900MRadeon HD 6870Radeon HD 6850Radeon HD 6790Radeon HD 6730MRadeon HD 6600MRadeon HD 6610MRadeon E6760TurksFirePro V4900FirePro V3900Radeon HD 6650ARadeon HD 7670ARadeon HD 6670Radeon HD 6570Radeon HD 7570Radeon HD 6510Radeon HD 6400MRadeon HD 6430MCaicosRadeon E6460Radeon HD 6450ARadeon HD 8490Radeon HD 7450ARadeon HD 7470Radeon HD 6450Radeon HD 7450FirePro W9000FirePro VTahitiRadeon HD 7970Radeon HD 7900Radeon HD 7950Radeon HD 7990Radeon HD 7870 XTRadeon HD 7970MRadeon HD 8970MPitcairnFirePro W7000FirePro W5000Radeon HD 7870Radeon HD 7850Radeon HD 8800MCape VerdeRadeon HD 7700MRadeon HD 7870MRadeon HD 7850MFirePro W600FirePro M4000Radeon HD 7730MRadeon HD 7800MRadeon HD 7730Radeon HD 7700Radeon HD 7770Radeon HD 7750Radeon HD 7670MRadeon HD 7550MRadeon HD 7000MRadeon HD 7400CypressFirePro V8800FirePro V7800FirePro V9800FireStream 9370FireStream 9350Radeon HD 5870Radeon HD 5850Radeon HD 6800Radeon HD 5970Radeon HD 5900Radeon HD 5830Mobility Radeon HD 5870Mobility Radeon HD 5850Radeon HD 6850MFirePro V5800Mobility Radeon HD 5800Radeon HD 5770Radeon HD 5670 640SPRadeon HD 6770Radeon HD 5750Radeon HD 6750Mobility Radeon HD 5730Mobility Radeon HD 5650Mobility Radeon HD 5570FirePro V4800FirePro V3800Radeon HD 5670Radeon HD 5570Radeon HD 5550RedwoodRadeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 6370MRadeon HD 6330MCedarFireProFirePro 2460FirePro 2270Radeon HD 7300Radeon HD 5450Radeon HD 7350Cedar LERS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon X1200RS740RS740MRadeon 2100Radeon HD 2900 XTRadeon HD 2900 ProRadeon HD 2900 GTFireGL V8650FireGL V8600Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon M98Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740RV740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon 3100Radeon HD 3300Radeon HD 3000Radeon HD 6550DRadeon HD 6620GRadeon HD 6370DRadeon HD 6380GRadeon HD 6410DRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DSumoRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 6290Radeon HD 7340Radeon HD 7310Radeon HD 7290ArubaRadeon HD 7660DRadeon HD 7640GRadeon HD 7560DFirePro A300Radeon HD 7620GRadeon HD 7600GRadeon HD 7500GRadeon HD 8650GRadeon HD 8670DRadeon HD 8550GRadeon HD 8570DRadeon HD 8610GRadeon HD 7660GRadeon HD 7520GRadeon HD 7540DRadeon HD 7420GRadeon HD 7480DRadeon HD 7400GRadeon HD 8450GRadeon HD 8470DRadeon HD 8350GRadeon HD 8370DRadeon HD 8510GRadeon HD 8410GRadeon HD 8310GRadeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST1150 PCIAST1180AST2000AST2100AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR9462AR9565AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DAR8162AR8161AR8172AR8171L2E2200Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM57811BCM57811 MFBCM57811 VFBCM57787BCM57764BCM5725BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712 MFBCM5717CBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM57712 VFBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM57767BCM5764BCM57766BCM5762BCM5761SBCM5761SEBCM57800BCM57840 OBSBCM57810BCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM57840BCM57840 MFBCM57800 MFBCM5702XBCM5703XBCM5704SBCM57800 VFBCM5706SBCM57840 OBS MFBCM5708SBCM57840 VFBCM57810 MFBCM57810 VFBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5727BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862425/825/42B/82B1010/1020/1007/1741415/815/41B/81B1860410/420BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXOCTEON Plus CN50XXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port210502104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPBZLXP-L2Memory Channel Cluster Controller21142/3Farallon PN9000SX210522115021150-BC21152211532115421554SWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidPCI-PCISmartRAIDSmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM25SS-3010 ATMSpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIFL1400 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array P430iSmart Array P830iSmart Array P430Smart Array P431Smart Array P830Smart Array P731mSmart Array P230iSmart Array P530Smart Array P531Smart Array P244brSmart Array P741mSmart HBA H240arSmart Array P440arSmart Array P440Smart Array P441Smart Array P841Smart HBA H244brSmart HBA H240Smart HBA H241Smart Array P246brSmart Array P840Smart Array P542tSmart Array P240trSmart HBA H240trSmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m7751650079517814/7851/785480658165815479567955/7954HB6HB4MSVCC01 Video CaptureSH7751 PCISH7751R PCIISP2100MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351Miami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES5T5ZB89HPES24T3G289H64H16G3WDT 50x Watchdog TimerINIC-850INIC-1060INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Medfield VideoCore 3G HostCore 3G PCIEHD Graphics 2500Xeon E3-1200 v2 HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXHD Graphics 4600HD Graphics P4600DH89XXCC SGMIIDH89XXCC SerDesDH89XXCC BackplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235Centrino Wireless-N 6150Centrino Wireless-N 2230Centrino Wireless-N 2200Centrino Wireless-N 135Centrino Wireless-N 105Centrino Wireless-N 130Centrino Wireless-N 100Dual Band Wireless AC 7260Dual Band Wireless AC 3160Dual Band Wireless AC 7265i960 RPi960 RMi960 RNSSD DC P3700/P3600/P3500Core 4G HostCore 4G HD AudioHD Graphics 5000Iris Graphics 5100GMA 3600Atom D2000/N2000 VideoAtom D2000/N2000 HostCore 4G PCIEXeon E3-1200 v3 HostAtom S1200 PCIEAtom S1200 MEIAtom S1200 SMBusAtom S1200 UARTAtom S1200 ISAAtom S1240 HostAtom S1220 HostAtom S1260 HostIris Pro Graphics 5200E5 v2 HostE5 v2 PCIEE5 v2 R2PCIEE5 v2 UBOXE5 v2 I/OATE5 v2 Address MapE5 v2 IIO RASE5 v2 I/O APICE5 v2 Home AgentE5 v2 QPI Link MonitorE5 v2 RASE5 v2 QPI LinkE5 v2 QPIE5 v2 TAE5 v2 TADE5 v2 ThermalE5 v2 ErrorE5 v2 PCUE5 v2 SADE5 v2 BroadcastE5 v2 UnicastBay Trail HostBay Trail HD AudioBay Trail SIO DMABay Trail PWMBay Trail HSUARTBay Trail SPIBay Trail SMBusBay Trail TXEBay Trail LPCBay Trail SATABay Trail AHCIBay Trail Low Power AudioBay Trail VideoBay Trail xHCIBay Trail I2C DMABay Trail I2CBay Trail PCIE8254282543GC82544EI82544GC82540EM82545EM82546EB82541EI82540EP82547EI82545GMPRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 210082597EXICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 M82571EB82801FB LAN82801FBM LAN82801GB LAN82547GI82541GI82541ER82546GB82572EI82573E82573E IDE82573E KCS82573E Serial80003ES282573L82575EB82573V82598ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF82598AT82576ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM V82574L82571PT82575GB82598EBICH10 D BM LMICH10 D BM LFICH9 BM82577LM82577LC8259982578DM82578DCICH9 IGP M AMT8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V82576NS82583V82576 SerDes QP8258082599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TI210I210 FiberI210 SerDesI210 SGMIII211I217-LMI217-V82599ENI218-LMI218-VCore 5G HostCore 5G HD AudioHD Graphics 5500HD Graphics 5300HD Graphics 6000Iris Graphics 610080960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series xHCI7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCQS77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPCNM70 LPCAtom C2000 HostAtom C2000 PCIEAtom C2000 RASAtom C2000 SMBusAtom C2000 RCECAtom C2000 SATAAtom C2000 AHCIAtom C2000 USBAtom C2000 PCUAtom C2000 PCU SMBusI354I354 SGMIIBraswell SMBusDH8900 LPCDH8900 AHCIDH8900 SATADH8900 SMBusDH8900 ThermalDH8900 USBDH8900 PCIEDH8900 Watchdog82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATADual Band Wireless AC 8260Dual Band Wireless AC 416582820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KT4 Series VideoQPI LinkQPI PhysicalQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoB43 VideoE5 v3 HostE5 v3 PCIEE5 v3 PCIE RingE5 v3 ScratchE5 v3 DMAE5 v3 Address MapE5 v3 Hot PlugE5 v3 Error ReportingE5 v3 I/O APICE5 v3 Home AgentE5 v3 QPIE5 v3 PCIE MonitorE5 v3 QPI MonitorE5 v3 TAE5 v3 DDR BroadcastE5 v3 Home Agent DebugE5 v3 RASE5 v3 VCUE5 v3 PCUE5 v3 MemoryE5 v3 TADE5 v3 ThermalE5 v3 ErrorE5 v3 DDRIOE5 v3 UnicastE5 v3 Ring AgentE5 v3 SADRCU32 I2O RAID3124 SATADual Band Wireless AC 316531244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APICE5 PCIE MonitorE5 QPI Link MonitorE5 Home AgentE5 RASE5 QPI LinkE5 TAE5 TADE5 ThermalE5 ErrorE5 DDRIOE5 PCUE5 ScratchE5 R2PCIEE5 QPIE5 UnicastE5 SADE5 Broadcast5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASGMA 600E600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579EP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RDPRO 100 ServerQEMU NVM Express Controller5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit8 Series SATA8 Series AHCI8 Series RAID8 Series PCIE8 Series HD Audio8 Series SMBus8 Series Thermal8 Series USB8 Series xHCI8 Series MEI8 Series IDER8 Series KTZ87 LPCZ85 LPCHM86 LPCH87 LPCHM87 LPCQ85 LPCQ87 LPCQM87 LPCB85 LPCC222 LPCC224 LPCC226 LPCH81 LPC9 Series SATA9 Series AHCI9 Series RAID9 Series PCIE9 Series HD Audio9 Series SMBus9 Series USB9 Series xHCI9 Series MEI9 Series IDER9 Series KTZ97 LPCH97 LPCC610 SATAC610 AHCIC610 RAIDC610 PCIEC610 HD AudioC610 SMBusC610 USBC610 xHCIC610 MEIC610 LPCX99 LPCC610 MS SPSRC610 MS SMBusI2O RAIDRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAID8 Series LPC9 Series Thermal9 Series LPCPineview DMIPineview VideoS21152BB21154AE/BECore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIIT8893E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon 88E8079Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATA88SE9230 AHCIMGA PX2085MGA Millenium 2064WMGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200eMGA G400/G450 AGPMGA G200eVMGA G200eWMGA G200eHMGA G200eRMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDIS200 BB16PCI958PCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352CH351CH382NCP130NCP130A2PCI-GPIBNET2282 USBNXB-10GXxRNXB-10GCX4NXB-4GCUIMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIPEB383 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064AMegaRAID SAS3108SAS1066MegaRAID SAS3008SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04nForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4nForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2nForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400nForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3CK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250GeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForcenForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPGeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51MCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55MCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 MemoryMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce GTX 460MGeForce 425MGeForce GTX 550 TiGeForce GTS 450GeForce GT 550MGeForce GT 635MGeForce GT 555MGeForce GT 640GeForce GTX 560MGeForce GT 635GeForce GT 710GeForce GT 630GeForce GT 730MGeForce GT 735MGeForce GT 740MGeForce 825MGeForce GT 720MGeForce GTX 750 TiGeForce GTX 750GeForce GTX 745OTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelOXPCIE952 ParallelOXPCIE952 SerialQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleVirtio SCSIVirtio RNGCMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS HostCNB20-HE HostCMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchuPD720201 xHCIuPD720202 xHCIT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8111PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648PEX 8724I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3060RT3062RT3091RT3092RT3290BluetoothRT3562RT3592RT3593RT5390R1010 IDER1011 IDER1012 IDER1031 PCIeR1060 USB DeviceR1070 CANR1331 MCR1710 SPIR3010 HDAR6011 SBR6021 HostR6025 HostR6031 ISAR6040 EthernetR6060 USBR6061 USB2RTS5209 Card ReaderRTS5227 Card ReaderRTS5229 Card ReaderRTS5249 Card ReaderRTL8402 Card ReaderRTL8411B Card ReaderRTL8411 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SE8191SEQemu PCI-PCIQXL Video5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PS4LN053X01XP941SM951A10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C17083C175FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780EasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimbaCrypto 5821Crypto 1KCrypto 6KPsycho PCISPARC PCIEmicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 SDPCI7XX1 Smart CardPCI6515 CardBusPCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 SDPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireXIO2001 PCIE-PCIACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030PCI2031PCI2032PCI2250PCI2050PCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7[46]10 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATMR4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32pAET4000w32pBET4000w32pCET4000w32pDET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64VT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700VX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237AVL80x xHCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371VX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890P4M890P4M900VT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363VT8235 AGPK8HTB AGPVT8377 AGPVX800VX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925SVGA IISVGAVMXNETVMCIEHCIUHCIVMXNET3PVSCSIVMIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainHitachi MicroSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLBochsC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELBrainboxesMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitSamsungAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomBrocadeNetSecZyDASAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaRed HatEtronFresco LogicNanjing QinHeng ElectronicsTekramTehuti NetworksHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: 1.5Gb/s: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735746748760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: Unable to create TX DMA map %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register Unable to read RGEPHY_CR register Unable to write RGEPHY_CR register Unable to read RGEPHY_LC register Unable to write RGEPHY_LC register Unable to read RGEPHY_SR register Unable to write RGEPHY_SR register Unable to write PHY RGEPHY_PS register Unable to write RGEPHY_LC_P2 register Unable to read RGEPHY_LC_P2 register ...failed to apply em_phy_no_cable_workaround. %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d %s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish calledlpd'({^~: n>n>>n>n>n>n>n>n>o>?o>o>$o>,o>4o>Do>Po>To>Xo>  5'+,()*-.&#KINMOH J AAԍAȁAiiԍAȁAiiԍAA iiԍAځAiiAAi0iAADiXiԍAADiXiԍAAxiiAAiiAAiiAATihiԍAA |iiԍAA lo>po>xo>@6=%+*p<%2`Lq>  H ( h( ' ' )+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! (~>| E V TQ > \ H X 0  d @@%%K;!d;!h*!؎>VVVWWWWW XXXX[[ \\\\]]]]] ^^^^__ _ ```` aaaaa >?A\> #6#|##p#p####(#h# ####t##`#X#x###X# #####h#(##(#P####\# @ @  ) 2T>     #<# #####,###t###|##p#P###8#h######d######l#H#### # @ @  )ĥ>2$I$ I$P8$PD$@D$d2$'$( $, $X $$4 $h$T $0 $>$;$B$0~$p$R$$l$Ē$$$(WEVrdroot2.5M@"~֓K2WEV  08` 5U<  4U Q`/mntr:u  5U`@@<@T 08`4U<  4U Q`[~ [~4U`@@<@TU 5Up` b 5UE)-A 4Ud* 5Ut@+ 5Ut@+hz A4U_r 4U_r 4U_r a-C(4U.5$4U^2 5Ut@+px f 5U6?K! 5UE$ 5UE$b@|E 5UE$ 5U?' 5U?'i**o 5Ue=' 5U~* 5US7eLUh 5U~* 5U0e. 5US7 :~< 5U0e. 5U:\5 5U:\5 (08@HPX`hV\֦uQKh=8 NƓnCկIC~ND_1{W&36s;}*FD*?{b9uK{8-%bay^l:Ui3J8޻Z-a %L%7w[95O݋C:eˋSY2RI/x*89i9cM,fT6-^r(j|HrpZxP]ư`jzYG#WSXot3-k^h0oW!yIhQw 0 fR)Hr-F9EfpMn$7:wz XhvU|nr5"=Y Հuj( 8bc VΕbKn:jims5B_B-+,qycVJ k )w~^6?b2mdMTCf?ȼ[:`B_vq, ul u6FP >^IZ0'B_HN= v ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [[ -z $DONEPROFILE ]]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [[ ! -f /tmp/noai ]] && { ifconfig netboot >/dev/null 2>&1 || [[ -f /auto_install.conf ]] || [[ -f /auto_upgrade.conf ]]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [[ -n $timer_pid ]] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in [aA]*) /install -a && break ;; [iI]*) /install && break ;; [uU]*) /upgrade && break ;; [sS]*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub get_rootinfo while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!"; exit; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets rm -rf /mnt/usr/libexec/sendmail rm -f /mnt/usr/sbin/{named,rndc,nginx,openssl} finish_up  . .. bin@ dev etc mntAmnt2=iآsbin=iB tmp usrvarinstbin.profile2 install.mdupgradeinstall  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if fdisk $_disk | grep -q 'Signature: 0xAA55'; then fdisk $_disk if fdisk $_disk | grep -q '^..: A6 '; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} fdisk $_disk | grep -q ' A6 ' && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f=/tmp/fstab.$1 md_prep_fdisk $_disk disklabel_autolayout $_disk $_f || return [[ -s $_f ]] && return cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel -F $_f -E $_disk } md_congrats() { } md_consoleinfo() { } ELFa(4"4 (hhhhhpp=p=44D$TTTۣehhhOpenBSD -L0! MP@ -7p@bP0"SH1 @9 0S> bR KR MR GRkR gR  mR wR $T0@ (%T%@%T!ER00 !T00 @0xS S *ST8,0 (C800" a- 8 -0L00(d -0L0~0(, -Lu0 -Lm P00 -Lb0 -LZ 00d, -LM$`K✠p圀&xu @PP @Q` 0 D aC 0R00 (0S(0 R0 ,d -L BC8 -L 9C8 -L 0C8 -L 'C8 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  9PP  / /O0S P00OU0@0V 0000 00 0U0 0 0 0S0|0E 0  `Be0 f` R*RbS0 00dL8$` 0-LMPKLP \0: S D4 K@/P0: S S000K08m @ - ELP 50  .PD40S0o DP4000 T0$ 4.P 0 4l$.0000S|8T$D0$D4 0S 0@oPd0S 0aP 0ZP5뀃S $0   $0 `0; S 0 @c$ #"pC0Hc`V <A0Û,)L$&Lv#0sy3Q 0Ss*0  Q  (P a "0  ޤ70 06L70 0 0 0  P0 0 0 0000000 0 00 00` 0 B000Q Q@0A AP0 0081А(q@00Cs0~1 1R0R0R 00 l R R *p bQ U0 00$00S1㤸,xfd(H08P, -d2LuM0Pb4K4K 0( P,04 0  bR, 0@=94 0 =,0 4K& 1p@,P 03 0yOKP PP0!dPPT@  P R T1TRMKd0U 0 K00 ,KW, ?R0S@pJ0"S4 0>@P -LMp`P@( P(K,K㬡  0mP(0SӰ$KMЍ  -LM0S S SL0 0@嶡0(( Kh计0h詡| -0L 圡㽵뤽 -Lp,P`ဳ@P] 0 `$00$ (0@ -L`PVp_@P<  0bp0>  $m[ H -MLMPa `P "4N@ (P $@TY  1j&dP t@ $@TYK(PEPE)0/pP10S0#3P PPPUp 3V@PP$@T Vդ@唐PK 00 0`ݯVT Ҡ  $@T(KTL`pp| -L0 K M, H$0@H @0 000 ?Pe bP@@  H$lp$00#D < 8 4 0a0@SMTܪ l Ȫ ت0SdcB@ XP R r@P00SxRbRbRPP,`pWP 0  s00 2U" ?0@ 0SP $@T 0K\\nPPDBHޤ@P , ! < 10D0 80080 4 H!*lps1 pR18 040DR0Q  R`Z00R00S< R (10S00SD1AP᳐P ,@P@ @0r0 0K;<Q 00S  00 $0SVPH PA0pK  0KeP  _P`Fv@T?`U(KD@8TMЍ -0L 凟㨳뤽 -LM@P` 0`G"PpdH0SW[H 0  _0 p-LP@(`PL52@ P  $P@@0p8 -2LdM0ŸS2@P |x2T &P < 00X@80 4@ 8`K0`pL0 H@ @r`0` ,p  8K\ X  0\K# 110 , @T T * g  0ᴐD @ \(TD @0 9#@0 T * O 08KD D80㐃4`T㐖) T * 8 0LK-d `  -L@$H`d `0 6&`` TD`K0d`Kp`p0`K ` p p$ p%<_< < P0Ro(K4L@XY@ p-LM`K @Pp e% a%Kp# -P 0`㓅p @E$0L0@!0 @ !k -L8ML L@P  03% P`L@L00U@p80 4@ 8K2Hp D 0pS@p <  LLL @T T *  0 㐅T㐖) T *  08Kя`p y80c4T|' T * m 0HKb@P bH BD0S%P 0P@ P$@@K 0C 0C8 0G@D,|\8p -LM@pPg b`P 0S nS0oS` =GPP00 @ĄP @Q  0U0P P00 00 X 0000X  w0U 0 <00 ,K , ?R0S@p<0"S4 0X0@P -LMp`ᚄP@( P(K,K^  0mP(0Sᅢ$KMЍ -$0L0S \㑧5 -Lp00p3 P``0PP @@kP@ sP P aP @ [_ph00SUTT .D2< ,2LzزD5MЍ -LUMЍk0@-XP @0 S S 00 ӑR\00 \00x- 0S Br Q-0L(  Q: / -LMP`p; $K"@;0S 0S $00TS#T 0f/  -0L 嫒̦뤽 -kM⬟LMB0@3S$$Lht 8Xx>  > 1 v> PP P h" \>lP> H>`PU@ 0!0T$PP U0U0T0S .x?`~@P P  XpZ x6 0<Vv & 6 @ r *0D0 & &F0G@$6@C#&R 3R:Z6XV3 ?2@6vC#00W #*Y/ L0S  3嬆X H0XL ` L2Q &R@FH R2TH@ 2R R H 2R T@F|0S  Z OP3T@1|@ S35: Z t0S<t0 @t@90 SZ:;D.*16 v@,55d5T5<PP55\pL5H54D5@5<5X58545 05 5(5 $55d 5505@H\pedA 8X\ Lx0\x(|z\5$5P5@Hd5\5P`58\v00 倀X㐆 '0 Z|  Z"x0 Z6 X Z6`pF0Av0 Y% `6c# X0R@Q Z T0S#t%*T|0匆Yx 0@1X TP`S*!p0S0a @*  ("p!0 Z2 2Z2P2: Z8 <2Z0G0 EY`x0 @!T  &Xb7T@ 0qP@UP!T51$-; Z0 Z0:U * Z Zʠ 0O* Z3 3Z2U ZKR0C6 |T x0"& A c(% Z``0S00S H0DS &R X :@X  0 &@&0ST#3* p&'0P &0' X ZH  6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `00S70 @0 <D0v> $ 0@0 (  4 '0(8Q- 0@( >X0S 00 o0x(08Q @+T U01U01hL0S X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQTLPl0 0 Z0S0 00 V00R:&X9Q (0 0 520#$ 00 0 P B240#$ 0 -pp, z0P , 0P( Z600X:*B(KMЍ -LM04PKpa@d 04 `XPD 0`PPG p00@T*P`uU<UP 0(0' 0FS(K 㕒P@ *(00S x*00(@ ^U 0(P?P@ -P 0(0 0$K4X`h P-L '' < -LMp0 :OP0 000K0,K00 e YPPc 0S` =;@P l `cVT8PC,00HiV0.P,00? 'P2 ,0$03lVP$,0 0)oVP,00 P ,0(00SP0, 0  @P@Q0Sy 00S(KTX`hpx 0-LMP 0XaP@00 [ 08S @P@( 8hL$ 0 0~0 +00C -0000$ 0 0~0+00-00S $::  00 $ 00S <<  00 0$ 80 0= 0  K$00  0$@+0S  $", 0 0 $ -LM0@S00 K0 $0 0`t -LPot  -L Pnt  -LM K00"Pt -L'h,0$ p-L ML@`0KP nm0S q00Kp p-L ML@`0KP Sm0S V00Kp -0LS@ hK? 0 << 0 p-L M@0K`P &m0S *L0 0Kp p-L M@0K`P  m0S 0 0Kp D0  D0 -LM0Pp0`-S000P(K 0(P @P 00S `w(t0 0 0S0(i(fKp@(4B p-0PQ`L@ 9P  00 0 0 0: P0SP %P  000 00& P0SP P  $00$0 0$0 P0S`PP  000 00 p P0Sp08 0-,PL0@S :000@0p5t5 -0L0CS0 Ql M00-00Q0^   ?00Q@0 0^0 000h5o` p-l`L@PTX0 P&HP80 pp5t5$8 -RLMp`P 0BS     P;N@#&T Z@ @T :h @WZ P8 Z08Z 8 Z7wZ 7nZ 7eZ 0]Z t7TZ@ T7@KZ  47 BZ  7 9ZPP? 1U 6(U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4{d@4UL0pU04gU 4^U@ 3@UU 3LU  3 CU3:U p31`@U H3 %< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!@Ty.vaPKZ  \ 0wP0t! UK,  * P `A0Kdpd0\4!U K K (K ,<HTt<L\(,X 0@XxhTl| -0L 刅㩙뤽 - 434L\Mp| x a0@S(| p p Px  tp"0S|`A8PUt"fQp\2x@K |0x1|0 IP<!8x hP$sD x`PW|00S xKD0t xKDt xpK0|K`,Kl0 h0 >P6~P1P,|0@000C S1 h,0@SP |0 帄>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0sQPK 0gQPM  0[QPGTQ000ӑx -@L|徠t廠l帠d嵠`c łT TH媠@姠88 巂ؖDTP -LMe_~K@ oK; 7t K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 éK`$& -LM(Qt ,Qd!0QP 4Q0 8!0 80S00, < 807@@00@4 80CW@<P!0PP0P (P!P!0``0` (Pp!Qp 4p ZP !9 @@004@a00,0 9 @P@`0` ,p!9@@<0P ` 0@VU,[!0pp0p p9@p@W0<p `p `P0@XW,9!00 44 84 R20P `0`@p 0p`@P@ @@P8 0!84p\a W4 00S(K$8h|<p -(0e/S<(0<0(0L@< 0 SeR 0-LMP@P%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 0d@KD 0-HLPb0@S @0030S0 - L@30P -BML:M 0D 0'u0P@4   @Z`Տ`@@TBKLL4d H 8d H8$P0 8$ 0H#P 00P<  0/S 0<4 H@Pw :P( 8 l00PP,UY cq9PPI<`P YqP90cC10P @T,K9 D,00 PS t 8#[ 9\P0  "Q@@P000  P00000  844044 PU 0S00X0P` @ ,K0 ,00 S|8 00\0`@PU 00S0V0S(0 KP 0 0BS(ʑ8{4$0 4$ 8YǟU PP OP >IEP P at:P0,K ,00 SP;;S( J#P 0,K ,00 S, 7P 0,K |,00 S8w $P 0,K i,00 S0d DP0,K V,00 S4Q  084$ 4$ HPC P> P9 P4 P/ P* P% pP  `P 0aC0S0S 8X :X08ʑ 844044 U844 ,K`0 ,\  84$ 4$ "V8d44044 ,KP0 ,\  8h4$ 4$ "U2`P1 C`XpP oP3"0cC1 @T000C S000 0,K 0 ,0S00S 88/000 00"02pW Wr+Vo ,K@0 tPP`a TL ,K0 e000 P ) @@&A@2EV0 q,K@0 FPP`3 T _,K0 p4000 P  @@A@2PWp84$ 4$ 9,K0 <$R ?ox0 844 HD$yPd 4$@T$@ @T(Kd\Hp(08P\xz0 ,@P\h -1LM !R  `P吏 qb@P砀A @QT pP @T a 0ttq0/S @@烀bP8'(0`<\. ..d. -LMCDE@FPG`@A B0ptP@ P`>` \0P 0S<<Kh0P$$ *K/d/ ./ -L3@P 0rS@Sq0`0xP` !0S`Pla00C8SS PPNLHQ@@ T@44T(10S  g#젟p LPP aP00@aP@@T|徎@d T@XXT0S< , 1#$%///p//80X0 Qp-L`  Pph舎*PphFaP@U00?8U(` "Q 9 @@0@0 L@phwp<@ :r01pl00 .00\ Q0-LP  P0h@a@Q00?8Q(` "\ 9 @@0@0 `T0h4p \\ \ \2 00 !(0h^1(1 .00,T1 M-AML M@ @DB^K8@PEfĖ @2JPP PP 0 P(K78 .0D8 -LM⸁`p7< @@00@P xt!, 0 `pCp,q. < 00@ T S7< @@0p pW `PU`p0 p `, pP`,q(Ko< 00@ 0S @VU P 4$0 `@`dTPP弤(K:p88:88 . -LMe/oK◤H5H044!0L P!   (KoІYP@P u@` P@ PT`U" YP`@ 'PU T@ PTpUhT0ST jD  1`p,@ $P0 0 `pxpq pqu,`p0@#P0 0 `p\pqi pq@hY0`p8@T#P0 H0 `p@pqM pq=8`p4@"P0 0 `p$pq1 pq`!ꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` q oKe/㢣[uvx7< @@0pV  U x0S)0S&h%#R Q0S0S 7< @@0p 0 R0SRg 0S0S`dTP@C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P fl姄oK   !1 R! oKe/E(Kh;(10|;;;; .:<(<L< 0-LM H(K K0K0(@ $P 6|p1 KK0lp< -LzM 6 66`9 @@0  "Y 0ᘠ! 0@@0 0@XWTS !K0@T SVU6 YV0O?P`P``4;D1 A 0 @2 A  !1 0! 1 @ş u@@Te/oK⧡\%0A K@00 1 k P! + ş!00P)$0S$1S Ağ T! K $1 AuK 00@0 @H 0 K0@0 @oK  NK0 !$0yWp`!$0pWU T@P@TP!Y0d ZW@B A0@D  1 B 9 @@00@0 Zk Zh "Q 1A`T(\$nK!P` /!1"P@`p0W`U`pKQ  ! oKK 0! 1 00S @TS  0 0 W V .K  0 R0! 1 `pA0S 0St0PR(K 0 @?@a1 A SW%; UT0UT0  @(K "0B?BA00/SB00B oK s!Ut0P txA@A PoK1soKe/U(K;::\d -LgNK@D*M@D e/=0,0 1vP ,vP  &vP 80:0 M,K P[`P '(K0S)0%@@0@0 (K0(KS )(K0D&@@9)`0C` eKe eK5gNKS:5 5@DS:@D <5 3e/qK۟e/Kן x9KN.KA0 BA B:  *  (ofPȟ0S  q0:K0:K 1P |10`uSUS OKe/ 域 e/ᛟ   hQC #XQ MQ AQ<  Q ?Q4DQRRQ UQ[cQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ^ rQ sQxQ zQ wQj P Ke/t 000"00C0{ 2w t p  P x&0Hf@0r@@T^ H_Z V pS0 ,%(M J Fş0S  <V @@ 0 1V d0( 4 0p00 y@P 0STE0KP Fp 0<)`P  0$m)0$r  40S X@ 40S40S gNK@D@D,e/M`PC)D$YP P0000ӑ yS P00 ӑnRP,400ӑyPgNK@D@D  `Pde/s@A0S 30S >p嬀 `@0p`p @TP0(p@ Pb  0  g 0,b}V `Pu 0Sr Ag@Pni  0ofbqOK e/ÉPPe/  e/ e/K XU R@ OKe/ e/ e/ l@ `= :&0S  0P 0( e/00͝!0|0s03Sp0 XOK e/`P P e/㬝 @  ,Pq(K;d]<<2f<j\=@0HLpD=rdA\<L=<t====t=]=>t(><>d<`>;x>>>>>`$?P?;p?d?x??MЍ( -T0L0S@840P (0 0 0{8T@]]`^@ -LM, ,0Q 8P60P300S.00SQp P0 `DV U@0`, 0S@P,0P0 0SQ Z 4 s8 0 ]@ p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ XP@#0T@0T0\ L` 0KSQ_ 0F@TP 0>SQ T0T0 <00SP7@7Kp]@] ]m](AXA -?MLMC`pP30S9 SQV7QVp3 0RQ P#700 Q R30SŔ 20RQ "]P ?KK(@DR@D?+aP78@K0 3K4 Pq 0 : LK4 Pd 0," -?KK(@D@D?+uaPPS 0! ?+gaP @E !8K0@ 3K4@ uP5 0x!M7><1Y@B ុP K᰻ 4 XP0 0 !40 @_ 0&E 6 0Kx0, 0 K5P ,0 7  ,0 `0WPV(KAAABmBB8BXBCB4C] 0-0L@T 500S `Pڼ 0P0# ;;S 0@ `Pp0 @ L0P@TP0D 6 0k6@0]]]XC|C 0-T0L?M0S@00S ?KK0P@D?+`P 0K0 -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0zQQ8pPď fP01@P1+(0S! $0S 0ESP0 SD5 $1 0S 0S 0S  0@TT0 0 00TSPP T0 5|00t 5 l00Q JPL585]CC|CD(D`D -t0 0LSd0 \@ 0P RP$ 5D -3LM0S2 2 2mP2} 20S 20S 2"2Q 2201R0S d2B_P 0: SH0D@@d2 @X20S L20S @BP001"2P K a, 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 p`V 0 0 0POP0 \0 B00 @00@P0  0||00pK ]]]],^zD`^]]0^(^D]D]E p-LMP K`@Ps0P}] T  sqT  h@L@ ][ 0%P R]Kp\ElE&|EE -L M0U@p@ 5 005 5 5 5 5 4 Qd̵̵Dж,TT$4@  $P;0$S4h4pG 4Q !ATp \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SPGeP`K 0* c0S cKpp -LTMp*7a=0`0@0@TSVUd@`@a JpPK 0@2<0PpK0@K^ 0KUUU-0 CR 0R0 SV00 -LlMDŸ@Ÿ^ \P`p^q bp28K"a=0  RQTSAAa  0@xKӟ1PxK0C@-t1P 0P8 KP PwD8100CS (1 ,8,$8 #4gDa=0 `DxKIb00S y 0 0BSR/b  h00S [ sc$K ^]UU,0U4UUpUU p-4L0S$1`@ PP>000-S 00 00 00S  ph 0P0P! P <P00:U0S ll00:SLQ10 0 $(0C?Pp]@]VV P00 Q-L0BS 0ZS 0hS 0{W8VxV Q-L 0S 0S z0eW8V Q-L 0S 0S Z0OW8VV Q-L$ jP=WVV 0P-L 0S`4pPАРP(#,ᝠ`P=㘠@P 7U P|DR@P0VPPS0    Up 0S,RVVV -L aV@ R[[tPZ45Z (5Y l4Y X3`P ᣜP @ T 4X`  L&]d@ R43?@@ T]p#3lTh4QPL 84@44@00  ,WQ 4W K@\@dP0V0C ,K 1", R6 1gPV-+"U0 U0h#0T0PTPSh"S0R0#R00Q0048" pB @1"2 P  " R  2Rx  B P/h 81Q ) 1 D>@r` `0 Sl(5\>P20SP00CS0 0  0 Mx00S ! 1 `00S񟗏`3`333x38 3P5000X`^]@]`ZxV]d^X^]0^]<^\^VP^^L^VxZZZZZZZZZTLZ][0[8x8^^ ^$^ 4[^4^L[d[][[^[]^] ^[n9  0\4@,\p4\D^@04S"(04 0SH4080C40 !d0 8 8P000@04S0 (K -L@L0S 8 0R, 00 =\\\ -0L`p0 PA?R R *RJ[RG!QQG (10SE /QCP0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS ^ p-P/Q`00C@ nL R  0Tp0P0 P0A*00AQ@*00p\ p-@P`L 0P <000CS   0Ppp - L@ P 0P/S0S/ScP I 0-L0L@P 0U(P <@T0\| -LcMbMKKM(@D"@D 8 3 ( p#壙3mK`F`F K*K  0K垻Pm0 0R0A`KpRV1 :*K(:KVx P,&RP \R0/S 9SK00CS& KP2SP  0KQ S @`T K 0fT  ` KV* R V ZKQC :K(=K 0` c Vp]  K0SX 0PSU 3KLL X0I  KP(v0@P *0S0R00S :K8S  K( 00(KQ 0 <[S:K(;3=K0CK0Cll(;<[S 3K*KAA(ӘK0(K \\ ]8] -CMLM`Pp.0S X  c00C00ST~0S 0/S  <S  > b<0C<0S cKPrВ @ P.0S1 P40K<0 8@ 8 1!0S1 0 e;1,@K ပx10(0 0$0 d1,0 bP!]PXPSPNPP 0  ,0 I;P C;P"{ 000CSDILITItI H 00SxY `0 KP08^d```@^`H^pP^E`]`(^ p-2L@`T 2Pᥓ!0S  Ro1@T 1Pᓓ!0S  R]1\[ a@ 0S% S06S 0S 0S*0S?0S;:> 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp,,=(0  -L@Tp  Q.SW|p 0S0C W` P=Pl 0##!>C=S0Hbp0H S]N\NM\NM\NM\NXM\NM 0 <#d !>Cv.B B 0@<#!>C0  0#"@!>BDS0k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0ᾁpq -pPL 0Sd&/XA`P00  S,UXB .UQ   w PR00EU0H@P ZV 0SP00MR CR cR mR00000X $0` R( 0S P 000X% 0S" P  E#000  0R  0R 0pr E\0P P0@@@@,^ a aDapaaaa $a 0-@PLD 0SA Q0S HP4 0#S \S0#S@kP@  - # %@Uj|帑p0Q0 R 0S  7HP 00@ 00  0(=,b`bb 0-@PLD 0SA Q0SGP4 0#S \S0#S@mP@   # @k|fp0Q0 R 0S  GP 00@ 00  0,=bbc -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0  -` LM0S PHp`0@T  0`b(@PU8 - LM0pS) 0娐P,0,`C0@ 0S 0"S2S0p6W lD ,`FPU*W0eD  00 004]0@-t0P0S `0@ P $0S 0S0S0 00@AD,^004 -` L0S `Lp0PU p@'D%DTP` VL' -0LpW, 00S(00S$ 0CS!; 0`c@T h0S0S 0R 0@S 00CiCL(  -L@LP @08, 09P 0]$c -MLMx10pS`V `10S 0/S BKAA`)P`0 & $1$Q0QX 9P 0@K,K p00 0p0开 ,0%%P  M ,0 0000@K$00,K:2 Ẓop00 0hp(K0Tc4]lc -L M@PTp5 孏`V- 0S0S$0S (0(`S Q ኑP P0 0@KP(K00! *p(00 $p CC(K8= -L M4 @PT`; eqP 0S0S$0 S+ ((K00!0 Ko,E@P 4$P  0`$0L00K 0(0 @oB0K o (K8=c -1L@`Tp  Q@@T PPP' B$P  E@P $P $P @0 00@BB$K <cd$d -@@L0S 0EP2 8=Ld -@@L0S 0DP <d -@@L0S 0DP L d -x0L@`TPp X AAT sP  P:0E0@< -1L@`T^ 10S\ |10SX; 0dX P @U, H0S0S 0R 0@PS  ! Ώ0  S;00 S00000CS000AADPP #P p0+0 0L00040 00PA(r L(  d -0L: SpLD H0 H@00!$%S$10a:0S60S30S0fD@Pf  00S 0/S 'PS0x k [#PGT ` QA00@`V=@eTc e -<LC00P " ; =@@e -"LtM0S K, `KPi0: SeP L0 a 0S] 0SY 0SUP 0S XT!LZ p c  0DP9 pP X9W1|1pp!`+d!@0S | PKp \0 S HL 0Pq$rtP 0P B0Sp_ 0 S * 0pPOa=0Q@ 0@PBx!0d [P:\1B_pJOWP@1 |1\ q OKl} 02P}P P 800 SS00#80t Y(Kfd^ff 4g\,@[]p? $( ,0!4 180@<@P?U xap 00`xax X40@@AoߍM 0P Q0A000  B@ Ѝ 0-P`L p 0@q  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S_ -L C9xj -l1LM0l  y 0D85 YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pQdPPp e @ 1Q0^l0  L00@ @.l4)@T h(KDk4kp`hktk -|0LM0 K N@PD0@ @孁@0 壁Kp`8p^N-0 CR 0R0 S00 0-LM@P/0 !PΫ))ȫ 0ë c徫^PhQ嵫UTPE@H00S< K0h( K0h,|kkkkktkp -@L0 0Q 0 $0Q0 $ h{l0l -L@Q񟗤X`T\Ț(T\dlt|LWQ6같șЙ $,4<DYWUS0SO #SHFDB@><:864;0Q |xtlhd T!PhYHW0 $#$(,"(h Q Q  B0ShC <8#"hȪ\lhllll ml$m8mHmXmhmmmmn(nDnXn|nnnnnno(o8oXo|ooooo8p`plp|ppppp -3LM,MQ (K@ l30S`  LDB K(@4*T IK 3(@D#0 K(@*K(HJK0"(@Db *ր0"*̀20S "*P% `V`"꣋@P់ 0:v ,2~w 0jv 0" KK(@(A*㘀K(J *㒀10SZ @_1 0np` 0n6@P61)K|0 B0/0}n9K00C/0/0on/0 /0 cn/ 0 K0L/0Vn)K0 B0/K K 80(@jK (A*3 n  M(Kppl`p`qx`4qt`Lq`qY@q|`xq -@LT  p3;p36x` -LM@ <K xp$d" 0010 0T ;0   P @e0`S@ ` z 0R*T0p000T@K0`KPX90@ 嗏0 P呏0 0pK@剏 9P像 0s fP sd~0n 0DK 1  ,D0@3S'е\\\4\\P\\\\\4\\\\\\\\\\\\\\ \\\\l\̷\ط\ P\ 1 &D <R 0}0; 0@00090:PW00t 0[0@K~P GP <޹0 X0<i̟@P 00eUP+;^TP  ;ZUPܭP RZ xK 0JUP00h; *K |­P 8Z<  1D R h 0ㆹ000005Z00z0 0w: D :RG 0ˌ 0rD )KR4 0@ 0bD H R0)H0Kp0<41 CD 9R 0)px9a0hSdYd  IiX I #y10@ 0@9i 0;o9 p(qy@a  y00@偬P8`FPP  0iOK00 W,yt8@7 0S`   PG0S@8 0080 -P Y x70r0So|K Hz[c0[ 1 1{[81 |0[w`[1 x0[sp[1 t0[o[1 p0[k[1 l0[g[1 h0[v [1 d0[r[1 1n[j[f@[bP[ e[a0[ 1 11(1 $a X1T ȠČy`[P1H Dl1@up[L1q[,\^0[  _ [8`[4] [m[i[0<|& ̌ ` $@(P ,0X60T60P60吺50  46 50<2S%000 FP @x$50000 0PxPE0@ 4< 40K   D50<2S$;0000T B>BS@3  % `40E 40Ka00@00a0' 0)[R00@ 0  0 00  0h40030 ! L40<2Sx·@K(P w|#K K0 KP$P /x30 3@ *0K@P<830 2@ )0K@P,20 2 00KP`pB@KPH#<0K@P P0< 80R #80KPP0;CS0aBP"40PP 2Q"("Q0 S@ 0pn `i\mTjLgL| A0S p\K|`KTKPKLPK0  0 \0 05K`P8 0T @膣@P>0S : P0 FV @ =V@ R 410S:t`ls`@p`{Gz?`xsslAs?s`8s\t(tK0C 0Cp4  0pH.`<$  PA(0S| 1x Pu (0PqlT (0($4@_ 0(000@S@/*PPxx%6Z,$S 0@S /'*$SP''P(0@S4 0Sp00S NP 00DdKlt1!(Ph@((P$00b04pPÏ 0 0C0(K`lf@"wPl(w4w p-4P0`L@iu0P7 luP10 0L0S' `0$ 0 000C S 0 0 000000  00ppfk p-8L@ChH1PS  0D P6ph 0S 0 R0 0 : S&L fF|00S V `"\咞L00SHP10f1php00 00 p4sl| GKӜ000S (KDwPlwwwlLwwwwx $0: S S  S S1Q;P@K J%RKK$H0B?  ,` Hp Rg80(S00Q0S+ @0 040( $P@1$C1/[!0@@ S  Bdp W`@PK@pK.K4 B$ `4\P 0CD PŸT 4  R    0 , <80S00  ! @00 0W NPP@ Q qxt0 l0PP@P 4 #1@`pX(Kf|{{{ll -L`p@UTP  *0 R  H n@0SxP0Sd` 00C0H  J<00  ,00 DwTPl{{Xlkll -L0S4 70000 $000000l$Up0\40@T12 P4 40St2 @ #0S 0S np P0S  0S L0S P86x#0S 0Sd `+0SP& M0S@! !0S0 0S  > 3 3 0 "0S "0" 0 0b2QT"0SP6@K P4bU2 0 0hcQh,"0S T儓2@@~@T 㽾("0S s2@m@T 㬾!00!Q0!090S 0KA00@000 00b1g1d1a0S" 0Sp l10Sd` P TK{P " (4,0K ͟P 0S z 2I02 Y0PN l@Tl\lHl8| st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0Po%X:(KlxK$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00 P8 8 8 0.S$00@m P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0ASH||,0Sڴß0. < ,0SQ 0S 0T P< V0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx""T20S d囌H P< p ,0S00@!L0SU `0R 2 0 0B S pxhhhhh`0 0 000000Q, 0B S  0 0 000000 006py P8 8 |0  00C00(<Q89008 (K|f0IlP4h`llPl܂ЂȂ0k<L -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` Gl 0@ 0$@X0  00C00 0 0 J 0Z*ffllll -Ԡp`L,P$ Q00S8 0S 00@00AT  R<0 08, 000C0`pGW klDl -L000S $)P 安!娉 0|!^1$)P aP $=00{K    ! 4 Y00S 1Q0 S  1lP 0S0S K,P 1P@! 0 d00(Kf@"lLl hN -41LQM pK  P@`KC8`P10: S 0R 000(YK@vPd1: Sp lćVPP S00S )@P U@ K`,<L --LM0 0 N-!000 0 0000 0$ 0($0,(0@,00000D@0HD0LH0L0000000%%f0@-L0$S  d0 P0 P@P P  P Q\S040 0f -T L@HgP4T #|=g eedAl -Lp`f]@P 0Ta0C0S0T00C SL T00B Sa>@@B R R 1 !! \ P 00C   h[ppWo``Fe`tJ[@G!_v3 0@4l DT6[`0@d/[蜅v̅ P-L@ ,00S 叆hqPlHj -L M3X㠓,  ; @P|c+ #;#`3R,XpW,D PU,, +'4 0@c00 Z4@A ?$4@2 0$Ć4堤404Z4Z04(ZX?004Z0d2  0 TB+40S2PUy0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` @d0 00Sd0\ƅ,%'@P+&P 00S p`P@ 0R@| aA T,` 40 (KHlfhlfS$4ff,嵩pPp0S 00CS00@Ӥ0@t@00S0#3 1PP 0h0 0S0 0`00\<00SL06#3 0PP<p0mQ\ dQP }P< 0,` }P 0KpHu\ui$\i$p 0-L M4PK @$0 x}Pxt 3Q[T0D\ 00080 <0<02K`}P(K0rHui \uTui  -4L , Q(0( E}p \urHuyi  Q-LP '$z 1ZA@, z 0(0 S^zQ@娀帐`p0 0 S V |Ztz Hz X00`@0D S% 4ozz ؖșԙ -PPLD@DDp(` <hz0  $z@T蔘z Qp-LP` 00S  R000 ӑxR 000   r   QQ 0u03P0SLL  phBz4@z@hT>hҡp p-0LxMPK`@ KL00 @PPKLP1 K0400  @T0S Dދ @K< L00 (UxPKpX$\uHui@@ 0-LHM\@KPH KD K K(0 2xPK0\uHuiHL 0-LHM\@KPH KD K K(0 xPK0\uHuiH` p-LM*@KxPx` Kh @wpP  K0 01Kwp KprHui pi | -L M K0, @e$0 x\p  0B06@K|P`x  `RKd @wpL  @rKwp0G KhdrHui pi | -LM"@K *KTT0 L@wp [Q"0[S "0[ S 5uKrHui  -LM0@KQ K!K  P %K0 ]wP - 0 u`p@P0S u0  t 0S-|-{0lS  PqPU@KHn\uHuiԜp -81LM@8Kq`P  JV@! V/P  0yWp@ 'PK 0QJP !d400`}P@P 0 E) &P r H$KDo( -2ML M`K`K@KH FJ@ BJH hJK0C 0 vPn` K0 Q( K18 P5tWK1t10S 2 尟0S ^KPE`@pH`4@K"%2P< 2W[H[w[ᴇ[ᰧ[%[[f[ 0 `t s$ 0S  s@HP0T00S x6t@`PKh@s8T WLs(K \uHuiHi@<H`ppx̝u 4 p-L M.@K `IP0 @up'  I00SA[T0K q0SK XRT001K,0H up4gKprHui pdLhi | -L M K@,0 @$`\p  0 0@0P0S phIP\0@Px`h@lP @IP,0@Pp@tP|` K@Bx@upuꨞ갞 -LPp`@P0 SP 0S@ 0-@PL0 p:0 0 -L`d00XTp@Pp 4 00 0  2 8uԞs 0-@PL0 p0 ㆈ0ؓ p-PPL@0S00pd00X Lj<8@P`RPPPpu8u4\s -@pL`@1PkP@T萘 p-L$M@`P x5 <@K$ dPIH` oHT tP@ 4` tP$;Kp踟Hu\ui$\i$p -Lp^`PP h$d po0 @80 0P(@P>pЖܟ -L@D008 ,Ӈ$008u$st -L@D008 ,㶇$008uP|slu p-L$MPP& 媸`@ C0P  `᜸@TB{KD@K$pG@pG B[F F 0P ,p 7F prP !|"4QwpBKK$@D`@@DP 0僩p0xS  \呛P@40LUZ@$KTutHu\ui Xi ppS - GL{M  WE0K0 E  rKp8 E E rBOK`4 E E rt@K  ET E TqF@K  E E q\@K {E E q@K mE E q@K  $ _Ex E qpwp3`v`3  2"RS XZ 2SP@00cW @[] T KZ[Q 4QMo.@K (EX:LPK P3 4 4KK!OK6o E}K 4 4E 4 TlqP[P Q[ U@, @ q?@ @ m?y??}P oVZ 01SW]K-K0  0S X3 X:qph>,AT 1S1S1S(Q$!000C S0:S Q $ Pn`T 0S,,GQ;V@P T"R0S x@0S,PK "2S*0S' ,0  0 n0 ~0wnvhq"Rd0S`en 2S |[`1P|!A tXn0l pP01S H10S N ̙|0[ 10S ? x彙00S 00S `p@Y(KrHu\ui i8i4iiiii$i̢BĢԢܢzȠ$0@Tpxi pXuDu -ML MPHHpm@5@ <54%A05Q(m$5Qm5Qm 50S  RU 0S 0SS0mL@Kbd7( CP Cx oPW Pm|,P<uAP   ( oPmm <0 <0R$ 30S | 30St(q(`0 lD30S8)b)$30S  W ՘EmV20SP` pA00S UmP0m 7 n`,0V pWP`9Zh20S`B`R 4T0@$0$@SFNKP@D/LRKLQKB C1 ?oPYK4[S` SoKL[ <PPP,BK[1K[!Q``P?K@ P@OK@@_KL[K <P,B0 S/KlT$l0@ nPQŪlt0 nP0QŞl $KHj\urTu4uLrXudppHu6i(|Bu@uXrKi%zȤi i  0-L$M8@KP$ JB pB0S C0P00C SX8@K _BP800 (np/ K0\u0Hui$T 0-L$M8@KP$ B ;B0S B0P00C Sh8@K *BPH@0 8]np0SK0\udHui$ -LMpK@P4 AtH A ` AA0K0 A1 /n@PCBBP 00S0xS 0K`# rP 0 S 80A7S$㊁A0[S K Ό@ K$DP00@KP 0 A mPh@K$ zA\ At mP`0X X0 mP@Kr\uHui ĥԥ,Di4hi$\i$p -LM`pK@8 P`KGA@ CA0tP0 L0 0P0 b @P1 P0 0 L H @ 8 T HPx1PP0 00 C R0:S@L P$pK@` 80$ PD $0@@T0P0S+0(0 AP000S00S  (Kp(P哃`K $0K$ @(T $0D` H0 `@KX @L0 D6mp<v K| 0\uHui8Ȧ 0-0LM0Q  ( PK/PP  @0Sl%AP 0S 00StPU<k 08@u\uuئ 0-TPL0@S s<0qt 'w 0P@0000lHu -LMpp0Sy0+S DQP`IOK`` <(8P,_@Rj307 OK.)@ O@K lP B01S0v@K @032K4BKOKI_K4[ <P ,#@j_K.? @K2 IlP 01S uKviOK.?` ?K,2L &lP01S ,u42i42i42i42i42i42@i42iZ i10ST OK.?\ ?K(1 pkP01S: Tu7,"(2 4"02 / @ PiK0 UTPvisiqiK0 UTP`i]i 㟔$KHuz0Tu\u"i <P%i XlIi |̧اQi 8 (t 0-LM 1 10 xA$0KX1|X!=kP 01S >Dt >1 h1 <8#"h00 @$0K0 kP ϊ01S >td\ >P Uthp00Sd  P/K0Hu\urr4%i @$uTu"i P`h#i xp -L M(@K 4Qf>( jp ('`P\(0 $0 ` jp ( $0S$ $ 0Ρp@PU 0S \ xړpMhP@$0UL00S@ I ,ǓUKHuxi ܨp8 -L0 ,1>(0( ijp \urHuzi  -L0M@HPK`pv$ = >V$K 0$ R@ \}@0P-Sp@dY>P4@ ,0,H K)jp K$Hui$0 0-L$M8@KP8$ = =D0 < jp0 (g$ g K0Hui$@"P -L1LqLP`V,(AP>0P00C S= iPX@3  iP @* iP#0@ iP01ű0 iP0l 00<0 XiP0L0 0 Hu\ui zi Tui ri r~i u -2LM04 SP YpP =P 00S00C S 4p Fp,KP d ,P 00 80 |W X 8 0R00C S|=Pm @ =Pe000C Sa 00S .<  aR #  <  aR # p< < 0@T%P40 000 +Y 3=P$4 TR00S 0 R@ 0T 0"T0S$@$0S 00 0S 0 PU,WZ@@, (Kpttrr\u@uXh -L$MD`K@q$ R< x< hp q0S* m0S& i0S 4PP0 x8 `hp0@`LPE`@TU0T` KHui$ -PLM@p5  p@0P-S2 ` @CS ` ASaS gS 4`4`@4@ 00SVpGWP ;P   ;P  d{pGW0`,0 D$D4@ A<P(4pG`@ $@P40,0  3 3 Z W30S %Y W  l;|#0Wx0|0 @d<PepW` 3QW$;PWi 2Q`];P @Q2 R @ 0S   BR X0S= 4Q ZdR ;PP Q82Q P $b  0pG2QP `Q M 0pG 0030pG`ꌑWAŢ x10S 180S1U10S81Q0` ,10S ,0 ;,01,0 9gP 01S00S00S* ,0T :,0 0,0gP\u4@urpu  992PP  X凪 0BS 9 \ @P  8  80 b : S SR  8 0-S0` S 0V`0 ` @\1  pW3 RQ 0@PS| x@ P 8 `U@K` PK`P ` `0,!`0899P`0!t p lP `"8+90h  8#90d 0S0`0  0  89` \ 0K80 0Sd0  @j@T(K\vdv(v$Dvv$vPvXvT`,v1uv -1LM0@S! 9pPk 㪘10Sf10S*, N0,0 K40CSHꬾhxxL0.S<0S 4!0S7 0S aYa,rP`M 0S0v03U0S  hL]zL0SPLP4 pRzl0dᨘ@P˃0S @o_Lvv v$vlt|$Dvv -LMPp@P 7P 1 tP4 KcP[P 6&00&06  7P 1 @@TP`6]kP \fPX@L6 10@GSd<$8H,`lx0h5 544?4 44444 0s4  x4 04 4 P4h4D4T4P4 8404,4444 333333 33 3 3 E3 3 3 3 3 @40@1 h3 @43 P3 D3@3 83 0#;$#00000#00"0"0000C"妥p 2 `r00X2Pf0Sp20S{p20Sw<20Ss20So10S@j20S@iX,Kdx 1 R $ 1!0S 0S S S! &!10S!h1!0S110S S S!t1 x!10Sh!1H!0ST1T1000SD!00S 0!01 00S!0 !0S110U  0(Kd00S p00Sꨱht@phvP e_K1 P. T V .0=>P. G VV 04 $#$("(Rtplhd`V\20 m 0@S d :S["RJ`K .0>P"OVL ]KPEVPEK@  0P9 @R5J`K .0=P- 1 V0~V4|V 04 $#$("(R$,4<`V00  QWV0OVKp舶̶@XllԵoo$8Ldt(o\l 0@X`t̷ܷ9  -LMMŸK2(H(`KJK 0(@D"|R+*u,db0`"+*k,0@"+*b,$20S "+*V,P% `V!~+4@P0 0! 1# 0! 0!e+ KK(@(A*-,K(J* T',,1 R7 @10S3 1K(HP0@ !p` 0! @P0" 0!7 000 @P!+ *+JK(@D$, bYT (K4q4qT`qY@h0LT<D| -L@6Tudm:T  p3jp3x -@L T3 00R . 0)S$0,S!,R @P R x00S R d00  H U P:00^\ė -L Qp3 -L4M 0@1TpPTTTPJ`KP .0XT <PH. % 8 TPUK,8H -LM @0a0TP0K4K,K8pK )0KPu$ )0[S S 0408 l<8#" 04 "2[8#!tT0 qT(KTp 0-0L S@P@$0)S02S #S 1S3S \XNT HIT W0 000 R@@T0Թ -LOM0 @K,0 $ "Tpx P Q  Q$@T <<0 4 4S <0   lp  lP  0TSPT  P ˟; 0 S  `p) XK`K PP9@ 0': ;4pKP : 0@: 0 : P T儮D D D D D @@E0@2S񟗬 DDtDDDDtDDDDDD0DDDDDDDDD\ L(hDDXhDD@D0P:;xM;0/SS" CS AS%!GS LS gS aS cSlS sS 0<0;0 0;0:0:09SP0S>)p000K 00 V@8 p0S 00S 00 80SR& <#1 4Kڪ4 h=R 000@0050 06WP o00c00 0n 080 4K娪4 (<R 0<c$0 : $ 0Ks 0S 000S $ : PWP   JK`P` 0  p:V4: PrPD:P< f8*D; 00`WP |o00 14KC4 R  0 w08g07d0 00j00Z K%# dI  7 K0 P Y, 0  9 Q0944K 84 |R3 0N0:;70< 04Kީ4 < R0\6H(<0K,mp 0H0:;:0:;8'pG7$@dXX H㋼P 00 4!A8D 0 0P 0PP @K " g   70 |P '0S00Q  JD70  D66 PQ/ @K _"   7@0K KP $P0@00S 60 (d@%0)0 lP@!Q@60  @U@`K@)p' 0@@ plP)0( pvlP5 0SlN  \d5T%0 R0<S00l5 0 5.$ 0 %00;0>4 P c 50d$0 0B0 Sd$8#804@0,@ @ 3 ,0Kl4 @0R,0 x3) ,0Klp. DQ,0K ), * kp )+ , kp CK0  ! X30S:00  !B:  0KkP$@30  )@& @0K@@ kP30Q sZ P ~2P 1P$Rp p D! 00 00!000, 0R PP4S ᓷP$: 0"0s 0000000 ! 00 0RPPX`Ӟ@H 00)00 00 0 S`PP@K@K\: 0P 80 `@00S&ɺPP@g lswxw@xs?s.A''4sw4TwpK0C0 40 5@K X0 T p P {aPnk0S [U _ P0  <QI T5 R XE0Sp5p t50 c0BQ 50Sap3cMЍ 0-8P8@L4 4  0-Nz - Lah( -LCM`XTE0PuPP4 40 00 =rP dP jPşP4 aP1 uP zP) tP*hP0 $4P!\N4 ٱp'0,K 补,04 S l^0P4 P$p40S<4@00S 4K 7P Yѳpq 1 dR 0+S ēH@TPp00F S.VWpkP`VH W0P 0p `PZ 0RR!>C 2#=S0Q@ PR&&`&&,&&%&%&%@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0 1@PQ0GX1pW*L10S LK⑷pXL $1LPK`@K0S@@0 <@ 8p Gp( @K@@  @ T T00T0S@>T00T0S(K(L8X -QL|MP p`Q`` ? 0 吠Kȟ 0`> d PT jP 0@(@Kh0P Sh@0[S@,0  K,@K0 @倛, @R, 0>,0S(KpL -@Lpd P|IT 3P @0 S00H@PXjP@r@`@`$PLj@@ L p-PPL8`@WP @2S @p -L(@_d"0p @ሩPQ   Jp00PP 3`00| -0L(0@_ d"p P`PQP @ -p00P0S @| -LM@`B0@ 蠟0 , @=0S* E@P= 0# @P  0  0 d=, @R00 V0S8=000 =$>(K 0-LlM 0@"pP  K]p ,倶0: S S VSK08$ -!L Mp, ; P ?ptI.7< @@04 0 0400, \0 Q 0:p5\`4K0U404,08 (0@0@,(Ko+G(K|rdAT` -oLHM`PdK@ p`0[00SHP0[00SC@0[00S>00[00S9 @P3  $K$ 0R  0R  0 @P  $K$ H0R  <0R  0KEFI PART 0-LP@P0,0 -0LM &>KP@Ft `@KK@ jP,p` Ό P0 @RU@ K M-LHM @0 `H `1!o$h@K = @ :p@, Ό @0 @"Tp(K -L`p@PEP,0  >rsd -PL`XL< =DH< 4@,p@ +T -PLM@x U01U01`,0pK0pto` V K p-nPL @01A01000C@1Aph -P1LPQ o4! = Q  47_*PaD @@D 0lP `PE\ 0@\0 \0 \ 0\0 !0S4 /0x0@1A \0s@@vw (K40H`t p-LM_K@`X@900 (7}7Kp$MЍH 0-LM Pp ANK@D+0D P @P@R@K0 -0LS@h L, -0LSh?L, -0LS0ShL, p-0L@T PPj h0`00ᄴP@ξ`p8 p-@PL`l lL `\ 0F D0P0 xP@ᨾPp@T -0L 喯뤽\ -2LM00 S Q 10S 1 o1 0RA00 0Y 0 00S SI|10S? p10S;00^SY,  0  00S$S00,0 (p0S00p`P@ 00Q0P, Z00QP0  @j@a ` P@P hp\P`@ 00 0 !0 0 000(K̥Х( ,izD 0-L@c@ > PPd 0hV -9L(M9 0H eSL  fS8 8 `ЈИpD @ <` 8` 9eU *HU BUAUi00E S$OEU CUuFU GUUU LU RU IUaU VU bU cUsU lU hU iU fUoU nUqU rU|xU vU  Ä7uU U yU\'U T7UW00F S47 $7 7R6 0 00C00 ,K❵, 0R& P00R0Sp AU6P&00&& ,K‵, 0R P00R0Sp@06 65 @55 @5z%00%0w5 q5 @5<0F@j 0X5 ]5 Z< Z008 <0 Z8 08@@ 1Lo0$00@ 0A,5 ;$%$0 %04 @4 4 *4 ' 4$00#4 $0@ P  P0 P00tHJl4 \4D0`pSpD0 @HL8$84@ypP4H 0c80}@ T8xX3P)`p@P 0 S 00K⤱P0S0#3 ePP  X7KPU@ @R@X00SX00SL0  7H2x304 SQL$2$0Sd"0000SL"0000S 10SpulBldRT2p` 8"<0QP "0B1 HP ! ` nQPX  50S+` `5 0@S5@ 5L 0H0 D@ P ` P0HK0P`0@PKH0 D@ P< P R 00S S0BP0 dL0P `0RL0 \` G0ST TD4T 400S 8K00K 0@8 4 00 ,@ h4T `4P@P< 80K8` 4p 0@ ,P )P$40S 8 40 0 P0R,0S T00T0 8 00R4 ,0R T0 3TP0`Up30Sbc0S z3Z ,3X00s03P0Sc# Z Q00S> 30S:S0S6R) 20SQ b 0R20SR 1p2 2R T"p2HR 0R08 KPK:h D2b PKR8 K-_00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S `10S h10S`@0 X`0`01T 00S0S0Sp0X`00s03V0S 00S 0\00S-`(K輻@,8@$4̥Хĥȥ \"X0` -L h@P⤀pP`4S S S  0`S Xo2PbgPR0S ]d,8MЍ -L 0x㙽x -PPL, `P( @7P# .P 00+P Pp$P. P pP P@TD -PPL 0SEnS0oSP  0@ 00@,m`P㳺T0P@ p`Pp`,WP<  0-d0L@PT 0P<00s300S @00S0 < -LM,Kp`P+;Y Z tP Z N nP!Wt `,00Y Z ]PWt O,00?, ?CP@OD⍏H_E`VZ -GML MPSPMK @D @D@PppKjP`0: S, KpP  S`,@K P pP |Pp  upPG6`,@KLP0  @P@PP @@00 :@P P:00`P T00SH /@0*P$;K@H8 -LM K!`P?pOCէ 0PPZ P tP VPpOD`VZ` -L`poj88P@!hP aPP fPtP vP0 P0 0StD0@< sp0@d  P00S +\00S P00SXe UA oPP@P@HD @,MЍ\ -L o㤻 -LM0@00C0S0@0K 㾮00#?00S  D@< -L M@P  K0 R0CKT -L M@P  K0 R0CKd -L@OMpKx ,@ xRE `,@K6mP) gP! lP 9P,sP oP& uP xP! 00000 0000 e k  X !rpta00 SM0K1PAA@炛P08! ,0P( 01 0 1 5 ! `#0A YLK@D@DK@hp U00 V00 Y0;;0 KAA, >K*:POPl -Pd P\ OKP0C!0C 4,@,@T QW뀺p@ P 98Ql10ANK@DhQ@D0`!glM0S Y , 770SM0S KAYA 77 R@,K rP7 ,0#4 P =+  T4D(KXzxPxT(0<$ -L,ML HKkPrP0AH0 D@ @0 <@ @0KH0 D@ HK⢤Pht7\$\\t\-0+0K)Kl\= b\* N\ T\Fd\ f\ t\e n\ p\ v\ y\ #00#000#000+K *K{|4K| LJpl 4 m4Fl1 0K00 #S^  @P0SV :uP 002`@  P <=@T `Q5PŸ0S h@ R8  0SDnS0oS0$"80 00Ÿ00",8KrP 1 1 ֣L!opK1XL QJP1!P11AC@t ^P r P  pP`%p0P q0PY   ` p@`pP P P 5@  0X* (K`X@PT,L4@(z$X\@@ -0PLM` R PKp%`  <`p`3q$@0v03T0S9 p-0LSP: @P zP uP*00S S  P P|0`@ P`000s03@T 8000S0S pp@$D`(00 0 D@<0D08 -LՓP  RQ-L@ Pñ厢Є P-L P偢 0-/LPܬ@P000+0/00$++0X p-LlM/`Ὤ@P KdP0: S 0PrS@ Kp p-`PL@P00S 0 R F)B)#&V \00S {TH0H R 8/),+)(0(')^p<@DHj --LM0 0 I --LM0 0 K --LM0 0 K -L@JT hN -41LQM pK  cP@`K-)8`scP10: S 0R 000(YK@`cPd1: Sp l(VPP S00S )@ oP U@ K8`,<L --LM0 0 㿵 -LM @XPp`*>` 0 P  0S000L -L XQ%;lQ dQ fQsQ uQ pQ ,0S00A >., $ " P@ p`0` p0@P|xaQ<0`80p40@00P,0(0$0 0d`X\4Dd -霐圠L`Ppp |0 0@R 00CS00Ӥ0ჂG P0@`FV p 0-T0L@TDP0S 800 2,A@$ 0hc0@,P c -P00 P0LMS@ PP P@0?0 <@R24 000K @aI2 000$-0 CR 0R0 S=Q00 -d0LP T00SD @00S4   Q0 蔲,p$ -TTTL`H"0S0 S0$@{@PvP U0S0S 0FS 0@_S0Sc 0S0_S] V__U0S 0SW0_ST_UP`F@p0W! 0' U00S 0S 0FS 0_S0S 0S0_S W 0 Qp U0S00S0S 0SJp~PW p 00S `0HL < *p`VrZ@ppHd@, 0- 1L0@S= 00S 00S . EP*P 00S  7P00S0P t P0TP0@d0S 0P@DT  0 0$p, -LL00S @00S 400S( h hO蘲p p-0 P0 UL ` ៯@Y@P ,T44II}0@`p| -0` 䠟 LPpB V:`0 0pC@0 0 @R 00CS00@Ӥ0ᄀE@ T t00@P 00| p -<4LMp040ğ ,4P`0@ ^, B 00CS00PӤ0LEP300S0 U0S ß3P` 0@^ 00CS00PӤ0'EP8``P W:<p0 0Cu "W00Dž0,, 0c0``00 U2@P u UP1"0S 0V'p0S#d"P X2@T0D"`@2pG @ W`:p0 0C @0V 0`U00V0S`F U !0S ^00GL000`00UU`p10Vd10S$1 0@P 00CS00Ӥ0E Ug PpGd b00VS00S 0000V 00 S `0R  00S p00S 000, 00c000| p$,\X 0-0L0@S 0 <q0 \  tP0S T T容4 4妹,( 0000,$L -LM`PKp*%\` \\ !\" 0S0 0(K@e0S ( K|@e uPD"Pp0!S%S0` \ Ka(K8<l 0-PL@0S\M0S 00CS00 Ӥ0~D r0p00S tMp -ML MDeDDDu_PP0 0S0 R 0 `@P奉7!T aFP BK@ @vPʬ4 P 0 K*$PDVS|43[S0XJ2[PDS0<B(D0S(.P 4  $P$000#0SP003P 30SP #0003$@K30$33|3tp3hd3`\#P00LP@P 2 (@K P3S0 cP 2P00S20S0 2 2R "2 t2 2 "P00(@Kl~P `2` wTRP 0S8m42P  B( @(@K\1WP!10OP JP 1 HP!10a@1 p 3 ^"8aKPP#P30LL!#10#P10S @ @4 0 , Pʴ@0P0 P 00S     D +X800S02 Kp8ī -L#00S x00Sl g XJT0L RD00Sځ$[$ +4p0,$ -LM,r,,`$1S} 0V15 VY VtVqV+VmQ10S10S  SJ10SY !001@TQQ0SM  lJ+h!@000C@0 0@v r n61 0@c _ [0Sb0 K P#[R 00CS000|0  B 2[Sh 00S `!Vz(K8Tph4p$īht@D -LM@K qP P p [J@0SEp -cLMpP 0 0Y@\T l z 30S00S, U#D0 0CR  ,$0* uR00 R0SR0 0CR  0*20S0S00SM "0S x0Sl + X_IL"0S< 0,TI,0S  HI!0S =I0S  !0S;*0S0Cp 000lP;Z 80S 0S  !PE0S  *T00 T0\TS@ TT T@000 @)000 TT)@K )K )00000gS,@L0@E00S$0 E g0AR8y(K$Ptpx p-LM`00S!!H0P0S00  @K! P {P tl T_` )DP0H( 00TKpp$l8& -@@LP p`@00@ S4$0P P -AML MP03PuJ:`0Sx(n?f20S7P@P 0S8@P 0S B/វP``1ypK0P!10S1 101 91 10 0*10S" 1P tA0S cXT1 1 V$0 ^ %Z l00S` K LD0   (KLPp,l <D T|( 1$pP08@<4p -sLMP`@,Kp@g "0S ,0S0S0 "0S,00 20S 0 S0S0Sh2`"\2,0T00820T,20S  t `FV0S A0S 1!00幰1 0@P 00CS00@Ӥ0t8:@t ,10SE \1(!0S 0S01 y 0@80@@@`P" 00S 0SE˼00S 00V 0S 0P Nm 00 @P0輱$`t,|X@p 0hD( 0-LMP0 @RP 8K 0 rP0[ [$t0R0CR0CX0R P0R H0R<Ḕ8 0'8 Ee  -LlMK`ARp \X10SP1H!50: S$P?1P@q00GPPЯ/P0 0@P 00CS00Ӥ0sI9 P00d0 0@]H0K@ 1@ K, pl -L@|MP`4@ @@ 8@ <@ '7@07@P7`7'0?00CS000f0P@ 0S= ^;H 000-SS4+S80/S<00KP <0 &80 080 0H D0 00E S H0KP`$"  H D PUH0K0@H0 D@ /pD00CS0@60S 460S 0S 60S 0S 60S 0S 55 %0S500C05 0 Q40040 Ť50SQ 5@5T,0 %@ Z0 V  R TKNPT@T E A =$00040S 40S P4ğ 0@P , 00CS0,r, 0p0,18p W L$P`0@,E40Sw 30S 3#n<0S K JP 30S000C00 80SHK0|Ll3@@40l#0@40 0@KV, ,0S <#@00 @@0S <0@S ,K P20S000C00 80S HK,0 0R|20S0,0 00Sf @20S@0S P"0s0S 10S 1 "40S; 20S10S1!嚬10S˔10S  A@A0S<1X!0 0S1,!D8t 00  BS0 0PU ,A,0000P岭,] 0@0 @0 @00000`00pl 0R?Cwz8ī|<T0DLp ,llt$$4( MЍ -L@P   -PL` g@Pp 0eS XP  0*W + P#%*+@ GpPt  00  OP H * 8 -P, e8X\ -LM04 p P@@@PP` @ U4 @Q 0 0K  p0V*0S  ᤜ ᢜ(Kp p-LlMP@`PPp@W p@` `00 PHK`4p 0: S  *KpT -LpM  KA4P 0: SPKQP@@Pp`T 0SR )aP@ph)   4p D P Po@` 0`(K8$ -MLM`p @f^KPE\ p Hnj $0KN 0 $K$ P-L   ڌ0 Ռ|4 0-@PLPhG@P @T eP@;P  ,d)(* 00hl| -CLMp P `㨘 尘 嬘 *nP( cP% VP eP08  mPqP (  pP sP xP  V ` P0"Xp$20W(0u03R0S Pr INK@D @D!8p  PP1:(V_8S\ ~KpG\ pG0K⤠KZK< `J0 p P X00K0S@ 00 ,@ r00  0 K =0@K0 tPp  p(ԋ P@`T0@ J  0 K (K@T $@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P" 10 RK0 p-LMPK`FOK     0RQKp -b 00"00#0\ -LM@K K00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K 0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ04 -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@4 -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KA M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(K4 -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (K4 -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,p(J0/S 60S x6F`nP} pP Z tPK4@K P60SPK$pp6xPK`V  U 0&"RQ06 0O?   3  K y~P |l8$ PT@:KH$0S0`00'cBMK(@D8@D0#Ys i/i/0p凴P`BK(A8A#000K^ BMK(@D838@D0`#aTi/PDEP #00010t@K  0 @L30  0 @A200  @ 6200S0Y0S x"0D D@K w] R 0 W0K -0 CR 0R0 S,00 -`QLP@9 p$0CV3@ 0P,<S +0S+@  R@0 S0SP ,00S>i>i+p -QL@B <+84!010S  +pP WP Pp0 CS   ^P` W UpG t0  CS @` VP<00S$ W i+m3 8p p-LPL`@LD8 T0$ N ph   p-/QL M`Z QW "Q Q;5QP 20AS4K7Q1H@K0P y\1\%  0K1 f\@PP 0 D0 jt0 h5dd0 0 S L00S $ 000, 0S00Kp4     -LM` @ FQ (KoQ  P  (Ko 0\ p P , 5p P,p @ % Q Qp QP Q Q,   Q Q 0S0S0S0C000  ^ P @U@00R 3 |T pB0P0( XPW 0  0Y $X  , R E @,    Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !|!x!xtpl! )ZX0@00@P i@TP,(8<0 L L0 h00S (Ko 0  [  00S (Kot (Ko)(K0 D p         PV  8z  4L$\p8p -T L0R S S0RS  P0  T p- 2L M0`S{ Q u0A0S10 0CS7OO8OOO(@KPxd\\!T@H!R >, Q Q (,  0  -|00S 0@00@P h@TP8 <0 L L(h0 KpD 8$8@L\ -L@pq&.`BaT cT gT 80S, 0 0000T4(ß0 0c3 @  p 330 @0`0$ 0 0`P h3lC0\S0C0PP DZD3P0S(430 30S0C0@@ ᱱ2P0S20 20S0C0@@ ᛱ2P0S|T20 @204S0C0@@ ᅱ<2P0S<10  (20S0C0@@ o1P0S10  10S0C0@@ Y1P0SL10  10|S0C0@@ C41P0SLL1`0@fS@s$10S-Q P 10Sj Yp@&.vP 0S 0R 0RpN 4<l`  -L$M@8 8`K pK4  0( 0@ ,@ $@ @@݊P P PPpt0 @@ɊP 0@@`0@T: K(@ 0-LM@QP0S  0S 0S0S0S A 00 S;(@K  &P0@0P* 000aK0 X\  0pp0` 00CAQ BP0   K0h^dL  -LXMTD0S` :P00$$000004X  3P X XX X  s sssPs30P0@PX Xxß0 00@Ug Uu UlU !Ud~K 2 41P#/ P0L@K0 L  ,0KHP D P  ,0KL P, R p 0S\ ᬯ,0S 00SS 00S S 0S 8#8 $#$0 0L0SbX^ ]g T$00'KZ00X*\1@T& 0y P: P  < 8#" ;P P  #00S  P yP Z0000 p d =(K< h88x0 P-L($0$ isR㇇L P-L@ D0vp4$s u; 2?P~8 -0LM@P`p(0 0-SI@P ^^^^^^`(  `@DT Ap3 P (0KP1p) 00S  0P#p 0 0S0  ^KPEtp PE0`K+sp@0S \rd0 , > 4`P -pL@P`00-S*P P P P P +P P ` ``t0@T  @Tp!`@DT00 0o\ -7LM 0R`@,0 {0gS&Ȇ{8 < 4 0 6iP0-Sn0@ F7Sdedee eeeedeetddDddtcbbDde4ebTde\dhdeec8ce`eHeeLdeccteedd de|deeeceeed(dd% 000|%0000d%000P%$000408%640 000`R 0SS v*`R 0!S`R 0!S40S v0!S| d4 0!S\ 0!SD 4$E{s{q $0@$0=$9pgzeycya|_|]{[`RA  `R;  N`R4  080 E`R+ , K < ;`R! 6`R  (#000+`R %w#`R `R 0 "0, K H!0S:0!0` 0  F0PP) `0S 0S 0 P q0S0C000lh0@ T:~(K$(8<`  -PLM`'ڎ=뤒2rR@ nP TP dPtP vP qPX2T2@ L2H2X@@~"b;p 2PC2Aq=1pPk O1`e0@SZPP P 1 n P> PQ`1tQ R dHH1p< 10SZ  0"pn T T T T" T  TT 6T F0 ]d0@@ 6T@$00S P"!P 0@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0 P0q8q q(q@q HPX\ P-L   <4("4#6  T -LQ 0S 0S Shh0 d -LJM2CP8@K T %08PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KT"SH K<0 K|8 -L-KH $M0R 00S \:0-K0 K  p-L`!\P@+0R0S   p X0S,{4{{${<{0,($  phpHPX\ p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@ph800S (ph0 ph8P P P !P($ tl-0 CR 0R0 S00 -PL$M !P   1Ef!1 1R10S PA !P B P !P" !P6 P   S S0  00S00S Kh~ Khr"P   KPHX@L|<Dp -L IL0SPKPP 1P !0 S00`ڸ`:t!0@LKP KP d0BP0 P R 00S S S R  UPP`@FPP0 HL0(!S p|,T|do$8 $\4dzp(_3hL4 L,$pP$dV2  UPP,2 @"Pe U@P_ #x0PP0S0 d\ th<0s<R4 P~s{sFD10 S 4\\!@ @0S 4tKT10S1g@ 0D0 H0 P D0SDA H0S H; 7 Q0D0 @0a@M=s(vP ,0<P0  $pǏH B8"b0OPP @ p@4H PP `P`U"0S 0S 0S##d(#0pÏ0S0S*$P0SH |30S/ 30S+3R&Q$30OTS 30S3#3#-40S4 4  $4PQ H/X4qr P0Sx0S0S 40S 4u40SDq P P02 2 2 P\  <0s <8` 2 Pcrar8_r]r (K -LM0T ,0 X \$ d@P X70S,08, 0 ) (qPH  0 S H$ gPD  0 S D$ C>K0C0CLD `4 PD ,0X$:dP PrLr,0X$TP| x SP d SP T6@ D\$@6pLD  ( S@PH$R  \$%pLD PD $,0LD PD Wp/&:`"@@P00T00S4 T2*P0#03V0S+ H40@0P@@PTT* W 0S ,0X$,0 L$ P$ K  8K DK0 K40KpK嬙 P 00Sd40Sa80S^ r [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DHPP 7Cx00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pODI@Po86D@ 00CS, Kq4L K1@ИP 05w-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,400S le@T $ 00 t`'D  PP0S((0K  # Pt`K` |ğt\hğ\pKD 8$P,UV 0t0t0S `,0KPP4ȓ0S S ß,  ,0KoP |, ) ,0KaPYP0< K<0 `P PpLPU q_[\ \'20S" 20S0H0 _[]K\ `[`K <　K@@廑P  0KPO 2 0S S Dt 0d@X@,18  @P` p , 00P40H10@00   @P` p$(< ! DPX0s`00 P+V,000S(0K  #  Pg`\@L0V0  0 001 C(K`L!LPx!! !\!!! "l""4"""""##@#ud#l#|## -LM<ϟ0 8?`44ϟ00 (ϟ(?@P00ϟ@P 0 , 00 8 T` Pp L oPD D0S > 0RS 0S Q00-S ? tW R>dW\>0S D0S   80> 04 S< 0@ D00S0H0 9PN0SpNP00<0S<80S8`= `= *xp0<0 08 SLPQ 00|SM !P>0S 0 S  z<8h= /a@P000T  T  T/00P<0Se0 SPP<0S X0 S ,<0S  0S DQ;0S  ;;0S q|;P PHD0S ;0 P}Q  d X PjL 0 00S*  R'mP;,0 :)00|S @ , ,0S  H*0S00@:: [, ,0S:< 40 d:0S,0,YKP0S;0 (j0 SJehP0P0 P0: S L)0S00H9  90S H9P90S S@9 00 L90S,0,=Y90HQ0hDy0E,@0S,0,%Y p X@`T;(0/S' 0S 80S0S#'T@K00/@0T0 P@ 0TKS#0S*u0S000X7 HWPPX``u000  70S3 60S 60S+6R&Q$60OTS 70SD7#K07#v60S7 >6 i63uU Q*&0@VD X>Q>4F  , \PP@",p60S,00#30#,6p3P 00 P@T@, u\P0S H840 S4 4 40,; TL00L0 Q N0S#tT0K 0OT0 P@ $0S D0S H$0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,d6PP)0S, , T t T 0S,|,0@(S吃̣ `p0p@h30S000@0+6P 430S,00@,6P  L0S (CL Tr20S. @20S D20S&,TK0S0S *p20S2#"2#M<20Sl2 X2 @H2 t10S000#3 05PP 0 SD!0@10S,00#3 ,5PP (40S0 0 40,<8|@0S@ w0QqXNQ11P @0SP@C\rs 0 00p P##D$T`0D#T8Dp#$$H$:t$0T@(0RtD0Sq RQSp00Sf 4 0Rbv p\ X qY &F0l h lK\0Kd0 `@ (pK0\K@PLr 0S?@0S,1 41 @ P10SX1<  #tQ01@P@@40S ,0S40,00S0W!0S0S<8(K -\4LWMPpP` X@K8j f$4X  00KT P LP Pp!xPKP ܰP#xK 0ҰP#xK P0x0[S xKX K00K,P pd q( PH3 004`Q,,B#30P ^K E000S  <P,)0S2 .S`P( P0S* 0S 0S  <؋P(, @@`PUV1 0 \xq ጎ0040 @4 K0@ PB0S (0K  # PLH@A@00QS P/ 00S 00 R~PPVP V 80K8 ,T0<0 g(K'$o$$$P$8`$$ -0L lRf뤽% 0-LWP\10S 0P 00ST@]@Ppc8[/S@ P K08SS/SK0|* 0-0L0M0@S DPK0  0PD0SH 40C:P I K0X* -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxAPP 0S`Rᚦ0 S0/R0 S?D0cBnK`F@+ޥ(0K 4R/S@/04B+dӥqPh!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PPt 0P @,100CcSX108P 0p30$0, BNK0@DCM P X000mfP J@PdL@hZ*00(KX``**P*ز+* -LM0 -PQ00`R0LMSpF ,20SB K"@,^K8PPPQPOK@D^Kv0!層Q`$8PP~P PU  0Ht HPd!QJP T)(0KP@x0[SP\0x@KU @p PV `PT @pP 0w03T0S P 7X0 SpP h00S`0  (K!@+L+P+`+Ll+t+++++' p-2L0PS 2|2 Gt2 ph2 R`2`2PR L2P 0S0*P} 20S MPt10S 11 cG1@ @P1 @J1 @D1 @>1 710S1@1 (!0`h0PV P x@P< s@PP 0T.S@D0P00 !GTP 㸤P00S00  V 80 G R00  00`p+ T +,P,<, `H,dh(Z\@@DP,X,t,' 0- LM0P@0P  P K*0 R r X0000 T 8@,d 70P8P,D -2LTM!0p`0iP^1A0 @0s 0 @0s 0 P |1|Wd000 0000,K0K4K(0Kd@K@$ K$8K J, 80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 ŐpP@uV00S 0| /F@0@_ V `@Td @P(0tpu0 KP,D,,,,MЍ -000,0P L 0 0EZzX- -4LDMppT0@-S@X9P00 P. Up" gp jp@ &# T\@K X0 0X0 d!T1P 0K &10S 00#40Sj@(K@! NP0S Xx @ ;p0S @ TMr&t0p@}뤽0-848-X-h-x-,z|------L`---MЍ -L bX. -L0GM@K0$<1 4q41`P oP !p0 0bAS`GK0 A A0 .9P GD GK00 A0  A0K PZPl -Pd P\ O威G>K 0C 0C8 qX@D.x /8\p -LM@pPg `P 0S nS0oS` =qPP00 @4P @Q  0U0P P00 00 X 0000X  U 0 00 ,K3K, ?R0S@p0"S4 0@P -LMp`4P@( P(K,KC  0mP(0SR$KMЍ0ķ@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -L MPa0K{500K!PU`V\2P`@R0 @(K~(,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K~@0(,<4("4!< 0S 0R@P0 R 0b 0O? š 1>A\0@ (K~@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# P ,,P`@PP Q P 808PS <<iP`@ Upp -\LMP` #p 00P  0! 0@T K -LM0 ̠! K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,K}0pW,00,0  }0 R, (,0! R:(K -LM@   @ K@ KIi00P' 0{!K -LM`P @pp0 o Xp# P 10151;;p0 T  Cp  0o{8888$9 -L M@T<Kh@D0 .@KL9ܷ -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX00`@TDh9 -L M0@SHKhP @L0i/BK99 -`0 MLȠ ,Ƞ0Ϝpj~p Kh9: -`0 MLȠ ,Ƞ0尜pK~Q Kh:8: -LAMJ_K, ,KOKᱝp`P#0S @ 1P @T T  R 0SR( K0ACp <j`V440 JKp, L|(K0L: p-40L@P(O,O0O`@<`O V@phOp -\LPRpP`N 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  e1P(# ,P ^1P, 0P W1P08Q 8QP< <8 {PU@ @P40040`8 -LM, pP BR00S ,$O0!1,0tR0S (O01(0P<8S 00`<S$0 00S`A<N8< 0V 0V^18SY,++(,a@<N01800Aa@<N, 0188fQP<@ 0!e{0<8 <.ꅁ`<N,0@188JQP<$ <8 K{< 8 0!a@80S1S 800/QP< 0!.{PU `W40040$ph:\`: -LM@P4K 80S   K"p0 0 a0 0S 0S  4@K$ $`K P P 0S "pt @T `PӜ4pK@0PS ̜@ UT $1 1P @$N`40(K  "p (寜PP`P ( f( N  ` N@4pK0S  UM@ T<0 80Q HK:z:H*::Xз: ;(; -L$M@+PPT XppdE @@K$ ᎛D ᴛ8 p 0S1 |+0`CPP, #  p{,P@QPUT@D0 }Pz{`,MN@0 jP,KL;T;i$d;;;;з;; p-0L0S00@T,``0@Wp Pp DA>00\0P-D*8',$ ph pȷ < -L Mp@Sp P 847p, (2(LO@P ᯚQ0Ka( 000 0 2Kp 0S >{ P 2[ p/{l5`P "0S @A0S  p{ @0S0(K0(0 PU00@0 #@00@z tH0s TQ$K <`<з$<(0<ķ H<X<ܷt< <ܻ<< -L M`*:24 PB2 @3rP0"0p P*J`P$30"pP*,0``Sp! `"יpP0*,@P``ٚ0 spPv*@`P"徙pPm*``p(0Sj !岙pP0`*(@P``ച0 NpPQ*@`Pl!噙pP``0p0H:E1=U80 80S ,1 Ay0 !~pPp``+*P U%0  P @`P0 P @`P0  P @`h QpP 5:L P(Kзz<<===$=04=H=h=== p-0LM0@S`* ZKPE*^P * Px%*phP  K@*ۙ PD%*<JK@D>Kpܷ===>><> 0-LMA0S [AKu.0P0040 0R  0RP +Z00@Tl@u[t00S0@ >@ K0&d>طHx>p -LMM<1~K pG`pG@P+PK͘ -Ș0!0x6 p& V !0K @QF t6 l& =8 46 p@ 06S ]0 ; ;KSK?; 0&60&$0&6<0& 0 ,0&0b. Kط> з -LMMA~K pGPpG0`+0Kr -m0Kt6 ,0x6  p1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@ p@ 06S 0 ; ;KSK?; 06&& 0$ 0CSX0&0 060666,0b.0 Kط> з -MLMq`KP @@+@@K -\1V0K,t6  D1d& xF 0Kh6 00+06 k 1f 0 AA+ ˁ0SP00 Q K @@p@ 06S k0 ; ;KSK?; 0&60&$0&6@0& 0 00&0b. Kط> з -(0L 00hз?// -L@`ELPPTpH0S, 4 `,V  ?P Px 0 GS R 2 P 0 < 80p W@x1xt1  018@T R0 Da1 ST0 0X0$0 10p0S A=LP@(P*@ pu( 0@0(@P((6I(@1S 10t`00S LP@,X  u, 0080?0X?`?? ط??? -ࣟL M000I0 0000@0`00 00@P00`p 0& 0S#@P0 0000000@ 000@00 S00`0@0+@TP 0VRh0@90 00 008V!R&K Bu"[04"48#CPK8@0RSD0``00 4S0 8S 0 0 )P0ST0v@00 00 [@1S h1 00 PA00Ku+0P`QP ,0R 00R 0S0T00 00P 40@  %400# 0l0S0  000  000 0,@0 00 0 $Kط@(@N -LM@K+2+K00@40  {/ 0S0S o/xh 0@ 00@TH40 00404 0<,0 _KD@طh@@@J -LM(K*L2H2, (0 b0/S0S*~< @0 <0<0@@ -e1 `<@0 0@P<@@P1Ap0@ ]=0`R<0Se0 ]=0 0O?0@@@c00@<0@@1!0 <0,0(PK`<00@T SP0@<@0X("(04"4 0 t0\@d0 `02X00< c@0<000 < Kط @з//,H 0-`PL@d$0 00 00@%*,0 0@<0@@0h?ط -LM(K*(`K@3,0PPc$3@_0,< 0S0S*00T P 0S 0S*R 12 00< @0 20<0<0@@ Od\2 `<@0 0@P<@@P(R(20@ ]=0R<0S3dP < 0O?0@@@c00@<0@@10S (`K<@00@PU T0@ Q <@ 8K 9(10SS $0 S (0S 00,< 0S0S*0040 0S 0 X P 0"P8#8 $#$h0`0 X04@-@ @b4 0, 0< Kط з@0K 0-t@LPc$0X@ 1S1000&),0$0 @<0@@ 000hط -0L0PP P P!0S |p0 40 0 S H 00 0-$@0 0F 00hط8 0-l0L0P0SS S S@P40h$00@" 0h0طA8 -L 10PU R  00 0 S   00tq`@TUhs1S#P0@dHP ! r0@ZHP  "r0@PHP "tq 00hL00 00@j(,0 0@<0@@hAطh/p/x/ -l1@L0`SpTP Ot]PL pW  lPiO1S400400 0<40`,0P`\p0  + 0S 000000p0 000 00 H(VUi< iO طA8P p-LMI 1 1 K 1@=S=SYGP 00  D1Uq0= K',1Q 0R 0R000 @K0 0S40  0S0S  RP@0S 40` 00db$0 00@',0 0@<0@@mKpԷ̷зط -0L \5}I뤽$A p-LM Ko'1a0@4 0Pbh180SU.TA0S  80S 44650010S 1080S10,$ 0S0S*S.TT0080S x0 00 t00,$ 0S0S* 0 004 Kpطз &tAAASU -L(MtFpPU d+5p@0S P"0T0S0 0CSHXYZ\,A 80P& 808Q 1 0S{Q0000S = 0S  0#S ,K2x00P 0@T 0 FBp` \, KAAзԷط@AA̷Bķ(BDBXB`Bܷz|BB< -P7L|M@7P P_%% G w `FiPC cP dP LP;#qP2 uP&`5 lP2 0&0.0S 000'0&K0pp 0: S t6t+d垐\K_p 0: S 440S `` &Cp5@ 0dSDDeP ;@?&3S }@<0<5p0<@Lp du\ 40Kp>p8h044 DEP\ 0减rDDPQ 4PP$]=00aDDP@ 0P 000P 0 0 4poh h&d%jP\! 0S0D0@$p8 Y (Ȼpp 0SH oKqpuo70\K@0@T-s*Tc@DS00SXod0\ k3pKo4 P( \0SX0S dR2.sp`@-o 62P@vo q@880S  HBpZo,(0K* #P P$pIos0<0 Pp:od`kp] pX  p|Q  phK  vpPD g@<4#08Q 000[l(K褽ܻ@ȷ BܷBзBBBC($Cd@CPT طPC`CtC|CCCCCCCX$DPDtDDD&DDE(ELE`<XEdEls8 -LM␀pP(K` 9P  SC@Pd (0`0 000@0@ ,P ,P oTE -LMp 0 ,K ;PXP; 0P P0pP ,`@0!P @T T00X   R 0SR@ ~ ,PP  ,PP !P;U(K0EE -LMP$@Kp[ BP@|P@ T M ;P% w :P0Pl $`^ R@X Yl ] @4 ;T $ @EEF,F -BMLM`,KL A D4@P P0pP,Pp1@ݍP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hcp ,K 3@P Y,Pߍ@0 S P4 k D$ {4KP 4K @ TP4kj  Pl  P H   P    P  ,K !@P P1pP ;T] ,P P  P0 00Kp P ` P  0KD9KP7 9 [9K00B1  H$ H$ H4Q?' H$0AS,PO H$0AS,P- P D4Q`AL$P@| CKAA -kL4p(K(KķзlJ  JJطJ< -LMPap@K 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T  @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K  0(K!x0K`t0x@tpxPpKP0 V@K iP0K 0 0|0 xp tP  ^p@f(KطзJ p-LM0 0 p@kf` 0K`p\fTPP0<0@ `pLf 0@KpJJз!J -LTMPnpK02 Ѕ p`PP +0S 'ftlP<@K  LSP @kf@0 KKKзlB 4K p-LM(R0 0 @0 K/PHfr1[S1[SjQ @K0 P1f[0  P$fpN0h$ KPfDA $0$0@$: 0S$4 0@(@0!,@0D0D0,`K, (  ױPe0< 0, Q0( <00 Pex0 h峱P`KpзqB@XKtKpBKyBKfB@L(L xgBXL|?wBLvB L -H1LM@Po., N/,# , cj0S9 1 "860 006. 05WS P0 P% 0` ,U@@p@  cPd0` ,U  @pWNY, 0 @ 0·p@طL/7 -L$M`Pp@K2@00B1S^3\ c+, c,|  X  0Kc0pt Wp00d @jpp 0H`p P*P`SU ,KC(KzL -LMpZ@`P & Cp. P!P`0`01:(@T P0  0-K⢸t -0K&p`p P *P` W@:Z  p(K褢L8L -LDM0h PD)7U,EhQ ,yU`  U 5%1 @ pX`Kd@ \ ` 0>p P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3hI 0 ST(38 0T00w0S 2 0WTpWڔR 20 Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0K:b0% "0  4K/b4,<4("4!!<@5 8Kb8,<4("4!!< *Kb"[04"48#8T!@@!8!00$!$S!0'pP$d0`:\Z`P` ςpP`P`dZxY `0忂pP`P`Y)(K&L0DL(M\MMMM8oM0sXG`GMH* - LM, [W0W , S *P0S :\1 TID1HDJ,!100tS  RPa 0 BS a0S00 h7@P G  fa000@PU7@Pt 4  Sa Na0 00 4@0p,0WX:(K0 N0NPNxN -MLM2@F pR~2`LPx$ H0Rt1 10Wl Q^KPE+< LPMM.\P x6S 6S 0  MP 60p@ Dx6S 0S S SP``P`P`P PP` D0 S0PP0``@] 0$Kp VKA$ $4NK@D[@4T KطзPL<PN8RN~p^40P0 0PPP -LM p~^@q귯K&. H~a0( K`p2K1p2 ڂKN1  1@8PK(K Lp Ђ P ,~( K0(K 00 0PK 70K@P <@ 8@KHP D@ p C0S7 ?^'G P@ &.P"p0^P2[S2[S2S2SP o^\u|KKT,P@ @ (K QLзT(QHQdQQ -LMP 00 X0  K0|p;^A KQQ -LpMh0 K 0 ||p^ KԷQQ -d0ML K .0[|p]` KQR -LlM@d0K@ .08|pz]=K̷(RLR -L$M0  h0  $ $K  0|pR] K\RxR -LM K00.T0 0{p1] KRR -L@M pR0 0!5  㬳pj]`@K@ |0 Z`010P ,` h00KPK0p @F] 0K° 0 K ķRзi@R p-L@M` hpP&]PX@K@ |0 0 @0000\H0Kp 01S B@] }KpRзi R p-L M8@K` f|0 |0 (0 pP\L @崨P@s\ HKpзRi S p-LM KP \\l @d`00S  P0S|P00  @T Kp Sз -LM` Ȳp-\`@E_K {20 1KKK0N! P @ 1KAN p @0PK {K1^ 01N, P @ 0@K/Kp0 @@PK {+pP0 SPfu% ࠟ0S @ P00000 g`PV p 0@\_(@P`0 @0OdP(,e0e1 P-L`l 1 @0Q0S 1 00HPolHh` Q4TAT0 QP\00+pPY$00C00S710SL00S. +0P0C00pS 00S700S@p00 PP %`, 0O000(,e<d@DeG-鄠儐Pp0 0S0 0 BS00R \P@`A8H<-D0D@00  R P 8@H p-P@0`00|0L@t0@l0@h0@.'0@0C00S D00S400S ph<p<H<@8D@D -1q00SL2@`0\0 0 P=00C00S&00Sx00S 0P0C00 S d00SdT00S(000   8D<Hd@D -LMP@0 2 uPB ,K J@P xxxrxR{p"PYq 0 PD0S0`00P, 000S SPt PtP eP tPTE^,K `PY 1 ,0Q20 Q@L00) PX00C00S?<10S,10S6 h300C00@S 00S00ST,  R@p0`@ d P P \0{P 00S Pl(Kl,\L$<pfff d@D -LMP0@ T T6pP- 弐0帠S0@0@P`P 0S  0e  0ʕp3PPP0T@l0ft`-0 CR 0R0 S-00 -@0LP`rPew`Z !`0Vhm4`c0SUJ L0SF I0S\\@U`T xsP 0`!Sb/*0S@,0@00US80800US00`zUPX*\00S` lP  U 0@0^S00\P0Sp`fLfXPfTf -XXbXXLp@0S 00CS00PӤ0QžPuJ  Q20 Q@L00( Ph 00C00S`10S[10SW T0d0C00@S L!0SF<0S0 S0!00 Up!00000 +0S0#3 PP 0S0`00p 0S0`00W @|W00 00 0 @0 ppL\<d@Dtxflfl -3LM, 0 0 SP`UAGP, d3P, T00U@C@0 U`l00h'pP 0`0C00pS 20S20SFb2 P0 0@E0R㘂  C@DpP "000S S pNL2`V30 VP\00)'P$:00C00Sw10Su10Sn  k0!0C00PS !0S_!0Sx1 dPWAP 0 0@FR0 @D C  R4@0 RP\00&pP000C00S%00S#00S 0P0C00pS X00SH00S,000,0`(Kl(<,@D\fd p-L`P@ P pP@T*pf -LP{p` C P  |@0UPh0S \0S@ Pp `0U0U0S|tP -LP!\@`P@ pP0!ShP H7<0<80P ,V0fff4,z -@@S@L`p20#pW%0 W@L00% PL00C00_00C00@S "0S70S0 R0 C"000S 00CS00Ӥ0cx0S0  P 0S0@ P X R3ژA嘡0 RP\00% Pl00C00SMP10S@10SD nA0P0C00 S 10S00S[ X00p 00S0#3 9PP hW d0 00p0 pD0 00H00S @00SWpGpp<LTd@DtfP -L M4 p%ŸP2 0B`00 p60!00P PXP1 P00C00SY10SQt10SP M00C00S  00C00@S "0S0S""0 0Pp0L0 0P:Ax0Sp `~j82 , Q$0 Q@L00 P_00C00B00C00@S !0SJ0S 0P0p,00Cs,0 @00p 0 SX R3A(a0 RP\00 P00C00S.00S00S% S0P0C00 S |00Sl00SP0X@ GL0 p000%S!Slh<l@DhfL`gd -"LM00 S2 100 r 0 R R$K!P` 0!S 00PPXp1$ V\1$0 SHU< Q20A0q0[000`PA00C00S100S|00S(  0P0C00`S 00Sg00Sh0H0$0 $ 00$  Q000lDtghgp<td@D -0LMP@( pX 0@T@@T@ET P`P ` 0S  0#  0p削P  0T@|tg -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S  q1@s^T-T`Pt 0^T-T00PS@  Y1@s 9S6 .TPP00S. /TBPP) 0T00S 00000PPS 0;T0 0 0\ P00wPP U(00S(PDl|dgxe -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 pd`l -Lϟ @ t 000 Tpo iT  &WT HT ET !T =Tg TGTbQTt VT^ PT@eT cTI |aT gTP rT mT kT9 dpT UnTvT< tT /xT U:zTPD0 nR pR lR 0P0P00PP =  Q _0>0S x>0h>lPzP0 nR pR lR 0P0P00PP 8=  Q 4=0S ==bPP==8PFP0 nR pR lR 0P0P00PP h<  Q <0S <<.P,0 0SS0<0S <0S/ x<0S r ;000 7@P P0 nR pR lR 0P0P00PP 8;  Q ;P= PDPP0S!SP +r0 nR pR lR 0P0P00PP <6  Q /PTRpqW QWP|6 P60 r 6000u`P8 60S6 R6 6  7P&0 nR pR lR 0P0P00PP t7  Q 0S0!S+ua0S0S`7WT7 70RP8((0P00 0S $80SqWPP80S^0 nR pR lR00P 8  Q I 8 8 P010C0S  { I1@s, nP004 0 nR pR lR 0000P 9  Q Y9)00Q0 mP0 nR pR lR 0P0P00PQ @:  Q .\:h 0SL:t:幊M:0SPEP0 nR pR lR 0P0P00PQ :  Q   \;(;j4;0S@ يH; P; P h; PP P -LtM ` `XeX5XXXXuXU@sP xP pP00 @ J!0 Xy$np0 10 00b0 0S 000-S 0@S@ʜ000 00C0 #tTP@KP0: S  0X  0r#P d@P  G2#000S 000S 0PP30S 000!S 0+D_0S 0 000S 20SrrRbT0S ܒܢ"P  !PB-"0S& 0"0S"h 020S  h2Rd`2 0;H20S@"0`000"0@0+ "000 S 10S!@0`00@00@P @P  @Pt t6 t"0 S 5 d00Sd 0R0 0"Wh4h@8eh8HLhhHLhtg0|pXhzhpL\f0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P  0 Sl`0S S<1D0 pcQ4,Q,0 Q@L00P.00C00S000S!00S' 0@0C00S 00S |00S\@DP = L0 0`S  0olhi<d@Dt p- L P p P 000 S S@0S pf`Pp0P 00S |0P@pnp\0P@P PJP 8 80ܞPppl0f0iPd( -LMğ dP4 8 <0 0&S:88 30  0gQ0 Q@L00 Pz 00C00@S t#0Sad0S4  0P0P0  0St\SC00S@9S><00CS:8 2, 2 0gQ0 Q@L00 P4 0x0C00@S \"0SL0S4  0P0P,  0S.1pW%0 W@L00 P00C00700C00@S h!0SX0So 00P!40 0cSD  R3@p0 R`l00a Pr00C00S"00S00S =0`0C00 S T00SD00S* 0 00P(K<@Dd -LM  @$" (2 P  dt0S  0t@oK  0 B ~P$" Tb  ," (2S  S <#pW0 W@L00 P< 0ß0C00@S |0S3l#0SDß0S 0+ 1; K 0P 9"rX%0 X@L00 P00C00V0Ÿ0C00@S h0SX"0S0Ÿ0S 0 :K`0S 2S ,\    ?K7~Pi  "堑0pf 0 Q2 3xAp0 QP\00R PPc00C00SD(10S10S; .80P0C00 S 00S00SW "1 $ 4p00S 0vT@ {: Lu:Q"(Kt<@DdDi -L M0P0C0 4 , 0T000 400pPaD 0P[0`00pPC`P UPA  ]PP$1  B 0S<10S 10S3 0V00C00S  0S0S P,00,0 p@0d 0b, RYPT  P(K`<@Dg -8L0  0%Sz0 SvC 0Sk  Q30 Q@L00E PV00C0@T20S20S !0T0C00@S <"0S{,0S 0  Q` 0S-`F.\Q(0 S0 ` !0S0S0`00 ꄡAP t000S SPI(qPQ$`00 S R4 A0 RP\00pP%00C00S&00S00S 0P0C00pS \00SL00S$ L0`00l`h d@DppL\< -@p@@0LP` U0@ P0 R00R00 10B0S ~1@s @r@ gR0000lg -`吀L p Q0@P @ T00Cs0,0 (0000 0| -2LM0s22080  20s B0St2  h"0`0 @0A0 S688`888 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L(1 ( @Bp4`K07# @D0 0C0n##0 C0?^NPnʴ00S |00C0@h0  \0T800 `00SP00S b(K|`iX<p@D -PpL0` Sd0 0;@P 0 P 0 5$@ 0 5$:0 % 00(E @@dMЍ; -/L@P0S @P :0/S @P:0/S -LpM  Pp  40CSt<<X<<<X<<<X<@8 +P/ <0S P$ 0lcXP0$ `h D3/Q@ 0T/S/00(0a0S ᧢"0000Kp4S :S0: S0S HP0S H0dwH0 S 0S 0S 0 崚H00: S / h0: S 0: S  H: S  S<  S S  SC  SF*q32D!0S t0Sh  サ60S ˁP/(!0: S' !0= 0S q3 0S q3 Q -Q P p ᝸PP 0S P U(K$|Ipi@ii(<i8 -LM`,_2(0$#$Sp@1 04RP" LP PP HP*iP fP$pP2@ rP p! 0p1  pA p" 00@ 00L"@8"p,2P@eT20Sp 10S!00p 10S 1SpZ 0p1D㥂1a ᠂Q@+$W P !#h%ۖ+W\P 0. 00 00000K⤻p@0S  0: S$ Y6t00S00S !  K₻K1: S<00S800S  z4(,@<jjTj08j8 0-,@,PL(   jj -0 L8屾P 0S 同k p-LM 0PK*"* 0 ,@`Q$K c\0PPP @8ePV  qPP b0S NP0<0VԀc 0PP 8PD0V0XxcPX 0kPP 20-SX0S $PKp(kd&G TO P( ID 0 00000 >%P;0075\+O P 3H( 5.:㒏0E,p 00.S.0@0K`8,0 , g bO0,0 0 0 0G000 AP%000)P P D(5Pp@P5@X<P 4@0H8S 40TS4T 0HST 00 RÄš$0s400s030 pP CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;bbbbbdbbb0bt30S峑 㶬0S.lP,  @KOP @KX,#0N P *XH屳PH00: S j/ JH00: S S0S2P" 8XH0S l"0SP l(H8S)0S H+N!0S  +P10SPJ @pK !0pbN P: <V`<P!0S |0SD10S  H0|\0t10  P8 P P`0S00S 0S %P 0StV`WPP`00S 뤽x|lxxVxkxH*dx@xt`xplTyhDyxfhy$yzyyyyzU\Uz 0-D0LS@ 0PU8PHP)OPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 (lH@L@ -鈁LMPpH,  F@T @ )PD p` pn 00;P'  gIp:0P [ 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 8WԀpЀT@H@P@L@ -`QL MH p0rSwS ?R@@T Wј00}nPw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P TH0090埘` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < M 08 0X  DK$p  05P  KP  0(P(KX@H@P@T@dzL@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DJ00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^PlPJd@LJV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  I@IP[ -PpL 0눀H`$HI%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S*l` -0L0S` -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #` 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp蔒0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p 'LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4'4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b r' (0,00 0e0`U`1`!  c'PU 4e \'(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub'(0,0e ',P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗~||||||||~<H~Ă\,XćX@|~~~< y< !  ;< 0S  0  Z  0RJv`V0'gFP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 SȀ 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  H%@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(Kxl^l8lG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝuts\sdz 0`u(MЍs -0LP00S x0xP pp00l h0hH0P DT00P<00S0  4xz{({X{ -L M0@S ^P  K0 R0~Kd 0-L M0@SP >P K0~ R U0 ^ K0T -L@Mp` W6@9CP@`L P H W0x&oS0000d&gS0000P&mS0000<&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- P@ L@ p50S h`V1@B@0TS0F0H@ `(%SpP5` 0bSP0SH00 HQҁYX00HD D0 4PU5 080 000C0S004K 8t@0SH8 ;400S( < X @ 0@ o8K0K, K"P 8 ;0<0 ,00X @ ,0 \3@T/ @000C0Sč4KP tPP"00幍0S \ 400S 0< TP X0 @ 4rP\ < XP + W20S P:A`P@.A@P <  p0@ <0  `< @ < @   q`P  p d mt40C S*괙,,ܙ,,,,P0S Ξ 0SN 卪p 0S  t優?HQd R:Z <0S00D0 0S X0PSTH0\q D0c 0S D0c0@ <0P LQ X RH00 X0c0,  D01P pvpϡ@P0S Hᇞz{{{{<8MЍ -0L 뤽{ -0xbLDMPp@,0 gP uP@00,0 0S $"ׯp20iST`P,K!'`P  ݽP h0S UF P ? (K1D P l7@PU0 lAPD/lKᓁP0('X  p AvPP偩P  'V v@[T p #P P l p}@@P 0SX@X 0c D@8|@|T|x||TdE|`|L(8MЍp@-`0@S8 <0S9\6 00S0C;ౣ;00 0K<080 0$0 0@ HP D` @0 <@  K -gMLMQpP`P7RQV0U00RQ D lKs>7D0 0LP H` <0 ,KTp P 0 {X7P0\L7P87@0@0  Q 7P0 0@4;D$+4 0 0 0@4;D$+4 00lK fK@ 0@d)5@6pP86\eVP Q|pyYw Xt5V1(0S  0j1t p00 0c  a 8-  & Z x50\%p5R1( 01( 01!ppt ,50\%$5RF1(@1VfpPt`40\%04R00O0 @00O0@40\%04Rh04h0 4Po@00@\4X4\eVf 01(0/ & 01p@0F V PP` `VxV tf  U3fVP`P`0@P QP0 3Q  85@0L 0 0S_KD,000 0`Sp,#0 @\00 0U \:0 0\%2|& RxF1(0PoV f xf1p & t&Rx6 ST2|FTP`P`0@P QP0 2|V@U  850L 0 iK0PS fKAA 10S fgl)P 0 0lKT OH10\%@1Rxf1( 1( x!1p0p0t@00\%0Rx6!0(0xF0!@p0t@00\%00R00SO0 @00SO0@p00\%0d0Rh04Ch0 4PQo0@0@$008 ((K<Tw`(w4w -L,P`0O=0pS000000 aR8#80 @0c 0 '0p00 / 0-,P0 L@ P 0 00 k'0 00 p-8LPChN0@S  0O P@ph  0S0 R0 0 : S0QP f*f0S00S V cl0S`qfH00SLt(P00f0php `\'P <3 ß0#@P0"0 PY@0,0K2D0 T` Pp /&lKA&&0TŸ0D2&0S \{F~KpGL2pG0p@P 0FKH`GH @ PG 0 0f@PV 0Q# 0$@P`4e %p$0R0C0= `A   x4st| @00000%0 00 "x$rt4s xt$dxt%000400S ۏ(KDww`8Twwwwwwx#0OQPDX D L3( RZD(RW1A@8 K `vp0CXh Tx 0Cp`0( P8 zB0\œ\00 S 0 0 R \00O008(LRLHL8 0C 0PLH@0S00ZY 03 LP@0, 00YP{X P#L00\%0R0 0S @0 @0 0S @0@4^00 0  XT(0(p 0( `08DHS000(K蘸tTX{`8\|{{{ -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JKK,JKFK0 J?K45 0B?4FoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T 408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0dL`DcP/0\%00RP%O0 @PEO0@C]Ÿ0 P0%(0/p@0S ( D050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2R< (8 pt20\%2R(00s03t0p  0S p00<00820\%@2Rp 20\%2Rt10K0\%1R00d0X010\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0+F60p(Kd@ĀU T -L MW @RS z 60S 0Sop P60SqFp c00Fp c000 ST6@P6 H6HYP4&Z0$Z1(60S 50S 60S ?ZJE0S Z 0SZ b 0SZ , 0SY  O080B R OT dR b \ 0#K`P``0H`"d0B !} 0/R0O?0@l&@@c0 0 0㉷B K2@[Y<40S 0;0 @d4 Q PLEY30ST 30,OPso/1"p@0@_004@-p8/3`"<KP@  h Y$C0S TYY@@T ?0C0S $XX@T 02@@2@2@20S lR@004 020S- <" 0S&P`PY`/1"@ 0Od ?A 0ZPap ,0 X1倁0qSl1  `1@01@0 ,0TQ@@0@Lp1P10S+ 00SLX 410S00S(X-P K⬟P " (0K dP $00SX (K`KH||\@|||D8}4}X}x}}}P 0h| ~ċ|P~~<@~~`x~ p-L@M P`Kx0S 0S  x{ -L`pᡓD"DDDRD0@0[dS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 00" 0 1P(xt!00!000X >0SD1 80W 000000001 ʜp00PwP@ew00SwwTQ  0e@DTPl0P@X`8|<Hx\|p|ȁ (ZK JD -L M`4 pP,  0l"`Ud"0@0@Q P 0,20SM W0 }4 0 u,0S  ~P0 a!0 0S1 0 @010M0x!`p1l0 @R Q @e 10S BW 0 : P c@P000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(K̄~`P|88zD -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@*͟p 1>0 2 P0 `XWD lK,,>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0O0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  LAP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 P!Xl P0S 0 $ R(p4` P   P0S 00   P   4,)0\5S ,  6009I000PO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@4P  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?ቿQpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1p(T ^ @@|`@t(P1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S P XV T3PDD <$00  RDDc0\5S 00   0S 0 00  e 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S SP. Rb(r0\5S\0h0\0K0@ `  O00P@  E @ 1 Ÿ0\5S ,0@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 0 0MT UJ  `P1 _ tPdT`8U 8TL{@H\t8z|\Ă@<0U pT唠! i (L00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`(PKp -LDMl@KD F(0 0p 0 0,0K0D0 $ U0TD`P T@ PP M0lKS  0@P0 g0Rp0,0Z@P0 (KD<P p-D0 ML08, `L0$ 0`'PKp -LM4 萟, . Y,0PP0,0 0S \  p@0U PUT0 R 0S  0`pHX0,0 ,(K|@-0 ,,0PQQ0P0 -UML M00CS@hlTT PP% @ <P 0P/  P ş 0PQ c Pe\0:0090?aJ [tU pE l5l`K⺊D (' 0K1bt5 V>K0C0Cx5 $5A| %5 0,0K5D0 [oK000p00 0S S$< 0-;;S< @00 x0k0S <0ttx% 0 <0\Tx% 0p LD0SDNQ 0?0?0 00SLP0 \5 S0@0 @0@0@,&0\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XT: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  O00C0P ?00090@!0C0@0 @$P0PFtX:0 P00a0 @ 0S0S P0@0PU:F(Kxp0S:  0S 0S @00T RX  0:0D 0@, 0@P`HX,DP -LHMl@KD T"1! 0,0K1pD0 j0!Pop [VSUQTP P` ] 00CS? pO Q  A 40S 0S00M R# @ 0\5S00  00S     0|0@P`d@p 00Xp40 ,0W 0 (K<(|Kp0(HCHHK \1!X>0S`XKPayX0S$5S(N0S %0S P  K0P! $5 KPXQZ$UUȭUTURʴQQ$PE``0P3  BaB00B $"11000 0S 8 $U.M0S P& 0S  $QPEP`0\3  BQ@5 B0$   B110L 000< K P!Lq QV0hK  B0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S(K L0XKL!OL8<KHS."KL` `XKTa`P`KLV` U8K=CHK\AhK0 0ta `,00CVKD!Xa$5S8p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  0S\08Kl!L5XKsGCLQ0aXKtO a3 Po 00CSl```l000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*8l  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%P MK P0 0KPP K\ [(K\p!P K P HKp!\I2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KLL/1 KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKag<`(4w0H\TpX)TL@8ЄU d<K\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KLL/1 KH!"@(K-B0@ @0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl!P K P HK\AQ0SK\\00S\08Kl! 2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% P MKb P 2 @@ (K -,0LM 0 0P400 0 840080, -LOP  RQ-L@ _P=Є P-L P 0-/LPV@P000+0 /00$+p+l0 p-LlM/`7@P K⊁P0: S 0PrS@ @Kp p-`PL@P00S 0 R FFCV \00S qH0H R 8F,F(0(Fp048Hj --LM0 0  --LM0 0 K --LM0 0 K -L@uh hN -41LQM pK  P@`KF8`P10: S 0R 000(YK@ڀPd1: Sp l(FVPP S00S )@ꃌP U@ K,`,<L --LM0 0 ! 9 -T L@H>HP4T gS`edAl -L M`P<@P 0Ta0C0S0T00C SdMT00@ Sa>A, , , R R3#!5 ", P 00C   :4,  Q0 0C#0 0 004800000,0 0 B4 0(PT| ,(P0@@T0p`?!O8<0040(0, 40(08 40 ?400000 000R ʤ |`0B000@8@0DPp0,0 @@0 ?0E ? ,d d00d0V`$@QPU`0P3  BB00B %"11000 0S Rڬ0 0 0(K蜅|Hd P-L@ ,00S Dh]`Hj -5LM Rppp= h5huPoʠ 0 @PD0(\%$5RR1 T04Poğ4ʠ 0 P(4 \5 S S ST  S 3S3S |ğ @p?t0 T4*` ,P@ڴQ0\%4R  S0@Sh` VŴ0 0B RR40AQR00QT30S0 @ O0TS¯0  y 0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S  D`!1@h00p`P   \0PaAC@T4:010\%R& 0O044D $0O84 K-cP ,@0e  CM0: S t,lt@PL@>0S ,<C,+P$B> R0s=P = 0S= l B=0S 'n -0@}崍=P` ` `  0 S P\ = P(0@-<0P @a$]0S<@T{<_.K B B,Pr Pn |l00P 54 S0 5S6 @Tlp@5O,505 ï @% p P5PW5U ˟˟+˟; [B&; @;0S|; 0MBh;00 T(+ ;R  0Sp  h+84B0S$ BP9 y00 Hq H0TI0 bH 0S "B0S &PD9 0y04 Lq ,0H4 bL 0Sd B0SX P8 00 PR $ @px0F+@P0SA0SP\8 L04 TR @w4)+@T0SxA0SlP7 w,5SLHDSQR 0XG0U4e0SA0SPL7 8g0\%(7Rx@<@Q 0V(E0SdA0SXP6 V H08<%0OQR 40`FH/8<%0ScA0SgPH6 4V L00OQR h0EL/@D%0SL@A0S@DP5 5$pQ@PU``0\3  BaB00B %"M011000L O 0  @_TU2 %4$@QPU``0^3  Ba@5 B0%   B110L 00TD00S@0SPL$0 0<$ 0444\%0Rx DCQ d0Sx@0SX@0SLP3 3X4\%0RtA AQ c80PSt@0S@0SPH3 8C 0S 830S3h 2R@L L3S  t /80HLd 0OLSH0P 0h\P P _P F"@0F 00p`X42P` 0O?@00@@0!@ 0O?0@@@c0P@u2P 0 0,k1P0,$ 0?RQ*1QA  N1P E|1Pl?X`0P05000N\d|`0DxILXć(}`||8H\ xІ$Hl؇HTtĈT08zh@LHP ܉8(K p-LBM5a0`0S# CNK@DP |fAPPl08 `04 00 0,0 (@ D0$ 0 08K 0 `H a`Kp<Pj@\+ - L0S:0S* d`00 @_ 0ứ@0ap 0 Ἡ0`P0@H -L`@sT^^`@ -LMANK< Yb AK0  ^KxD -LDMRP`@ S W0X00  10S 0S 0S h  RP1@@lKD M000 0U,@K3V. LP H` 1D0 0<0 Tp P LlK" 0L@K0D0 T@ PP Lp H < 8@00@ S2,@ @P @ P 00S>@ P,0H0PwD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S1 0  p?8P0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\Y8K@ K 8 4 40W8@V (KdU P -0Lp@P` d 0S0S @ T @ 0 @Tpw 0X L000 0 0000 @  @TG-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80PLT}x}p@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P  00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P  00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ$ - @LpP  P  P P  P  P  0 $0 000, R\0 ` 0  0:0 -@L2P ., P ($&h# 0-L@0PP HP~P@@ P~P0蜊 -\0LM@(0K( 0 @ K$ K0 P K$Kd -0L@P  hz --40LM K 0   K蠊 -`0LM00 0@0 K P @Y Kd -t0LM $0K 0  $  K K0P $0@zY Kd -0LM0S P bYX@0 @00P OYdЊ -LM  K K0K p@.Y dK 0-LM 0PS    KK0p @ Yc0 >K00 -L@}63LLh 0S00 -p-LM@0`P0 RXP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ } 00 0SK0 --LM0 0 嘡덡 K p-PLP` 夾 0pi uP@吾@p0S Pㇾ兠P@ PpXP@$0 s @ppTC| - 0LP`p, 0S) 0S& 0P 00p@xt 0pdPP@ V0,0,0(`@,@(`@B@C\ -T1L000,Q,p5@p 0`g P0 ,@T"0 0R0 0Dp 0 0S 000EP 20009 {~VPPTV@000& ,@T\ԋ| 0-|0L@0S,@TH0@<PP 0MP@NVP P"V0\ --LM0 0 冠{2K K -LM@p`PK! |P4$0u$0  K,H -LM@㈠0pP0K[Mpt Pp`lP Uh ,"?0!K ^P 0?`\0?!0[ 1S000SU% 0 ?@!k7pP&W0S "W0S W0S ,A,>2 ,A,>>JX W WQPKJ 0S fJ0 (K(0 0Uu0 ,EJ` KxЌ p-`L0S+ @P(  r0P00 (0, S , , R(0(0phJp00 pџ php\ -L}J0@000,@T p`PpV0S P  {p0StV0 SpV0 S @ T \x-,z|` 0-0L0S P. 0 @0 PU0sh0   0j ,@TZ{p ^@0S 0\ -L@ETI_6p$ pxI(< -X2L$M0  D2$ ,0 (@  $K,K0pU0-SD1@0000G,@TI!Hvp/ Cp`+ P#8@K  P 4` 0` 8P 匯 ሯP <0!$14`au,$!1RI Kz 0 @p`P#40S 0:0pU0S P  zp0SU0 SU0@ S TP0K{Kh\x-,z--`L` -L$MpP*0@K 0 P ,p (p 0P  #10aS1 @0 8 <` 4p Q@Ks |Hw PK h\P!h LzPH2 Czp@ FTU0S  0S' ]gQ 00S0$0 $@Km\ |p G"4 H0ppp Q00 SK--`Lȍ@x-z -LMCnKЁ+~K+wPÔ#PP(K 0@K(P  tt0p ,P 婛sX<0 ,P s<(>H=u yP 00p$`K yp@ T{T0S $0[S0S p@T$00 SXTGG@0  K$L-|܎<` -LDMP<P D @BBJP ,$'\ `yPw壛P q fV@ sV@ ǵq@ !5wp`10SW  1 P 0 P0P  P8 (@K `$ ` 0 p , $(p`0P 8@K  4P 0P 8` { w;;;00>x꬏-Џ (kjle fMЍ 8 200 "P: -LM@pPg 4y`P 0S nS0oS` =PP00 @>P @Q  0U0P P00 00 X 0000X  FU 0 .S00 ,Kჱ, ?R0S@pS0"S4 0F@P -LMp`P@( P(K,Kة  0mP(0S$K -000 0LS      < --LM00 @h.P 80 㶛 巛묛EI뤽 p-\0L0`SP@8 ,2P<php(gd 0-t L@h2P\PP P 000@P 4,q<$@0hedA,(  -MLM0@<0 8@ =P = = = EP |ˬ =t* P-] p4`Kh* dz -N0@&S:ꈆ؊؊؊<؊؊؊؊؊؊؊؊؊؊؊؊؊L؊ԇTԈ؊؊؊؊T؊܉؊l< +0 `40S<0t:  .t L\p RQ`<@0@0 L  @< 8 `嶌4 <R 1 `妌4 ;R  1 `唌4 ;R 8 `儌4 d;RX 1 `t4 ,;R 1 `d4 :R o1 `T4 :R _c0 `D4 :Rx O0S \\*TF@PP@ @000:,P*:1  o-xɟ00)<Kp 80S<0S [ 0s 0d  0SpxP 0d h*@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0- 0Nj 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C   R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10sE00!0S00S00#1ѣ10L@Kp:  x* `00S  KP |*p8,00Sp 6 x 6뤽 4L@ll,tx ܒp $@$`||8ГDx$ n<$@H \,P|̔,80@S̔000 10B 0# 0 10Dx80@StT<0000 10B 0# 0 10Dꐕ -L80LS$4\\\\0S01S 00  00 #A10 #1 0S D訕 -0LPA@`|  `   0BOpcP VB?㖃! p     -LMp`Q pD4K iP00SDDT[0 P7P 0$ @ -LMp|`Q D@X4 ibTP8D0 P'P 0" < -LMxe@D lUd  0 L5QD60S 0@p4 00 C@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 RlC 4 0 @4@84 `R`0_P 4K謥 ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d 0 0G4K(K84U @Dl - L0R  P?l -2LM00 S8 4 ʺ0l0 P2R@ d  0= 2P)? 00C 08P4`\\0`"1>\\0?0 80(R0! @ d b2 0; 0@4D1 00C04P ,0OT8`S8 K ~?0O,0 (@ 8K 0ዔ0 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Ksx `?f` d 0 0@P0 0S 08Kx ?Y00 08Kx ?N00,$000 (00$Kkhl84U D -LMK@P,'0 K`0@ P A P @ P p w 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 004 0 KA8 -LM@PpGK,`$1@ 0 A SA  9 K00` 0  0K -p Kw ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK Al8 -:L0MP0OH0 D@ P `HL` ȟH08dP0L@ 唣#P80f \0, 00 40@,, 9I0 40 (XK0PP9 000P P 0 0 `t0 x0 0Sx0x <0@V@pU@PK`0j080S.ʤ8P ,0@0CX00+! 0\ȟ0 00@00t0x 0T0 T0 1X0 X0 0\07 0\0Gǟ0 \00B`0 `00Bdd 0R%ØŖ=˸ 0P0P 0lGP P Q\0ςQ\0?00 20  0^0C 0nik&6PF08 S`0O@ 7f  v0000SI 儆0dƟST0T@@0d0H00`<0S 0d  %XP@PdP55pPZd@`00P 000HE0800`Y,U,08@P( 0` E!400400,p80P0` ,,\`0\`0?0 0 2 0 , $00$0,\,c0tS`0O@ _@D 0000SI D0cST0T@@0sd000`0 S ß0ds XP@PdgP5XpPZd@@`<0Q0P 3J000080"2P8 0SX h!40Ÿ0@40 Q`0 Q`0?00 20 $00$0 0X84@P`0„0R$b00@  TJXh00 x0`pWp@ 0\5Sl@PlpGW0H0HO DP@,00 ß @d  Ἷ(a!0 > 10S70܀80P)0p@pl@`x0W0HOH DpP,0 /0Od 势00 0 080P0x `RU(K8D4U lT -LM  pኰ@<P ヰ,;P4K;0S ;RQ:G 00夞d: @P0 :p   d;:Qp: `: Sr\ mQ (:  S4Z@ ,0O;ttJ @P@PPjɟ 00T 0L59 0$ : 049 0B90A  ;`0UT T0PD R@: R08R0;Y00 8 04 000cH0 400cL0 H00O85ę(BTTp0ht@Hċ8 lĚD8 ؐY J;400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S#0 0OH4LD ,L=2 000#`1Ps P=LV>00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 400@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<+4P` 4  4d U-0O?`@P$+4 K ФTp !@p4P`g 5P`8, 0u!D @ , DK< K,0K.PTK`P LK<0KQ  P0 @ 5K< 8 p6, 08dP A0`@ @c0 0@` R pQ 0ȐĠ J)F#Z **0Pq970S㑫@P'  *0\%$8R48\5*0H*0P<8(8Q0\5h80S ! |8PP @8ppD K"p [P  P 1 n}PP880@Y0 Di R01:0冫Pl&~ HI V*`b`p㸐K:4K`0S- 0O ,00 /0Od ֹ*P0d PcP@c@t 0 S Kd  9 l @P`phZJ0P,0V0S kK :0S :PX :4K0S P  ?>0 ?0 ;0 4 D0P D 5HK*0`PTH4LDVKd h00 f0 R P000`P pV`0 008P40 x  @@u A@p,< 008#80(K 0-LMAX0@K P0,L 0P< PLU 4,APK080HԚMЍ7 -0L 墘ì뤽 -LP`p' @@P0/S /㻢P@0.S0S .S 0S `V47 p 0S0 PP` -1LMXp ttX'l10SR 0: SN aPJ >A0 SF3`K * [1 RA@c[P.[ 0P/n00S 00CS00@Ӥ0{@@`P0S 00CS00Ӥ0l{@ PpYTyT$KX0TzH*<pL -LM0@P, U`pT` p,  X+P @TPU T -L1M@QPK]PpPQ@0: SI0S H!7M< pP; K>P7 0S  0S 0S0: S @p00#K׎p $3 S`!k3uP Q pD0`P 9ePA(r p4N*7((0  e KX8` -LqlM`KP4n]P$0: S0S6#0S P 0: Smp 0S\YP 0S @0S ,*P@T(KL`P\8 -@2L0S 020S$20S UPPv g40C S0,,, ,,0!)Z( 0S 0SO @$ lB6A0SDH aP> ;Q p8 0S0SH OP, $0BS 0S R H(YP 0S ?0S \t)pX<`pTT@Pw?0S ,Oo QLXT8$\` -L`p  0!P@0dP PP RPiP@ rP fP P0@0@ ]bp0 0bSAX00S 0S ㉶D0U $0EzL\XPT`MЍ -000 0LS    (Л-0 CR 0R0 SzH00 -@RLP 0S D 4TH UF 0@SB 10S<p `(<7H0C3@ R 0S, ,&H0S|H@ l R @0 S0S400S(>h>hHp 0-PL@0S(0hfBQP x_t d\00SP e <G 0H (0hC4p8L - L {Pm @d` om -LM@/h"P0002Pp2 lR dr`XWT2T"PPPfP tP  'ap2 10 bSP PP P 0@SX :=P10S Ya@a,@ {pQl 4  {PP `@a0<S 00K@P =0S 1 0S0'+0S% 3KP ,K  04 P,00S R1040 8K[P @00S df 0Xa=㮨@ZxZptH8$MЍR -0L m㎨뤽 -LlM`p@/(G@Bv r3X0 @P0Wf2P4=KPUP -= P0: S %=0 0X  (K` -LMp`[[h0,0 mP pP,  &"@P (0 $!P!`p001 @R Ԁ@`p)q1 @P0/S ,0S  j P00U00S1P8&`@Pܧz@<D8MЍ -`LV@pPq \V Vf) b[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @Hph -`RLp00@P0@ s0@0S S ;S s0@0S S\ 40gPV@ @D -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp P 0  @T0S04 ; 屡` Vd p-L`@8lP @P 0S0 _T X0 R -P b4 0$ 0S5xp<̝h 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K"@@8ܝ -LBKCM@M @ 50KP T L$ X4 Lt XX:P@, LP8P ?@,PLt ,0S , ,0 r x000,0 R#R ;R Pp0000Pt 00,0<PPL ,tP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r @000,BP, , ,0 rP 000,00S# ,0M00,R @0 S0U,  P 0 SKpl@lx,00S,0  , ,0 r 000000,00S,0  , ,0 r h 000L ,0P$ 0S  0L0P0 L0pL4 ,00S,0  , ,0 r 000,0 ;R  R   ,00S,0  , ,0 r H 000,00\S ,00S,0  , ,0 r 000,00S< d0P`0K00 )k 0eS * e 0`S01:p`   \S0S S@000S0lQP 4K@P0壟N00M,00S,0  , ,0 r t 000,00S  , M PU00E,(p>,@_9 04,00S,0  , ,0 r 000,$  ,00S,0  , ,0 r 4000,0S 0 , K {,00S,0  , ,0 r 000,L, K 0S4 `  0b0 S&01@ 0S 0 P MP | @T0 @, 6, 0,0 0\SSxh ,3P, P] ,0@,0 P< Q<H l 0 0  `84 @4 D4 W8$ 0hS * h 0`S8 01:@[@ @4 P<D$\SQ# RD `@T`FD + \P \  0 S0@B 0T$0S@\T&T\00<Si@$`Hd  S 00`0Sp`P0iH$0, P4 ` 0p40S 4 40 r L00040 gR 9R1R*Rn R;RcipR wR^V`YpWV44K d0@s@l`@0S40 4 40 rTD<000 S XT#%{+40  40 400ST$0T0l TT2@TT@@" p 7$0T$V40PQ40040 sS,0  , ,0 r 000, 0;S|0,0@,@ 0\SS, :n` @Pj+_D PPd0 LP0s 0@T F <000 S 0 0Q^\6,8H\t @T@ $`pxܟ0$Pؠ$dDdh\`'%PU,P  , ,0 r h000,0 ;R0,0 R @ 0`S0  @TP U0 1 11(K p-0`PL剒@P 0S 00CS00 Ӥ0(q6 r ᷃᪑p觑PUpp -0L0S002 nPP 00S 00S  00CS0p 00[6p <00S p30mpTH -LxMD0S 40P40S$4 4X$4 4 倔娤tdTP $0S 00CS0p 00 6p D',Kq,4P0S 3P00 P" 0S  P O/0S P 3P@@@`#00X#0S(30 0  3P 20Sm KSP @50S 5& 0^0: S Ÿ 2SpB00S +  + P, x @~0`"> P, #D% %3+õp@, +  xUP@$O !0S02 !0S0(!1 X1ps`1D!0810p"P" HP1 00#30mmPP 0@H50S C5 0, R 00S S B0 0,  P00 00, zx 000(KTH$xf4LDPpD$tP\j80 -@L 000@D 0-PL @ 0P@000@ -LM0S`p00S; :SiP 000S S,傐"PP 0@4 0lK0 00T2 0DD"DP<< $"0 00001,K@P# Q000 ,0S:噚, a, ),0  RO0#SL0nSt1 G0H00c@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C<0$4/L -T"0PRPLMp`@07fP aP eP EP) nP iP#rP uP!@1@0!S00 1@  0|}ttŨP`!VpT1T0AP 1 n$1Q0S 0 KP2[S0 0S<0000Q @d0S@P|0LP 3T H0娞H@8<@zL0Xht@,@ --LM0@``0 T0DSL0@ D0D0^  c )TwKL04T -L|@P:3 8 -L[@P*3 8 -L@P3s 8 -P@Lp`8 0'P 0'z40 0S0000{S  R, -LP`p/0wS {S& sS'0 p P 0@2( 0p`0 pp P @2 0(NpPU$ -P` PLpKY@W000  0 0 -LMP0Pp`@0S  0@0U l0 l00 T00n0P S  0F$ h(``h̝ -L`zK<<<MP(pG!0 0R R0@P 0|*0Vj P` P0V00S00#3 .jPP d0@ 20S 2] 08 00$ 0(K\DpP$$ -h/LPM@K0t 0T00l 8.00l0Q0Sf l@PM 0 R 00: Rn 0SPPH lp 0$Ο00 @ R000 R8 0SPP( l0QM 0Sm%!%*lp000 R000 R͟ 0Sl0 p3Pll  l0=0C>S񟗲@ X X X X X X h X X X X X X X P X  X X X X X X X X X X X X X X X X   X X , X X D X X  \  < ( X X    X @ [k0S:K 000P 0 0 0l@0 0 lp@ @Hll R00l000S  0SEP@ l`+ 40S> R JP0030` c .:  J  0 0 0  0 l`z 奥0P`p?ʟ0UH 啥P@Vt 000 \T *,'P# T 9$$'IP'ɟ\'@VP L)0h'Pt9 $sP`0VSLI$& &80S00#3 inhPP 8@I00Sb _80S 0S x0  0S & PZ 00 D 0v PvK0Sr,ȟ0f  0S&g0Sd  xP G`0  @ L  0Sg &@Kw0 >  0SB  &>X70SF0S  l @-< 0t3 R0' t@  `4Pt4q P0SPl0Q 00A@p1 峄l@@l@ l`V10S 0S q0  0S /$A 'P(KMЍvc00 0-PLP0@@T 0S <0,H0 S   R000hr0萯 0-@LP@hT@0 0-LPK@P$H 0R0 @@0贯 0P-LphC`q@PG U@@V@贯 -p`L@P lP mP ?PP%p hp01@PP0 ,'P WP` 0"'PP`0=S\Я -TRLML"@g?P 01p@W G`PV 0S 㿄0S G100TPzG0S0P 0 1S0S@T 1MT\PA ppgPPP? P  0+00KKpKU?0K0KR 00φ0@ ;0 , 0咊0Q1 !ᶆK h0@0S  0wU} t3K\`ԯD$T8\ 0-PPL $0$@QhePP0T -LM`P4 0-S1l#00@q( P3000" 7~PP P tP plP sP ?Pp ~PPFP㴢p "fp @ W U 0SWddp`FRU S Hr@(PKiP4~ ( 0BS B( (0"0CS0SF@0S`h1 R Aa[$ R @FTFA000 , PpBnPB,0P, = @UPT,D 0!00KVe`3\ppP(K`&0%SLP  :iP[F(p`k P \+嵿 tGF`P@T`$KtD\d\tP`t,|dh " $ -tpLM@\`P 0@  `—0  `qKt  p-L@q0`0SEP e?P 0PvP31 @R J 0S@@J U00S p$\`< -`䀟L@pPnP ?P lP  pP p zPP `p`l ep01@PP IPPP IPP0S @\@ 0-LM0S@PK H|E >P 0s3 \0@8H -PaPQPPLM@pdP ?P aP tPp;` ` Tep0pQXy y@Pp 000 000P@TY 0@KJyP 000 <000Ay@P(K\(X -$L M 08 , xxx0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #dp00  P +\-\0S0 X3@QX Y 0S 8D < b(Ko80S ,0<0 H @x, Rp`=00S40S+l(l0+Q H0S C,l@0H @0 cd\D@T=`P <2e  1i`Pv3p)ux0 ,Q- @x@P! 0 4 Rkk00+S H R=kt B@0H =  @0 tc\DDTD < >0V0 @D0 xDY00@0  8 R000 Y 0 0/P00 g0 000000+QH ,000D RT0wPUw<(K\(\dP hD -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 |Ɵ{< p& 0 0 P8 4 0DiP/ UP' LP RP ?P#hZPP() fPrP+# lP( pPuP' xP  tP P)P) '  @,8@ 0 40  X0p+p-0E P kcpP@U,@  ,KJfP 8 0@ R 0KAfP 0 1S +R-R0S00Z 070S d.CT400S w y9S,4y0S4 0Z`.SZ (w@ q/ P ` Y0D000  3# 0~ 0,0 PtBP@T P3D08s@ wPV 0 -Y0    ~B\T@T20 H L vx 0 R pV 0j 0P a H R24B0 (B0|B0 xB0tB0 oB0 jB0fB0bB0^B0ZBWB0 * .40S L0!SIB06 h BB\?B-Y0 ᤄP85B0< S.Ba )BW @T@TTX|``<0*{'9P0 `@0 D 6 00Spq(KX\Ա  D|4@DHLPX`dhlpx8вh -L M00X#wSPPL3 UH@pp `0 pP ?P VP vP0`  ap0U0,0 00 S0?0,0 00PS,00,0 4P 00p#40SP u Hv0p03P u  vPP 0 S ,".PV 0BRSsA00CSUx5 5 6 5 4 4 5 V'MV 0|1|ZA40ShUA `<V: PNA0DJA08FA0(AAQ=A;A$V" 0 00 V *A0S00 A tVAA0*`A`Y`0*0 @Te (K萲\8`ȲԲܲ(@H`lh -L$M0`0eS U,pKd4p0S Px ZPps pnS eS ESf 0Sp R\ 0-SY0SV pP eP ?P RP/ nP, sP uP rP%0 ?P,@@P  ?P, @ `p@0 PP <P0000C020q2 0 40 0 40P0<0 8 a<0  cR<K^P\V00 S =  fR) aR 0R \R1 R@\ - *bR cR&rRD $ nRtRH  vRL     @@  00C0S! P\00 @ 0@0 0D0 0H0 0L0 0`V0S 00@T 00 @ 00008880t,08@0S Su``8p@dPnP@`p Uzu$0SvU yu`T  hu(Kx\TD -,1,aPL@p LP PP ?P-PP _p0aV ?0@0S U e@T DPP ]@PP$ٸTl?DQ?U00\ |D -3L,M0CPp`P0 LP PP ?PP` Pp x#G_p`30S\%XA~H L~D Z4~z,3P$ I`V PADj2P PL : ?0S2P0S  @P ` @e|2pTŸP ᝶ ᙶ,"0 @ P0L0 PLP 2 ; 80 4 80 0@0 < ~0K0 @K,pK0 pcP `R< ,0@<c<@@P00SV P># 4>U4 1.*00SD N<0/SP0S d@P<@T dH ;hd<@L U>U \0(K\ܳh`T  ̽D8@|0fP p-PLUhd0 0S @`[{@X{T  @ T %>puGp -p@QL@ mP@LpP@ (!^p001 PR@'@1ST00pS@` T`W　 iV  J[ [[W@ X00 , =$=@\0L< - L0 0S p`@0P 0@P 00s03T0S 0 00S J@ T0 0 0D -LMD@KP[0D0 ?P pP :P  000<= ~]pD0S pp`@@D0T!0S00S 000P(K\xD -LMQp@ 0V`  0 .gl0V< 0 `< 0N^ ,  0g(Kz' -L^MPp@K`oK@GOK=GPp` #0@@@@ L+p0S0LK``oKGcKG@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0bK?BĵP̵Եܵ -LXM@tPK`ሀ'F  0lp 0F 0 0$K H* -pPL@` fP vP ?Ppp [p0aW {P0 [ D;Ply(`@T\ -LM 0 S@p K_P 0S  D1 `@ o^PU0fC10C0 0S000S0D$p 0-4ALM,!PQ[?PB 0AT00  K/^P7 Q1;00 SQ" 000 R 08SQ 0S p0:P000  a0<:0bP:TK0\`D  0-@LM PZ?P0 0AT K]P000 0:00rS0  00C8S@  RPP0S>P0@0@SS8\`8D$ -DSL M@p`?PM SPp#Zp0aV.@W# R:K@=p,` 0  <0 0RL@D`tP@p@N:K]:\X:0H"00P `0 A0SQy Y:w@(3D0 1I@ H0 `gW aW oW uWI@`pW |PlZIPC `@rU@ gU oU XU wU@ xU uU D0H0@0@Y @`PU lP0-W =W +W00,U` \SP 0S0S@e(K\LH|Pt<X`dp p-@L PY?P. 0A`P@] 0S 9 X9 @TpP @@`T 0-S 0S pP<9po0S`p\`t| -`L| @Y?P@ dpZG01 0D0P0S80 40 R@\`Dp -L e0ppx0A P dP0@OP@1,K0!$ ( , ,@$0T :( @`DA A0@$@ ( ,0 ,0@@( ` ,0 PaVP@ K2P00SM@P<0$TPU >@ KD@  0-@ 0PLP 0c0 -LM,@KpPd똀 SP @0T : @`DA 'A0@@0@PS@ udP` $KD -L,M`L P PB 0 40 0 H 40`0T` <0 8 n:P8@ YD  <0  cR <KTN@0S000 P:/00D  D H0 <0 cR<K=N@LH 嬧P 80@ @cP0DAp0hC1a@0 0,0 eP,0ST PRQp D0@ 8` P`@0Z, KP 100S PU80=(KD -RLM p<0 8 f @(S`$M4@K0"00 40 , "" 0PTPU 20 /lnqd2P0 %0`400fC180 < 0 2|@; 18 0 p@00Z 0P P P @80Y d1+ 0 1 80R1 !8!P8 쐟pBP @PAp P X 140 8 4@,0T :p00 @`DA A0@,@ 0 40 400,00 ` 4 <08(KD`x -/L`uHPDp`@P]P@  iR T$  -d1LHM Rp O P@AF <@K lKX0[l0`0 Y@[WP[T`[Sp[\[b?`0 l K0l K0KLK0 `pNKMKZ/0 S0S 0S0 S0S0S@K ǑP $0 :/p(K 0-LPL@ x0S C0Ux  Tp0 p0@TP0P(x R`Up0 Bx p0 -@RLM`PJX `P@TT8`FV000S/SAP pR :@e DA A P1p00WR :x0@e DA P!0@0@ T T 0oTDITP p-Ld`MPK0S d EL@P0S T[x -L M0S, 0@ 0@0R$0 KP1[S S|ࠁ ࠓl 0@pP[n1[S < 0pP[nKPht@t 0-L@PX 0S0S D 0S@ }@0d0 -L ! 44bP, 303 0 h (p t Pp 0 00 D 0-L@PP0@S0 0 8<0 40 ,0(0$0 0000@-p 0P@0^R0>S@?S00 0 @ R00 0  -p0L R`0PpX0`T0@TPT *U@(0  000 -00 LP`p@?  r 0  ^000@S 0@00 @P)U:DD2p -p  L2 20R291@1P10S 1 19a威P@U0c00D0c!S000p1HA jG41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t0T0  HD -\0\ X0LP0/0A00808 Q005 Fh - P P0  0L 0@0R_0DS ꜌ | X 00CH 000@00S (0 R000CRh p-40LP@`0@S 0U p -L - L 0    -LMP@p-0`d K"d@P P00<0P 40 T ,00$0 00 c0BAH P-L@Lhp < 0 00  ^JT?@hCD -$0L  -D@LP`4p0S 0UP*0V  -L@@T* -0L0\ 0@ 0 @ @\ q 0_Q $Q\@ q 0_Q $Q ^*0D 0-0L @P:000P:t0@0hd 0PP1: S0T C:0P(P00Q0T0 -1L1`PQ p1p@llqKPQE r 0_R $RLVr0$r" 0 R00 ӑ UV r 000 R0 r 000 R00Q r 000_R $R @T0%"*0@nDtxCLU -0 LP.000R -0@ LR 00R 00S 0aS!R0S0S0S0 SS CCR00S0S  C -0L  -0L -D0L <00S$0S -D0L <00R$0S` -0L0P 0@ 0 @!@@P Pq 0_Q $Q@P@ Pq 0_Q $Q \*0D -L -0L@J -LD0 <0@ 40,0(0$0@ -Ls -0L0`P:00Ph$P0@t0 p d@X0@tL0 DPD0@@@TDh,H -D0L0S8000,0 (00@H -0L 0 -0L 0B -0LH -0L8 P00$ 0S P0P@ -LMpP` ȀȠ04 <0 8 0 00 , {@@@@4 0 b00e<08 040 00 ,0@ 0<T T(0@(KP 0-0L@0ϠP|0x0 R  BR 00S H0F 0S@Q*0d0 -|p|0L 0SP`:'L@  `8 40 0 0  -L@kP嘀`@Pt0 pp 0 R 3 #P0 0V@ t0T0  0-1L0@Th10SP' ,0D@P R R "R 'R @P R R "R 'R R R "R 'R<P0S0  S S "S 'S P0S S S "S 'SP0S S S "S 'S  B0ST0 P@T T T "T 'T00Z@0H -d0d 0`S00L0L  B P4$0 0 904 0-PLM8 4@0PKK0K!00Cs08 p-L0L@ K<@<`0PP N0QAp0 -tpPlp@LX`d@D0 <0 40,0p p* -pPLQ DP 81 P0S0g 0Q 1 `gP@UH@DtP f ҉0 0 ~0 0 0C0bSZ PP@@T *@@T*D0 D0 P@tr0T p-0L M @0 K0$KK a(K0a `P 0 P$0 `}0AP὿X PU<BPMU'KpЛ d 0-T0L@T8 800TPc@PdXH0@0 p-0L 0R 0R`P0P0 x0 EKml0@d/ 0R  BP 0 p t 40 -p0Lh0Q`0` \0 `0S 80 `0@SZ@d -L -L -D0L <00 R$0S 00 ,00R00S R -P0L H00R 0@0S` -l1L M ``10 l0lp ,K0K(K4K `PY@W(4 50 ,0(PcVP00S@  0,gW(0  X (0000S/S d 0"W00S (4 R X(q$KЛ d -L -L -L -L} -Lu -Lm -Le 0-0L^S@P @/ 5P0 Pe0 -0L0Q @a`pPPW vd0@@0@^SD @DT* 0P 0 H -@0 P00L0p|@`V U PPᆽPPo00Cs0 -L0`p 0 S 0809\- ᫽0P@ 0U LP @T0@TD#P ` 00000@@ @ <~W0@0 P 0Hع --LMM@00  00 RK0N0 0  0 0Q K 0-PLM00 @R 00 |  Rd0 RH0 R80 R$0008Х -8LM | t8  @P X嶼P H屼P<8  4ȟ@0 |0 w 0@q b0@k <0@e0 ` C0@Z c0@T #0@N 0p@H 0\@B 0H@<0 47 =0 @10 ,0 '3p~ [0@ 0@ 0@ h0@  d0@0 p B0\@ L0H@ l00@ >0@0 0 0  0@ *0@0  C0@ f0@ g0t@0 ,0 L ?0<@ ?0(@ 0@0 0 0  .0@ _0@0 { 0@u0 |p0 lk 0\@e0 H`0 8[ A0$@U U0@O u0@I0 D0 ?0 : y0A@3 [0B@+ [0C@# [0@D [0@ O0@  O0@ O0@D O0H`@ [0`FP@ [0P@ O0`@ O0P@ 000@ 10@ 20@0 @ 40@ 50@ 60@ 70@ 80p@ 90X1P;`p@ [0@ [0x@ [0@D [04@}(KH  l  t  L ̧ Х ,  0 $ X , l L P $ ة x ( t x -0L0@Y0 @h 0S N Ih  -0 S00@  0L0Pk hTH -MLMP`Qp| SpB_ Q 0P @TP82@ @TNK @D@D0"?U1`@PP@T!f ^0S1`@S@TN ܹPP0V,A ,1`@ @T ȹP0g.K B B"0S @ P0^K PE@PE^ @T 她P0 0.KH0 B B`9V< K0|H80p < -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,Kn-,04#0hP0(s(3(#P`@@v0c0 B0E0b02 T-0S0 0C02BQ 2\"0 2 a00cCR@00>Kp0CllŸ48 00 4`A-(K4 9pPo0(K s`0xB"C00!00S1 @ PV 4 ۂPUX@T@Z@X00S 0l\ R T0S   XVdP P PT0 000@ t0 `00c@Vo820 -8KR0``00(KH tDH8Hp @T< -LJoK⒞K`F MIM,0Ip0) )1KX\yw%PPM@1@0)9K*KRP00 @T 1U5 S* S W/ 00gW   S09W:0X0 @,P0f)![^R@% 540PX-(KhH Х P p-@L `P4$& 00@ S/@`@P 000$0 0 @ pP< -PLpʷ`P& @eT(* P(R @pᵷP00 T@0gS4` R 0gS:00W CP -LMp `P'UW\@0 S<KZ PT U0U/S0: S SKP1: S  0 SU0U/S 0: S SR  KP1: S/0000@0T :2 @`DA A0@0p2 ` @B@0U/0 bR<P000/S /P 0 1 00@\ @K=P0g   aR;P  e"C! 0 QI000U1 $1P0 0 1 1:0.S 0S* .S0S% 0.S"@P 0@  cRڝ;P  !00C0 X 00!PP X 10H(KD0 -0LM<`,0 ( p B@ ,T @@0 4K$K4 0 $ @0( PhcEQ@e KD -LP`@pP0Q :x0 @`DA A0@0ᠶ @x@0dC1` Ach=D -L$M< 8 P`@0P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S" < <08 +(Ko@0T :1 @`DA [A0@08@ `@JQ 8Pj `p @ DP 0p , H 90S5 0{R,0GHl4 , ( }R,00S,0  ,,R\  @ 8@P`0  D 40D<0  c0 p W(KD -pp`0@Lp*@@PPJ, P0p0mDX@ -LMP HK U   XP?0 /0S 0S0S @O0  00 , 00( 0 `Kpp P  80 4 L   80  cR 8K: Rk < p x l  < 00 \ ]H l T 0 d p 00 C   ; 0$  (00 80 cR8K½9ː0 00S0 p)0-P]E)0@00`Ot͟pW`R 0S*00S&0@T" 0S 00S 0 ,V  00PG`Pp tp3@ K LG`v@|P  | 2l ! 0D` 0   fp p 5@ 0$     80 cR8K/9ː0 0 0S0 )0p00,;0 ?C|0 d@K 0K>1PK]@ 80  cR 8K9000SPp0 P 0 08`4U<  4U Q`[~ [~4U`@@<@TU 5Uhhb 5UA4Ud* 4U~*+4U~*+`1A4U_r 4U_r 4U_r ana.OA4U4U|j4U|jbEA4U  5U M: 5U M:cA4U 4U 4U dqiBxA4U 4U 4U eZXC4U 4U 4U fmrS7` 5U M: 5UI( 5UI( EG;}nDR>J:l_ SV#(m^3 0jLaFN1g@еJI(s2pknr:ih%>2ϕ>sO  q1y=B $T#wYH$=z q3^Sp'+Gx˪>]_$O;}tOF,HH_@Wx_#6Qᕒm &``u9CX㢭E_'>.8鳮Op}'zF`aw` 'ҿiH]93#M]Ӑ⣥c. IMcY]a)?F65!簟~nʔT'8ZW')~n#D3V%e8;-oˣZZȕ[[zv)u&x/m:HςyfJ+yY }s(lfH-hgź<J;B 6qNe2]5g"WC1]i坋װ08 /R_*(_;zؘrfDM,q z vR*Ǟ;?;rcMNnz . ..arch@ catchmod@chgrp@ cpdate@ dd df edhostname|2 ksh sh ln ls mtsha256sha512mkdir@eject@ mv pax tar rmsleep@stty@sync@ ... . ..chown@bioctldhclient|2 disklabel2dmesg@fdisk@fsck@ fsck_ext2fsfsck_ffs|2ifconfig|2init@mknod@mount@ mount_cd9660=i mount_ext2fs=i mount_ffs2 mount_msdos mount_nfs2newfs@ newfs_msdosping@ping6@reboothalt@route@sysctlumount . .. dbإemptyiئ tmpF runtzlist ... ... ...`Vd #V Q@pTM 0SY[P 0@S*S0]SWY: 0@S@0P@T*T)@00Y\9@P@'pɟ00S0Q0S T`  8|)00 [= p  Q0 0 0 0 :S  0  0S   ~ 0 00     @ 000 0S  00R   R 0SQ@V*V#0 #0CS #70S0 0SVY@Vp@@V0@V```  @0p D0 s[LP_ 0@S*S Y0]SV0#0CS # 70S8'P"W#Y@p`0 V :6@e DA A`P@\pWe0S Ɵ0@S@@) %V:\6AA  ^Pap DP 0@@S000 0=S%00 5Xp[@ 0ş 00@ 00s03ş P00S -R=R ?R+R@  0S 0\ş SQP+R QPHQ @0P@ $TP 0  SC0S   00\0 40 0c0ᴐp 0 0 %S #S=S ?S 00?0 0 pA.0 (;P3EU@-P`E  /;P`$`U@*  #;P g `FV*  ;P 1 g 7=@@T@0S0S   R000 @ p40 p !0@P   XZ0Q   0 0 d40 P@Zl@ ձ  HO dtx ĽȽ$pptzDhܳ` 0 0 0 | m$ 40AZ  0 0 P   A  00S0   zQ 0 S  D0\ D0  @ T! R 0S, \      X0S S PH DD@T  * 0S  R0 B  0 B Q Q Rq tA00C 0  |BP q"0t0300L  0  0   R 0S\00 S P$#000 0S L0 00#20#\00Sr Qo 004, ` P@ 40 0c0 6A0 + :@0T :@` DA A 0@00P0@0T :x@` DA A 0@0ኰ0 @a@PP 0 ( 00 , ppu00 0 80 4 0S8 \ `000   0S'\"40ZCPP` @0T :@` DA TA 0@00 P0 pR 0=SC ,S2 !S *S"-\ :\:]P ?P [P}Q ~Q0 {Q 0 0[R0 0    000 00@ {Q @ 00000 < pp > SpP(  0  x0 t x0`0 @ 0 | 0  cRڀKF40`00S0/S T :S000SS@/|P0Sd +S0Sx -S0S4U+X I J0@ `P@ 80 00 @(T@|tCT@  80  cR8K30TS00T@00TSV 0Z00 ` P 0 00 0 0S0000   ) 00 3  1(K 0-x0L M0@P# 0 K 0 0 Q 00`0S0@@K0D` 0-0L M0@P 0 K0 0  - 00`C1@@ S@ @0K0D` -L M0@Sp; P P$ ( :  $ ( (0  (`K(0 PU @(@ 0T :h0$ @`DA A0@ @ $ (0 (,0P$ ` ( @KD p-PLM`@ꊮPT@^0 P3KpP` -@LMp`o@V`1S0PMP0 S ,$ (0K(p $` P {3KP -@ L1 S@8 -LM@0 A@K p-LlMPK@`P@@PsU  : SI  S @PV 0SKp -SL0M@< /0ᥭP < PRD1  000 , 00P080 4 ::ㆭpP4@ЭpW `e80  cR8KS2@ ‹0/  @80  cR8KB2@ ᱋4< |P4 `,  PP PU4,n(KD p-LM @KPlG`  U 00/S 00 (P000G@PKp( p-L@`P0=S\ *SZ +SZ@G pH000 `0p -0L0p@`GPT 0r03X0S  QH 0 0 @ PT D -LpG2/@ͬP@pV  G`P`P 0  P!   @P 0P$RU2PPP  00  U@ a @T00S@ G@P 0 P 000 l0000SM0JH TY  G0@0!00@00 00` 0PP 0T P 5U 0h000 d1R(U\0P 0 P @0 @  '1`(LXD -`LpPF  @0`;000 )JUFv34K0 00P;00G -x0t`00lL p@0PPR>0D00 @80000L \ 0-@LPdF $F@P  0h$0PR000AS ` 0-PLM0( 0 , mAF/$ 0 0 0S  ^ 0S$0 Ph1RdA@j0 D 0SF R=C(100 +E@P  0  *0, R ( 0P( 0 0! P0 0P f9* =p $0@ 04hK04D-Ll@| -0LM  00  P,0 W 0P,K  0 00S  0CB*?0SGH00SF? PPx?  AA4 0 4K?#0S# 400S PS! O I;o 404 0S00:;P400S7400S 400;0 0 0S00S 00S LN@P 0 @ 0 0S 0` K 0 0 0pX` \>$Q `X(#0S\0 

S @d-`0KL P M0HS=t  l (70S 0@KoP~0: S|y/0-S0S\ 08 KPP `0K p,\Lt 80Wu0UW,0S    ,Ge ,PUu\XL +;XX@@ 0+I˟0@ `0SU  YU-  P 0+`0K L@`幉 04X 2X -Z 0S  :R0 6Uh*<000 0 :Z  0S0 x @T 008C80CS񟗥  h H H 4 4  4 h h 4  , 0 < P h  4 0c0\0tY00 0 00 @8 0 @1 DPKC @Z0D0  DO000 000 00S H0 0AL0 0  @e090 60 000 00S  0 !8 K,㨇7 @P 8K 㚇4'0S 0SW,0 @ 0 @ D`KDP  D=TGP@0P0P  D0@0  0P0 0@008K V60 6 000 s0 0 00S00R0#S0z0 <R0 000 Xp30 0<\0 00 0`0 0`K\0 5T0 5P0 5L0 5H0 U080K00S 0 (500054 !@P $00 ~0DS{T~0@ 00 S0N40 40 sO0 0 400S8ꨄ儔p@R_T 00 00#T0S쀟PA f .@0<0 000 @ KP 9`'0T  P㚕% bP0`  0S`)0DtD 0-L$M@8 0 0K, 4 $@ @ @ "0@P  R0505" T40S* "0PK?(0(S'0(0  j(0(S 8 0   [zKK4 8 J"K0D` -0LS@P 00S  `[KP0u @050qK0 050p@ -`Lp@T @P00D 00   (K 9JX @ - QL MP4 O@T``!0DS00ST4!T 00 "T 00s03V$ 00c 0 #T  0$S 0%T 0&0DS4  Q0 0s(40p0C00 `fY @  H@ I R,   5 YY Y 01`0IYSY  0S 0S0 0# 0IS  t    < L \ l   ( \ l   |  8     < L   (  t 0 P 0sq ʟ P 0sp 妟p 0p 0pc 0s 0Rs~ 0Rppx 0Rppr 0Rppl 0Rppf 0Rpp` 0pRp[ 0pW 0p"S 0pO 0S 00 00` P 0p^ 0pSp: 0S 00 00 0`S 0pI 0Spp$ 0SX 0 0 0X 0@0C 00%S zX 00 0 X`@ 0! p,  R 0 p   I H@Y p0IS < 0##4 0S 0C 0 (K -L0 M@0 00K, $00K0-<0<80 0aC!P00? 10H - @Lz 00 -L PT -LMP* 4 倠P0A0PUU T  0Z5!`p P' EP 0@0!pP8 d!0 R E/DA i0 0C0N 0E1`@H̠H0-K HT-0K,K+K*PK)Kf4偠4 ` 050 ~0@P 01Q:H:00 010CQ:4 0 (KHL -LM@ `, E\ @ ! 0TS60Tl20Th.0Td*0T`,@ %TX"0P0U: 0FS 0aC1BVV0bqPP߽,DQ)``, !J@ZH -GMLM3 0S 3 |3|EHpCP d')KJX JD3L-k@PqPW0 ]43PP  0@P0!pp 0S0S 2Dl2P dXx `P@R# # # # # #  0S     0S @P1\NP PEU0SU8  RU2PEU.`<T!0 _1 @-`PbP@g@d #P q ,KP| Bd0 P0P0AD,FX0 H\06DD@0 3(0(K LP  -8@L0S (0}/ }0 @ LH p-0L0S `P P hPP X0@T@@堼D0@ <0 B40 @$0phpH -PPL\0U PpP`0`CAU!bXh@ 岼1P0LH 0-L0LPD0@ P 0dCRB0R00H -LMQP,0 ``pi @gDAU00?PAa,0S cP8P 0gC@T : TH -<0L 400R:PR B| H p-LMPK`@G'P,  1R 1000c00PU QV0xP U xIxV P@x0hP?SX0 b@@0 @k P0$ &xxH(< - @ 0LSp:P`0 S 0B00哻0 0C000吀`Pc@P  P0S@0P\T 0`0DV ,P@(@HX| -d8LM$0 SP HxH`     CgP- 0P>9P2?P eP8nP 2 lP/rP ) sP'PP Q @ b( x   000 `  <3/Z Y'#p00 VaP 0^S   z0@T 0S =pP |6PR&00c  㰀 ZZPY0SZ   P@r XU)&hۜ ؜ 0 00 , Һ004 080 pP8  bRP!P@ z z 0 PpᕜP`g 0  )8K ^00SY)᚜80@  cR8K !P z4`, 垺Q 0 dZZPYYP0S ,Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C d,@a,@ ˛PP0 d S,0S00`V@3@#V@T(H2F/PU@L{ L7z^@@ ),Q00@T`3`#T`V}-p,{A B ARPTPPL 0~.PPx@K P`0,10 0(08`K,0 妹00@080 4 8 @0dS 400c0bS  @8d ,P $@6{ #-  -004`v 4(KP\DT(pxLfH |P<Tp0     $PQ00 -0L`0V`Pp/@@.P,@ p0PP /-f P -$00000?P -@@L x-0 t- p-0   P-L h 0S0S L@P00P00@P 00 -$@L0SP00 -4@ LP0SR00 -,@L0SP00 -@Lh p-L`00L S@$ R!P}PTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0Pp -LlMxKPx0: S K --80LM0S 0 0 z( ' KP -@PL 0P P 0ݙP l0l0h -R  Y*T <@Q R 0$S0 J* 00PHj --LM4@0 0 5( '&KP --LM@DD!*0 00 ($ '&TTK P --80LM0S$ 0 0 ' K4  --0L M 0@0S u0 R)0 h0 ' X'Pd&P0  D00S   0  KLPHj --`0L M P0@0S <0 (0 ' ^'1&P P-L@  HP 0 S ;L -LM@KP@0Ph0PaKl 0-LP@Py0 S U 0L P0-L@P4% UT  0h90P0  RRR00Q QD 0000  R 0S  -LM@K 8@w00 R000 6w 0x -LM K4(w00@  @RKwx -QL\M`p  R<P  (0@003 Q3# V+x p  0V 0-0p0 l 8@hK0S? ? 4@ ?  0"#402 @ ė P'X PhK; 0#40 H@ 㶗 @4"i* 3P00X00S 0 SShK 02 @ 㚗X 80T p0{(x v(X p( X h0[S tUp1p0 b(L!UPD1@\04 0PQ(l  t PX\ 0x P:( X 0S0 -(@T 0t S0S T]l0S `( P(K,t8`(d h-0  0\0\^S  0008 0 Rp00  ` 0 ST 00C0H0H P4 000P00P 0-LM Ku0P@0S 0@|  00CS0<0@TH0@0P 8@T $ Ku8xP4 -1@LP 0= Sw 0mG Ԡ@<0̀ p0`P#@ Q 0  T  0R@QT 0  P L00@4A0PP<Xt -L M"00p@( $K@1  $0S WT2 <0S 0 S R0S S PWz u%^ Q0pq0`9S 0S*+S S %SC-S@?S=1t1PP PTL1 $K$0 S,1 >0SB P71P`8@ aP V` W,@TPUV"e0@P 8gPU W 0 P@T UW 00 Kt -LM`Pp4$ KtV`U (K9@P  $Kt( 0!j20@Wp Wpp,40#00 V  @ Z 00CS0<0U@TP0@0P <4@T$K Yt Kx$ | 0-0 0P0 @L R 0S^ UPR 0SQ\ 0@@<00\, (l0Pz -LM`00002p0嬢SpP0S @ 0020@00U 0P0@`00 8Q X Q  00[ 0010S+ 10S' 0S$ Q1P0p;0QP P@t 0|G 0S0D 00`H1P 0S0S0  Q!S 0S0;0 <0 R 0SPP 020d2,0 0P@ d00S 0S l Od! 0S $00S U /<tP -LM0@K 4 p4Bs4,KPP  9s, 34! R-s@W`8@Ē S2 `R 0 @To!V @W R= 0S1H20S 0 42D 20S" 0 2pP0 1!0K r0 1p@`@t0 0!0000U00 0S6㲽P1W`" 00 10S 1!h00S @PP @Ps 0*0K rs4 h^W@ h00S0p >0i@0K xr(Kx$`h $Lh -LM$PK@p Wr`T`00 0S 0S# P $K  KP 0 S  2r -r RX0!P@ @ $K@ rT0d0KxP$t -LM Krx0P 00 XLK q}@, K@ qx p-8@L`P P #PP@Tp -LM$pK` Pq Kc@P  q 0!@ R 0SUU ᘼP@r (w@$K qKx$-08 00\ $< 0S0ơP -LM@K 4pq00 R000 dqx -LMp0  @7, KOq$`V00@ݰ`0 0000 D0S4  $P0``:x$PU00tH徰PT4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`0#004눣@0@S w눀:JP0#ST ,,K p23 0S 0S 00 (620SX 2 Y0$'33 sTR  D,K pT20S  HBHHb -@DT 20S   10S - -O ᠽ`P  5=1@p!@l1 @@@4. 0dm5+  C1P"彋 PTK0O4K0X8 P4K$"0㮋᷌X@` X'@hlQ!,\(X0"Q TQ`( `( K!P(0!S%  0x!0PK0PK⎌X@PK Xd4PK@hl(R,!\X0 & T(R`80`8  XH`X00SHlQ 0x R[ Bp0x p0\(0" T8S`` P lQ`h(R`(K| P\P Ο0S00 1 P P #Pp000. P\P TΟ0S00 P P00C0x,> $0 0$0=0S     K D0  cRDK p" R} ؍  0 ĉ < \ D  h 0 P=0S \=!Z  $01x P\P ͟0S0@0 @ TTc Ta !TPG00D-T S tV x,0 00Nt L,0 00CKR AK`h, P\P 4̟0S0@0 @T T T T@UYCKC/K0P;0QU 00!S 0(000 0 0< 9[Z9"`6 @+P ,KP  0 ,@pP D0  cRDK p0P  p0S:, ʟ0(i,00 000<0@Z*Z ?Z+Z !ZH* P\P ʟ0S00 (P@ 00 j'Z \ZG "Z' 50 Q0S009 00xɟ X 4K0p2 0000 X4K0\Z `Z $Zz>  P\P ȟ0S0@0 @$T "T  \T `T0  @p   0@0p~D0 cRDK@ pTt  \00p@j$( P\P ǟ0S0P0 P(U3 P\P ǟ0S00 n(P @00T4K0 @00c0000T4K0 000 00" ${U0  `PPp @T\T Ɵ0S00 /@VK꤄ ȅ #T`R D00 `L `I900A[T2,KQP @,@ D0  cRDK P000S%,5 @T\T ş0S00 @L00V 00AP%p P\P D0  cRDKm P@ğ0S00 :P@00 P\P ğ0S00 p%P#P  00 X4K 0 @ PP00T4K 0T4K0000@. 0  Q  @D0  cRDK @#P P\P hß0S0P0 ]P0$00 0   P p   D0 cRDK p 000XPp@00$0000p00 X4KT000000D20S4  0S0 0 BR CC'Z40 HX4K  R" u 000p0C00  <"Z40 HX4K0 0S6 d l d (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0d 000C0@T40 HX4KG02 @pDt8$ D@(Z000 )Z00CS0D P\P x0S00 f)P 40 HX4K 0 @`P@ dO00%000 0p00 " g}Z!40 HX4K  }Z40 HX4K0 2 00p|Z (Z 0@00000 X4KC 0p,`Z 0040 HX4K \Z" P\P P0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 '(Z000d\Z< P\P p0S00 P 0  'Z00 X4K 0 00" 00i"Z 0 0p" _00pZ"Z0 0" R\Z D$ P\P x0S00 e$Z "Z\Z `Z Z 0  [  p0  p))Z  0040 HX4K p|Z 00(Z 0@00000 X4KZp 00 % P\P 0S00 Z P P0 00 D0  cRDKp =KX `"<Z>Z R " @@i Rg`W Vc0S`0&00Z 6V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$L7 P\P 70S00 -P0 0 &PY000 |P00X  S @0000 0@8r7EP[WP008e(Z  Z &Z;Z |ZGh8 P\P 80S00 ] P ;ZȠ1 |Zㆠ. 8&ZK)|Z&PF% "p 0, 0 4,0! 000B01 O1 0 1 P0,` 1cX T 0T 1  cRCKP@`9 P\P 0S0@0 @T0S TT 0`!%0. 1Y T, } 1  cRCKP@  P\P 0S0@0 @ T 1  cRCKmP@( 00C0<+ 0\m:T;0 Gd;0SX; P\P ;0S00 (P㨫w u0@8 `ĠK0ASb  @00P  PU LA  `U000SI " F 2P l  5@P  <R }R<<F 1&  @P 0 ,  0S < 0S ( 0  @000 <08 8= `Y0S (K0 -\1LlMP`@T< 0PUAPg `9:ŁpP0T\S  K%㶁@PPD 0S?㬁@P xK@`PP0: Sh0K 0@  `00PV(K 0-LlMP@PPpd 0T KP0: ST0K 0@  0@ 0@K0 -LlM'xP ` `d PRN0SJ41`PU$2'PA 0Q= 唠KpP1 m`P-0: S)P L0 0hKS0S p0St0S& @l(P mXm%h0K 0@ pPU(KP| 0-,PL@ 0R$ @T0P - 0L@@TD p-l0L@` 0S P 0P@PC@U ߞ `@T00@pD -(@L0 01hD p-L1L@`0S  0R+ 0S P 0QAP U 00S 0S$PU0 0S0 00@CTT 00Px edVP@0-7VI0   phpDPt -P`LpG㎞P@pPX0 P000Q0@D P-@L 00S PP@ P 00S{00SuB:@lpl`P0S 03nT000S00tD -LM< @ <0$ 2   0Q, 00   @0 S 204 80 40S2  2⼥@P1 T&04J40S TT <2 0S <00S,0S< 00<0"< 8 1 R8 1  aQđġp!0S<0<0S0S< < $0$000$040S l1L<<@P5 0S4,0S 0S 000C00 00S h<0 ,0S 0SP <0p@P <0$0  7 40S 0S000S0S80 0$0(K$Dh`,8 0-00P0@L@PP0hD 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1٤@P) P0 =0S < 00 0 0 T4E  1;  40S 00S2  0Q 000, 0 P% 0$( @< 0@ 0S 0 0 0 0 K0DT -/L@k+P@P~P @~P 0~P  z~p3`dlt -LM0S8 8  OKwG/}8(K Kmx8xX@i))<\H P8 D( 4@  PP X@PTsg7 0GP @eP <P$ g%`'7@   | ~P l~P E~P0 DD}P(7  ,',7  7 @6T! P 0P'@PƟƟ@0 @'&#`&0@/SKP|KP 0R 0R 0R 4V 0S 0S6T  $wU@#j%# $P0S0S`Ek#0 0S [&t5P\U ` }X5QT% P5P P#0@ 0S@&#P}P40S6&z}P4 $ư40P@>T0 0@Dp  0pa`P30S 31PS00P `!RI  2V @T3P  00P  3p @\ 3` $ 30s@@b3P 0  ?P ?P @$@$0 0$00000 0KhP1: S|2 0ShBP 0S2 I1@|P "0Fpc0 000Q 01@ 0f0@1 0`p00P 0ShA 0S  0g@T 0]1@T 0  0S S"J%0S  0FPDC":%PV (0  Wx0  l 0S00 C(KX D`(X|`$P|x Pܳ0 `|X $ -@L弼P@[ $ -LM0@0cSz bSz+ PK P 0`R R  C  0R PU  40$Ă,40S,((0 "4S \A KP@D[ /$ T 000  R0000000S t -L4<0<Q808 R` `;0;LD<4 ,@$htP 0-0@pL@`PLy00eWy@P^ 0 0     p-0`@R0 000 LPx0Pf 00 p p-`PL@l0lQ@VPP8` B{  phSpD - L@! P   P -LPpZ j0#Sf@P`@ w`P - @L=Pp``V 0S  f=@P@Pf Dp`V:00@j -LM\p8 < @0 @Ș,14 8 xPPPHxTX` UU0PP``ї `xPUp0 ,p W4 80<@ |0,  0S `0 \0 @pT Z p@04(KoODt` -L 0  P`@p!0 Sm'S ePUpPH0S CTTCH  T@0 @0@0TSU mmt8x  -L@p`P0S)QPU:|Q00V0S U yPP@T:P -pLMP`, G0SC@*T< ?T: [TV:0S 0!RP0S.0 ]S `P) ']TV% X/`! yP Vp|T0V0X0S )T V X*WpG  `P,0U:V P w3P -LM@Q` 010PU40!0R-P00-S Q  0 0, 0 R -P 000#0+P0SPU , e0 -P0 0:U?Upp ,U;U #U ,P yP0:S0?, 0Pz 01  1P? 0k h:P ;P- 00 0R0! R0 0;P :P,000, H 0,1  $1,P 0= T?, :007,P0100+#P- 00`pV 0 0PxPPpPU 0h 00TxP0`P000? , ,(Kz\+`t8|x p-<`LP@1S qxP @%T@p 0 e -PLM8 pR  R< l8< 0Q858 5#4 %4 5 S8 \0S8 ?S *SR[S SMSJ:S0CSE4QM 0SM0!SI , 000 0S0[S0 D[SB0:S?0:S@@`xP 0S *Tf OxP  0S4P P@T  0S  r R0  r 0S0[S0:S 0S0]S= 0S Q  Q Q4[\1 (0S0-S R0]S R  R Q 40Q 400\00S 0 0Sw0]St0 ,0R pW4\ W 8@A< 0P< T@*  P 0W8S`L< 0PGP@   r@p@P < 0P<@  0qV Pl@< T 0WP_   K`PX 0W8SA< 0PNP  8<@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (K` -pP00`Q0L@MS@%wPwT@P0f@@T\PKT0P Ǿvp3 05KD 0-LM@P K 0S  P00 R0Sp008 0-L@PP 08 p-`PPLP v@᫔ Pup -\L(MT2K R 0S %Q$02K00 K D p-LMD`@4 P0^0 ~KphG  -PLM`U0p`QR: UU UR0000` USQ Rj@K$ 㶶l0 BU00R0S80   U 0GS 0 00R0$`|P -LMhT0Sp! P( auvK=0S QP%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  rDK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S l0S x!R D  0Sb ]t1S D  !rD0 D0!0RD(K6 ( 0  LhTd 0-@QLP0 00hj0@-0PSH /S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S At 0 bRP@  6R 00S@/S/00,0YQ 0c0` , 0 bR@, R, 00S@/S/00` t P0 bR@ QY00(K` -LM00lSp@ vpPUP@/T TQ /sP `es`V.T@V .T 0.S  0w/S4 W1@/000 0 bRC@ Q  BKA| ~P@0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@s0 0 0  0 {00 K 0  yP 0Q/0000 `yKD -pPLP0PPPRsp`0V`@X `^D0 DQU 0U $0h `T D 0-0L @ 0  # 0S60[ t$0 0 :Q0a/0 0 0 P  0h 0 -0L Pp 0S0+ E$00j  d0:00  X = SU, @0  d0d0 0 8 @0`d!. 嗨P 0S0 0;0 0T$000  T<000``@ V 0 90 0 0 090 -P Ll X`  R 0PXX@@ _P0 0 d@d0 @T8Np4 T$Qp pp`` !P0S0 0;0剽 00$ `` V @gT  "P 0 0d0    0-@PLP r 0h0 p-LM @P u8 0& 0PKS0 `K B$0P0&P;0S0 0P;000$0 崧P0SpP 0 0C0P x8P -QL0MP T H H D P %PP0pL0 q  R 0 B 0H@PP @H@ .X *X  X #X7 +X -X2 hX- lX# 0X+pGpEpCpA p>|;TT0  D T 2D@TDpaT L@ T L (0lSP @p  pP  pDF00! 0H 00L 0 RF00 <SL0  AD L P @PPPP XP cA0H0S 0c0HT|ΟS񟗦 p p p l ` p p pp{@T  T `T0 T P`oX: dX iXuX xXA pX? (KVV@D@ (KPu`D  0X X0l 0X  P`XuX5 D0S-0+0, 00l)(K1A> `0 @P l 0R0l# (K%2> &B P0` l P Lx0X00@0L@BB(K l YрpL T 43\ X T pX T@0@|?KT@ ?0K?K?K'40#0 P0SL Q`qL `i l= S`fH-P+P P0S X PX0C0 0 0H00IH0 20P00S X :X0C0 0 0H@I@YH@  0xS0S X !X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUH@@H@ PP0H   H H(Ktdx --LM0 0 K 0- L@P u  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0 -0L @; 0Sx0   3 $00/  Tp' 0 :0  (P 0S0 0S0:0 ;0勺0 00$ 0 - L@L2 0Sp 0S 0 0C 0  -P L@ T0pD ` 0S p' 0S V0`!  1P0 00c0S@@ LpW0 X0 dP0 `` -P Lp W`  0S?p 0S @V@@ L0 `d0 dV0 W0;f 0-0L@P  Pw0  00 ,H0 0- 0LS@P 6P 噡 0P 0P 0 0- 0LS@PP 傡PP0 ,  ,0 -L^\Pp`@ET00\*@|0W0,B0BSV@`[p0 F 00p $0(`pp ```D --L4MD@K0B 0 0 7dK -p-`P00PQ0 L4MSP 0L@K0 0 0 PCKp -l`L@pP  㲔PP@ P P@@ U 0S (0S`0< `0``0$ p   <\ -l`LPp@  pPPP P PPP T V` 0[d00\\00@0d00 0,0$ (` p ` P 2|D -@`lL0p.00 0,0< (`0P ᷘ@P T00ӧ2  `FV@,0 Q00 o0D -<0@L  @     D p-LP`@@P`p p- @0`SL0@0@ P p 00P@0T:h0 @`DA ϊ A000 000 0 00 pD@` -H"p0LS82@Q00@A2 P 20 S T1 T1P``BTR5 1/l6T(P``2T)P``,0DSTEP`100LS P1\H1H5 `R`>  C`P0  R`0k`p`3V( 0 T # X00 P@0T:t0 @`DA 2 A000 000 00@?D<94  -1LM0 PPP0@  Q EQ Q P0P[0 0 0 0K 0R S P0AS@KKK0@  06xP@Ľt -0Q0L0 80 00  0 0bC1!0 @ 0-< <@0PS0L0P0 p- L0@S 0ES00EPPP `0P@ @T@@T000 0H 0D00S000 ,0RP4 5 %+p@8L -L(@P) P㤀p` P/ U0B@0<PP 0`|S00|P00S 0  -LM`ءp, PP  P 1T0 PP1@[l1@\1T 0T P<100I$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0   0- LPsP @0S00,t0P 0P\@P dg@T0 @@0 0-l l@0LS00 D0P {P}P :^, @0 -\0\@00Lp`0 P 0m,x -LPM@NP t @0@ @, 00 40 -0S@0h P0,_P=U0CUAU {U  U. (U=U 0UREU! \=U 0UD=U 0U) M= t⏇0⋇ ⇇x /\@@ ,R  0Sb@~, @P0 SP@0 R,0  0Sb@~,@P0 SP@0 X/ @Th@~~ P000S z 0S t 0S @T @ , p, k,00, -L M`p, 9,%P, 0TP, RP# @;P NP"dP cPsP uP@=0S@@0P S 01 d1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 @Py0[hw)0 x@P Xy00h"h@U ,P hWXp -0LPp y 0w03&@  0` yy@T@ $0W<0 0 h! -@`L [P [0p0y @9=00 0@@0c0  9Z  oby -L M`@[0P  0SP2wy p A 1 00"@P0Ps 0d^0a@ 0t!00h!d!d0n@V@0s 0@00S  0 @? .97 r 000 R00ӑ R \t r 000 R00ӑ R KDDt`xt -LM@ p0 0P`+ 0[S(P% PP @  @x g p0 ,K⢹,  R(=00 x(KD  -LM4Q0( K!Kp@`0 !00 0P02 WP 0T@T  5P\ 0 0 0 0000!0[S (P000P0<0 KDt -LMHR0!K( Kp^`(2 00@Y!@[T Q 00 @ @ @ᅥ0S0T0 3ې!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p (P  p=0p?08p100p 000p0M * 0p0%P pP !0[S (GpT R@ !0[pS (7p000P0<0 KDt̽ p-LpM`h@P񟗰(; \; = |; < < < < ,< H< l< X< |< ; P= ; p= BPxlw3h+@ <2G0<0x ~RP Jw000@/Sp.PlKVPg0: Sc^0<0럺TjS`0N뿐JK Cp(1 @0! S 0+]730<0)0<0"0<0@P}T/@ 00  0d ?0 0<0iD00c<0@0<0Kpp0t  -"1L0#0,uP`@  4TG$] / @Q:XV 0 v V0000   0@`@0  0 00 0aP @00 0T(0mv,`@D -LP`@/0pHU@P P0S, -0L@  T0T ?@  h00 0 hD -L@@P>@ $A A A A @ A A A A A A A A PA 0<0 00c0<0 0<0l00<0X00<00<0,0 (00<0LT  -LM0@ `Pg   Ra 000p1U 00S0 S XSxS   00S  p p00 0@  ,0 *-R& #R \00S&$\$ pP00 00B S r ,P0W B 7 BR00?,, R^l`Dt 0-LM@ K|pP@ L00S00 Du 0S0P 00? 08 -L(M0P  0I    0D !1 `o oF@T @ T$T @0!0K!pKT00g U`P T #00G T 0G T CpC U00g0 0S-00g0   0U K`dD -L MA t0pPA040 000 740`V0 0 0 S, G, T@P000T@T , 0  q0<0 U :0@g DA tAPp 0040040 000S00 ZTX U :H0@g DA tpQ 0 g (KotD -LMK @p- 8 -LM`p, 00 P@ 0[SP  ß @000  R@0=S3g  tPP`30S P VP @VP 0VP$  &0e k 0  , RZ0S ᡼Z|2s,00u ,p 4@ ,0D0 )< @4 80 < ` ! 0T0Z0S 40S  <\80S   P 0 PP000P0,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0|0p0 s0p00pU|s@TW" Z 0   \  ?S 0S<  (KtD,` p-LLH @P` 0`0@PTp` p-0L @T0`0PP 0  0 `PUZ 0 40+s0phsDT 0-@LX's0 0Pr00S0000L00@0 0L@P@o k 00T00P0DP0 0 .PP 0@-0P0 0@$ R& q 000  RJ0q00  R J\L00q 0  RP*00tDG-PW\@ B\D ,\ $\ \ \ %\0\ ;\F\ T\ E\h\ e\M ^\ b\f\t\ l\w\ |\77 0 BqR700S GzRt700S `7\70P: 0s 0 PJ0 Bs 0 P@T*R6 0 0S6f6 0pL'P$ r 000   P000  P  00r 0 @ P.@T*+R5 0 0Sj55 0`LP 0s 0  P0 s 0 @P@T*UI PG>$5 5 5 ^9 4a^  ,\ 4 "\` +R  P%P#J00S@T*F^f^ R@PU00S UD400S 04000dU4 0 0S30 P 00SR3 0 0S3s`30 P4 00  0 00 Pr0  00r 0P 0 s 0 PP@T*R2 0 0St2p20 P0 s 0P 0 s 0 PP|@Tz: Pt00sp 010 0PPe @10 |1 P00[S (S )S {S }SG ]S     P5 p`@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQUR 0DtL (0 0S00PP0 P-L@0 p-@`L0@ PR a e 00b 0p0 p-PQL`pR@ 0 Q" 0Q   0S0 a 00 08@ 0  000pp0 p-p`pPL@ R  P pT8@D00 0S0C0 0 p@80 0000 0 0-4@4P0L 0 00 0 00 `$0R 00}H0H 0P000 0  -`L PP@ `0S@ 㳉0p00T媉0@S00ꢉ0S0C0 <000c@T唉0@S000P -PL3M8 0880 3`@Yt3@0P?0p40 ,@ 0@ T(30P4 S,P,p 0p@ W0h0P40j S P2 0b2!p20 @2 PG -< 708P00\0S00 S Q   U MQQ0SS0… Q^@0# 0´08P\<Q 0P0PQ 0 0S0a 0C ,a 0P00 0R 0S ψ000pP@T*000S00 ,@S<@Z @>@P0S x0`00᫈X @000D00 S  00c0(K0 -`0@ X0LP0  OT え $0 0 0  -0@L0S -n hO -LWhʈ 0- P@Ln0hn -H0L 0@S  ,#@TT^6@@$h2 0-@P L. 0 00h p-X`@L nPn .0 0 p -LM@Pq0S aQ 1P@@]QP 00hA 0K 0$0K0p(0K0 p0 `PwPB1 $W 0P0(0APO ᗃP U VPUPP|00  $0c0u03Q0SP0 000H0 @0 <08040K04Y dT -L M K0 KK K 劃@P vPK -L M@PPr0S 2P 00S hbQ \2@@LP MPD H ۨDΟD>8> 0>P (>(N$>$n > > k.>Ο >HD0 ^#PP@ P PPP,K⇽= ,0 LP0b-Pմ]0 a0bM 0R 0LR |M0Lt-0g\-g@MD]  H H = =0  c= B = <唬<匜<̟Q  P 0 S< pP Ro L 0P 0P с Uۀ0P  Rl ;0 0SP Rt| \  H ˟^ P+000^PP``0^HKH; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  0P|J0Q `  a0 ` a |:`0P @0S 0 p ax 0 g0b 00S0b`0pt0 S P00Sl9` P7 P/ P6 Pl 7 P.  P2*P P-|9R` `P800O T)a0Pɟ000<)0cSsS CS@9@<B8=8!0S 5H0 0CR,8` ^` 0  c 00 0ȟ0 `0S 0P0 0 8 "P P pr0S7 00C0t'P P P@@ 10@'S7@@ǟ00@007`` P#7/U0 X P @@P}0 S56@0 @@G &00xF  0y0 PX]0000@ Sl6hƟ 000C00D&00<6P>10@<&S0000@000?&0 0P0R %00( $00@ S 0 00C005 5R00tşp%000d% 0P0, Xş00 y0#P0%005 P P``s4@T0S  @ğ0 ( 0F00h$0PP@T |4 D3 @ 00`0 0E@s0U3 4 0UxCp@0KS`0$ R0 0 0x -|0LRM~Kl opX\ `@P@  0@bm Ktd@A -PL M,S 0,SS0 afS nS 0@K DC  0PS K( -FML MP KHp H@`㔐K1,,,Sp* 0,SS& g C 0DpP  p@v0 Ulvx01` Vڀ㲂@0TS1!S00Q0S<QP (K8L`t p-L M`Ph 0(0PX0,P04@00000000$0(00 (Kpp -0LSd0@``PpH  lP U0SRO 褽H -LMMOKMH@/pKVBP ^KPB LB KHB KnB0`0 8b 42 0r nP*04  0K0 ~0 082 042 80Kl02 ?K00 8 4P ,P n @ B CK@T  (K(B 0-LMOKP/AH00 2 B00 (RnPK^K00'B -PQLM Hp P  TP T CT cT00㝁0UCTUpJKH/AT2CT D2$K<2W`` 0 @V0 ! 1 2 nK G_KpA A1!01  01 Q q m@PW1S 0! eA>K1 01 01 0W00 S+  0BpP  S Klpp@Ju0 jCu@t0^K 1 4A0 1 0! Q A 1 ! A p0J^KPEd m@KPtT" P$K D\p04&BŒL` -VML MPpemp`  OK/@ $P Qm@P t0ʀ]K PE-KY/@\0 KT0P ᳀ r 8mP4Dt KB0F$B -LMM/NKp/`@0 2 m@PK^^KPEPE2~K`,@0x 5 @C lP `X AP @00T(K0 B"B -LM@/Km@ 0 d0C" S  $  $ $ $ $ $ $ $ $ $ $  0 0 000 d,0 \0\/KlPHDK0gS ,0R((PjK0#B$40 -LM MOK f /U@0 3 zl@P :0S l(K~띎KHkKHA/I I  ) WkK,@?\şhe0T6 9(K4 00PKk.K B4PLIl@P $ TQ Kc@P.)Rğ4$i09 (K0\PK8C8sp@K\K$?K0QSpK$|?4S갟 ȟ П pd ldhddd`d\dXdQPt L$L4QppB?KK 0$U?3s3Sp< s3Sp4 3OK00 KS <0@#P4?C^ c^  K\KKpK0Kyi K\K pKHK0K pkip/C?"Ÿ09 06 06 9 $7 kPQK@7Sԡ ܡ ġ Lb Hb Db@btb 3CS '7 K@,",2>1 K0GWS _<0@!P>!(K1 0!8K>6[ SHK?6[ SK>&0rp0K\0K0\Kh!>6SpK >8K0K HK4KPh(10S K\K pK 0h3Y\) ) 0\(K0 B$"BxpH`hz,<!B$`lt( -L\M`pp@KP pp>.>P p.@>PPpT 1 K I 0S U 1 K < 00K 0-LM@/K.>1 0gR 3  aR dRmR sR000 0 \ >P00 8}\0 0aS KP0 }0P0 0L0 0/KZjPPKf0gS*X0DPKSP SP S H0LDK c( P0=PT0S@ St@ Sh@ S`@ \@XD KgLgK00 $@*BP$\H|t p-L\Ml@KP P=:!>P) @@.`>P @K< \@K< @|\`p0S.S0 C.SP @0S0 C R000C 㓕):9 TP R0@S0 CX0W0Y0 4K4p 0 , 崄P (Kz̲ MЍ 0-,@,PL(  ~d -LM  FaP A!1 K vp" 0$#4 '%aP @ 0(py K Sp\dp 0 DH|#4 ,$|K\8 -L M`P H FfPH`-?fPPo = ZPD  0D0 rhd0ST001P@ o@m`pP  q1 @P  HpoZPdo mmL mD0S 0  ( 0;010S   dPo00X΢P 0-SX0S yo@K 04K,@dPpjoSmP ,H P H\o(K884 ,<\p -rMLMpCKႢP 2QbᵥP^20S  ᬥP F%20SL 㞥PG KƝPB3`Kd* [P2 RDB@SP 0Pp20S 00CS00@Ӥ0r@aQ0S 00CS00Ӥ0^҄ PpyTYTN lPI 0S  @n1 1: SsNK@D @D P H{! KPK&9P;{KP0: SbIPP n 1: S C/K -$K8<Dk@zH*<pL -qLGM@`PfP`P iP`P!嘧p10cQZ1pI aKP 0: S ZJMK@D @D+J8 !P x8p0W`/S/00p`.P/uP@ 0S @P :0/S @P:0/S@8l 0S\z  pIKAPZ4D< @MЍ! -0L  뤽-0 CR 0R0 St00 -@pL8M`PpNPP sP p MP@$"pp5W&R@K0KP< , K 00 @P g`P,00,0 D@PXw W0S< , 0 0 ``LP \hXK 1pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPrk40[S  5[0Se|ьt Ca`@L0VU D00S8 P $廌(K@<D\p8MЍ -0L 1R뤽 -LMP`p@sPp 8p0@0dSAT 7HP\G_KU@P <W .G7P@GK8a| -@LM `P6 600 Q03*,  0,, pW00P0 U 00 @ep 0 6P02@0P5 :06P *0@@,0 PdW p 0-LOM@P' @\@0P00 K/냂D10@1P0  :K0<HX -LOM@'D\@0P00 SKy/^@10<1P0  :naK<HX -Lp`.P,@P04`0K0C*K4M8.K BK( KL:K*KQ=K(0C8 LK( (aK0B8 8 C0(I LPpI( 0 SU $ T $ $ $ $ $ $ $ $  40S 0000 0 0E0S'000S00 0; )p 05  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K(l4, .K 0&880S80 0000 0 0*K0P8 Z0`<`K8ßXK *p0`06PZ@TE0  0K]P T X KP @T`P X p@ X0Kp @T TE `݀K@؀V@8aӀ0SA o8-P 080(x0 0S$v $`@PV  XK-*KXK/(b0(K00C0:K(K0XKS5XK 01 R)0S S S"Z  fZKp0S   p ,<4("4!< 0( K00C0a( K0St@$qT^0 0000*0S<0 00S 0S 0S8AX000 00 000 00S081 0-0 000 000 0(K0 p-PPL@00,`)@P L00040P0 ))@,p -L@M` P3 30 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 3P02@0P5 :*0 3P $*0 @@00 PdW p0@ TP3 : 0S 00@ 0@,0qU dP"(K p-LOMP@`$0 |P0P00 UK,mH10 D1P0 @@ :f@ oT  00Y@Kp<X+l+ 0-LOMP@$u  P>@KT,9D10@!\0P PP :1@:T (0 $@00SK0<X+l+ -L@N$000  Ph@G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ P0@0@0@0@0@0@0@0@0@0@|0@t0x@l0p@408@,00@$0(@`@p@P `(p08!AQ aq$(\,00P 4!81@0  0p^P0Qp nt ^Q nt /tP@ t ~ /tPp t .t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< W.<P@ < u8 M.<P8 < G.<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(KoA 0-PL@ 0#<00#800#400 R00h2 -pRLPw D@A1>0O `cWP: @1@ T@D SH0 0@H0L@pf. @1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  Pl @1 0S@D RH0 0@H0L@ \00-PLP m-@0@0D@H0L@0` -RL`? D@A1>?0( @PcXPp: % @0!0@@0D@eh @0!0@@0D@\@00 @@0D@@H@?X X  P @0!0@@0D@ D00-PLP -@0@0D@0 -LOMP`@)ypa 0+Py0 S 0y 0p WK/&H1 s000yP10H1 KQ`0 S0$00DS$0 0!$0D -MLM`p%"PP) 0V0 BNK@D@D 0!PP0 Z P4 W\  ' ,@0`p\0^"["P{%$K  -L0M`PpP) K.0 Pt 0S x0"S UD@K h,00 KSP(@u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK*K0CcMKL8b=KRK(0C(L8p A((0B88 L,pCxPp 0 S 8 ` p p p p p p  < 0 0R,040S0S000 l0St0S~p0S{x0Sx\0w"0"S000`0SS S000d0SS S S000S4 Py\0@3 ,KPW0, 80% R! 0S S0S080S 0S0S0S 0S 00S 080Q, `0S S d0S S R  h0S S R  r 000!SS\ 4 <h0SS\ 4 lz88q < r qr h0S r q0000000S2gGP\0  '7 HK$HK {0P0p0S,0S0 $p HK cP0sHK0S,0S\0 000Qp0$0 00$0` R$01D0s,0S000 00( 0?0bS@$@|`|@V0p V3 0S @+0P.S  0J.K0 0 B00: 00 .S0S00P 0JNK@D0@D 0%o* P7+0`@0T0  T.*P  0!0 00J.K B0 B57 00JNK@D0@D 0$=* P*p P000JK@@=P 0|00 00(00?0bS fSe'|P0 0 , `0S$01D0S0 S0  0 0P 0u0 S 00P7 `pdKW0$ 1DpK8`ß K p` @ K0崽P  #p@TT \0"   HP u0 S 000 0 0 0"P 00( r0 d@K$"Kq$%:[0C:K:K:[S4b44@MzKdK%KK :QRA(pK 0R<K U)K^ 4 K  K |0 'K ^(zKxxK0K0KK\0 :K*K@!zK|*(K0 K(CE:K(P  | KP@:[T(@u0 S 000 0 0$GM0 000 0 R,0000,1,1 0 -0 0 000 010\0(K(0,0| 0-0PL0S t@00t@0B -@L$;h#;B -4@LP )PB08 0-L@(;P0P@ P;0BB -Lt@t@ -LM8 Y< pP tx4 2n P!X20S002 妬PP 20S00#30#姬p3Ps t0m,`  (P00CS00 Ӥ0߮ R r ,Kx%80SW00S (P<,K0,K@P 0K ([00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00t04  0(KBp0- p-LM@d`P6:P@ 0  ;,0@0S ':TKpBB rS-@L`P"@3:sspp 0P@s@s p-LM@d`P9P@  0  ,0@0S 9TKpBB rS-@L`P"@3:sspp 0P@s@s 0-@LP 009,@r.0 9 0hmBBp;l; 0-@LP 009,@r.0 9 0hBBp;l; p-LM 0`|90tr.@l9PX~9\00SYP  0`P@o9KpBBp;l;B p-LL]9's@`P 80R@P Ps@phN9BBF 0-0@LPA9 0 0P=90BFF p-LMrP  0@P t0P r0PL`PU0 r8@( r0@00xBB -LM\P`( Kp 0 @P F$0(S`Pr"0 0;0S0P0S0 @‒  | xP0P@S0P0S0 P0S0$P0S0 (](0$ 0cR00 S  KB -LM@Pp,@ 8]r[r0@0SVPp% 05@KU`300K ,`K50K0 *0 @K`@@ < t0P`ppV 5r\@P0`-rP0SpW@%r@#r X8(KBBBFF 0-LMKP0P,, ;@P P r@K0BB -LM1800SP x@K0 00 200KΑ H KD+@0 @ P,@@ 8KBBFFBB -L4M@p8`,@ 7qX q1@0SPp, 0V쀟,KZ&PP@1@#TPK 10T0K@≑  4K04P 0@ Ppp0`V q`@P0`qP0SpW@q@qX00 7(KBBBFF 0-LMKP0P,, ;@P P fq@K0BB000 0 000t -LnQS(0  hRBq00 -0LM0@` @0s 0P$pK ~$ P00R0SP :R Ur 000RPU$ @D 0-LP@P 0 S Sp00@ r 0R <ܩP  $0p000D -L0PF -MLMPP"0, 00S S0B,0 , 0R],0(K0  CCP  %@PRnK`F`FKK,KPp00(KD0 -ML Mp>PP#1, 00S S0B,0 , 0R,0(K0   C CbP @PTBnK`F `F2K,KPFKp00(KD0 -LM@`p@P0 P@ Pp#K P -LeM`@P pVX  XV  XB P PNlPK .0Q5P  $0pS'PU$  0<0KR0;0K 00SR  00S S;KMP0;K!z#W1<K2 1C$;<K~$pWe We*0SY; P!1PP0S S o 0BU@ l`K #o< KP0p < #@ oP04$48#8  5#p( @T% T%*o ! 0Po0 S{o1 0 jK1 sqo10! (K -LPp`3@P d000S@  S@ @p080400<0 0\0 -LM@A0p8`PDH 0v4P' A0S#XPU H 0-0KR0,0KI00SR I0P P,K#MP0,K " -Km#K -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K0C*KM8.K BK( aK(L:K*KQ=K(0C8 LK( (P 0B8 8 4C0( L( 0 S  \ | 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V` 00FV08 KF/P{40p@P  Xp 8K p4A m0 00np 0{ (00?0bS fS0S4 0R  0 :K(45</K 0c880S 0Uhh*K0P8n 0S<`0(,5x`P0`0*K84LK8ğpK ppl0`0?P*K(R@p0KᇴP@ pH K.P T pH K.PHK P x`P l p@pKp @T HK )p`tl*K@jolV@4ajl0S 8jP 080(pw0 0S$f0P04 $`6@P  pKpKHKnK`FK4[0C4K4[pKS:K"5 r_KpK*K(2`VR0S SL- S SG6Z:K <KP8:K$" 2Z0*KP*K <p#:K ZYK +*K Z Y :K K p 4[0C4K4[S@$Tk0 000090S <L ip`k0 0+0S00S 0S4A000 00 0P0S00 00S041 0 -0 000 000 0`(K,0 -L@`pP 0<@  -`PL@akP00p4PP d0T04@0 T0L0[P0 P   -LMB^KM`PE@p x0P 0 @@P <00&PP<4p8@ K# -L@LP 0@0B -LMBKMI@I 0 S|# # x& x& x& x& x& x& x& x& x& % L& t# <00S000D0 000 S<` S. [0S o0P.S000 0  ;60  0.S0 S00Q 00 0 4" P4 G+pP0U0  U.P  0!0 0001 y 00 0 0 !v P p 0SP0(00 000 0$H0 48 P@ 0?Yj0 0Vj0S0000(0$1@QP/ @0S 0( 0S 0$$M 00D0 0 0S00< S00<000D0s00 0 0-0 0000 0%(K -L@`pP 0@ -0-LPM@a?KC/_K@0 Q Q 06Kp@ `@ ,0 pK\ L0 ,P l  K0& -L1M`0pPKA4 8 0 p 1S01 R rP P 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SgP  00CS0ZP0 r T000U񟗰8- - . / 2 X  PT0*08PdP # 0hP P 0ᄠP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SP Ti (K001SSPTd 43p043 BX @ 0@ B0T0  RP 0 r U000 !P@ 0C00X0  0SP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000:PU  ?K0CUU]UXPxPPEV ;-0 80#B80#E   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000PX   _K@PEtT-xePEP ֳxӳ;0 8i0p@ 8j0p8@0p4# 4# 8S 0e4P4 4(KDn -DpL0`S@PP 0@SPp -L M0`Ⴠp%X"0S 0@P0,p O@ d0P0{,p@   @  b&$K -L > > > > > > > > > > > > > > > > > > > > > > > > > > 000p 000p 0p  \@c 00@,P <0KP (K,  -0LS@0000 -vMLMx 0pP|  p 1S01x0 0S xJP c 0h 0x'00 S80S5@?KC/K 1 4C 0C xt0 0(pK|rK0pT?P,`LOK(K Lp Q a , ( $A < 4 Ph hPh (K0@x0@00@PK "K@@ Hp dP \@ `@ GXK|'0hG pW  @' dG PG 7 p@G"nK00@%S@D L0K 0PP@ T `TKJh10`VFp`` \0 R0\0 ` p xdKNP. Kp' h70h7 U0@@KDPK<7 @G l7 8 )0K*0K@@ l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l @ PQ`P`  P 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw  28Wp\Dw  PD8WPaDP"P0L7 )0Kl' l' l7 l  @0S1 `B `>ll l  @0S1&*l'@ @0S 18#X `!0 8#X`l7@  PQ`P`  P 1P` 0 P` ZH l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l@  PQ`P`  P 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 00 0dP`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKtPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKVP6pKpw @DT0p`@` \0 0R\0 ` xdK@P <'h1 R 0`R\0Sh  xdK.PK0p `0 \0S xdK!P0`0 x'0@0h7 [p 00hw PY  )@P 0KP D廴h(K 0 -DpL0`S@PE 0@SEpQRP000S0 -Ld`P  @ 0SX00R001S @  P0p@ 0X NP0Wp@d 000X T00S <0@@ X 0 0.<#@Fp -LMOPPX 00z`10>CNKTa@D @D 0P3KHH y p* T0S \PPT3 4`K Xp MNK0D@K0@3[<3K03K\ Tz  (0!"(80S -Z00 @3[P3<831P@<0X0P(K8i  0- L@DpP  5p  5p  Cp Y0$S Y@AYP@0 p-`PLU@`P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@tP2[  YW0 02["[[AmK0`F@`FT@D,Pd 00S  uY00 K -L0MP`XKP0:0/PP JK@D*~**|* P11;dPP JK@D*Ld*$* P11k;Kp,8DP 0-LMP^<0SY P0ST 0S OKP.PhA 0S @ .@P@ P TK0Xlz -AML8M0`Sc J0P0@0@(K1pV (@K0 PQP G@PKlp@  h0R d0R8 pP5 h0K0 @嘯@P# A K@08@ 0P0S020# Ћp3PPḮu A=K0C80C  bp3PJpK0p 0-!L0PS00<@P) U=PPPP0!SIP! 1p᎛P b0S 6P Pp 0wu0PD9 P-L@ XX 0@P@T, 000@G -0L@S4L p;TP 00 1 `P.@@P<8P0 PP50P4P|P `Ph p-LP@R`P@ R`p -LMpPR`(K0 S00( 2K ,pR0S @P R` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!6d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<(K -QL MPp` Q QiPc  a$ K8PZ@ $00@PP%]P @PF  f008 KP :8 KP0@  80K@ X 80[S70[0SS 70[0S SP @0(KP 葌(0S K p- `LV@P p 0P*(0 0p000p( -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0p000p4 - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0pSU 4 0 4 \ 1,0 5P1)::0S 40P3 0T U.*X104 PU%0F>S-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K@P -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S4 h 0-< LP@ P0 -0L.S@P#P*QR00)&P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5@ I$`VSO"0I845@A$  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 O00<110 0v`prJ W  0Vd9#Zp ]`p X 04085# <0 @TN00 (KDtt -?@p##pWL$MX< 0O?   BE!5;t l@ڞN"0 01`V#U!42T100  8 4   0᠊8 4  0T 18K1 8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ <? 30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 `  (Kt p-H<`LMP@7Px0Sx -LMP@ R@00 00 -LM@5pMЍӳ- 800Ms00Ѝ p-(LM"X`  p@xx -LM   PM@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LMpPW@: 0`A("S*M"0 0+Q(0V  ` P  000 `0 P*@` L$0@0    ? -,2L L0S L0#S 50 !S0S0` 0C# @U  000PP PT4@` T0L 00P00 R p LX0 Q dp  PpWUh ,0 dSD(Kh H  0-@LMP$0 (0P0CPEB0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@ h 0-LM R00 0P0@p300C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0  LK0K {P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  L&p@ rK0S nK07SiK#00PbK@ U p 6300| 0 S?Kh -LJKM@DM@D`*p  W@  0p000 0b0QZKPEPE Jp@ K0S K07S K#0 0 P K @/ K 0-LM 0PQ@J"0 00P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 g000x p-LM` S0PP PᦳP@ᳰP0 `0`x -QLM@*P T@ -L$M`p@0 J 1! /< P +s*@,6P@& +d*p@ 8PK  /00 000 Z00000 ,1080 4@ *pP"2DJ@Yt2=J0S. a< 0p P*i*@%J?00t J0S<`l d0p P*8Q*@ J?00@ R00(KzGwd @$ -LpM`10@W,0   @K™@PK ,ᑠp@K@  i`P060#0P@U@Kᤙ    p  iP0\0#0P@U@Kᇙ    S0, 0R (Kh, -L\M` @ V^PP, p t x a 0Cs^0l0 }PX  & hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl 9 @4hK1@K. ,0 S (Kh8 -L`R0M0@Kp0 0n P 0S diXnP 8nP @ ,KP0 Ń, R 0S!V000z3Z 0Sj0KnPd @ ,KP0 裃,  R 0S tB?SV0000K<wn0sn@PB /,0PVPS00S000an@P0 ,(,0S00S000QnMn InP@$ Z 0S ɡPT>P/0K 1nP $>$Kp|d -LLM0 0rp$0 4K V0 0DKs J @ P$`DK 4KP@ P$`@0 @P<(@0@P;0$ 0R Kh4H 0-LMPH0@pu H@8L 0MP ЍaЍK p-LMDQ`@PI K`Ph d0  o>=1 08 @0 0<0 0040 V 0K! 0'0`0 K1' 00"p PP00Sd@K/f`; K lp 0#4 KpKP -LM@0pSGP00 'x`-'P@2;L-'P?T00S@ G0S &K  -LM/@ᰨ0 P0 KpKP -LMP\@pT` U 8@1=1V =T0pp 8 p-LM,.%(僽$1$0S 00CS00@Ӥ0 G@`P0S 00CS00Ӥ0၁F PpNT nT tl00S``00CS`0X PX0  X0 rP x(pL p-P1L$MQ8K< @,1@TE ( (0$KS 1 (0 ( 0Sp7 $000 !0p P $Ϭ*<0S )k.:8K#eT:$P `K kp@ 0S . 400 ( 3Kp`K8@TLL -MLM@\`K, Lh P*K0P`0 ,[f:KPd` Pf`P zK(pG4pGK:K(Hl*K(0Hp0w2 P P*K`< Z:@P:K``< ~U*Kh P :00#PH kU> :00 Pb :K\}PV 0RR 0RNpPI 0REKl0 R?( (0R;:Kp0 ,0R5WP0 RP+$$MP&*Kh|p$ :Kd 3PZ*Khlp 00S0@ }PP :K`d9< KK`ū᭠ ,0 S,(Khp KL`ptX 0-LM(PK0A(0 $@ 0 @ 寜㬜㩜㦜㣜@0(0 $@ 0 @ 嚜xCuCrC oClC4PhC$eC0SK0Kl  p-LMX`@PP @0T^\,PP @S@xPTK -LM@pjP q%p 3#0#-#T-at -0LMM0 ,0 U%PPWoKJ%T1[S   @P UK,MK $0 d7 |/. Pp , ,0 Sӣ(Kh -LAM0 , 4$ 84 `v@ PD?0004A#pP 09P D0Sdd!0ƍ48$$PD D0S@ 40B^KPE@DPE E(0K@tD[P?p%0 墍%@P P 0+4J PwDhpl 0ᇍ04$84\PZ ,0 S0R(Kh0I -LM< @ Pg `0pKV8 D0 S 7`PT 8 80@#P0S> 4 hPP8 $ P@ h@P8 00S4 KP 4 R ;;S h@P"0 <^P 4l hQ@  0 8K:@PV ۞$@(K@RMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  ᡬ@P<n<@ Q 0 00<@  pX00V00S< < R9 P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K. -aMLM20$0 pP" 6#p` ]KPE[NK@D + 0K 0 E 5 U\e #pT*cKk[PXGk06: S  S [NK@D+e K@@_P[NK@Dp1l!IR 0K@@X@9@UTSaD[NK@D"`PB0S 8 K0UC"`PX% u,!n/K"PX[KAi,R*O* K2SPX [KhA8\00S $0 S4L Khwd @8edA@4 -LM  K K0K P K 0-LM@PPP0.S 0a C00C0  SRQ88 -LM  K K0K 微P K -0LM0`p  $0 /"PPK?PUOK S7iSb DSp dS nS rS 0 &`*`( UcU V*dd000P V* 0 V* 0000c00 0 RPE PC0 U0ppP;0PUU U00S!0S 00S Q0 ] PP U V{*PP Vs*0 n BPP>10CB>A#>A0BPE0Sj<@@f  PW*(K0KK RK p-L M`0`@K$ KKK`KuPP$+0$000KpTK - 0LM: AtPTK -(0LM KtP KTK p-ML Mh20@0 \2`c*PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+BA.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S ,uP+AKIK@A @`A d xPPT00S +:=P 0S` T00S <0Pu 0 S(֞KphTK@H`hl8 -,"L$Ÿ M RP`@ 0 0 Q 10m Q 0 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP `t* -LDM\p, 0 \0QD0XSxS@ P<r: 000D4 W @`  Q#00ӑ giPdd#d3e/0T02@0 pW: @Q q "000DTpG. v00A SsԢ` P@ 7j Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SK/Q!D00A S00V0S< @ j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2p>@0(^PK2 i1Pf>@(0/@P00 }PT@ dK0 yd0S@ F>@00A>/00@ ,0 S,*(KhDt -L M 0-$ -LM0 !` -0LMP`0pK00K]P i 0 ##SVPU`0.T00S` U @ TU 0K (K -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H > PP1P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K H=/00 ,0 S2(Kh -QLM@< P@0 R+=0 0"P8 < e yꕘ$*`@ P@&@0P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ P 800 R  0 R04 <00Q 4 8崢 (K%*C-@M 804 (, $   [ 0 "6(Ƀ.,40(0P` 0P`000#(p@$p'P(`0 @pP` P`  0  $08@7(ǂ P`@P0 `00#@$ "!0 @ `  0800Cs80@Ѝ -LM `00#@$0@P|0#@$G-|0|@p!"h0h@P'`(`0`@! "X0X@0#@$0@M0P ` (0 0$0Ѝuespemosmodnarodarenegylsetybdet -LM(0P0 @` c(0'00@0#@$0@/`0#0# @$,@$`&Ŀp' -LM@  -LMPUp( (0`0(0 @hU 01: @ j`Pd9 cPE` @U U  m& -L4MhP@K`pP$ W0  v$ 0R O Kh M0ЍPU --LM0 0 KG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q ЍD - LM0 K  姧p K -L M@P4K0`px $@ PPoP00P0#S :00  $0 S Kh -L`M\,  0  \ |K q! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ @|KPd!1PPpW00P0#Sv 0S ,0KR*:00ZK .0R::0a @S@900 9/00 ,0 Sݘ(Kh0s 0-LM 0@0 @PK0 (MЍMЍMЍ p-L M@P`ꔁP0fC @\000C S 0 vtKp -4L,M TK@KT0 P@ qPle/bd4@D0 D D R*0S0 |S :S00$m  $@m: @mP#X0@0X0H KYmpH0C<HPK (0@OmH0 00@ImH0 ,0@CmH0@D K40mPDl  @P2mpH0 8#(3 H K0@'mp2B, 00H0 800H K7@mp8 40H 2d.d>`.`>@PL.L> 0@Pl 0 P l 0@PlAl l R0h0 l=K1 PlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\  t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` JPH  t\00S2 l^+; NB1`p;K B@@ IP`tT p  0)"l @bT ; 1 K+DbP@p` @PV ph0S :  (tP00\00S@ P p^  P:lp A< 8 t0l80 <  0 :8`^ p@ UA 9  0p`P8 L p 1Pd8Qd)1A 0 d 0qHD Z@ 0b0@ 0@`PDPD  0< l O 0P 8 D8\S p8`p0 0y  H@ 0$ 0`P>8P 8 80@ Z 7@ 7K 0pPlʄ K  0^P 0x0S <l O8`pꌀK4 l0?Q0Sl t R00Ӭ61 R 6 0,PlpL < @H P 0 0 0000 0@P#>P ,6 t Y' 0 0@PP<l  0P HXl 00 l 00x9S 000@Pd0S|PL0  X\00CN@6@cPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R L0PL0  T@P TT@ TxPT  UpP \\ pP d@^00S X 46S 40 S `P` \ R0 01E 0`` 00 0cS0C` S`0` P`UTPT ^ `Q~pPW h R T5PT  PT H T L  PL ? l0p0Cl0 t t^&ʐQQ" pP- t R T Pl0<0 L pHl P H100<00l0 T VL.PL  ZLLH@ P L L N@P L0  ! 7PTPTL`@P 0SPTP 0@ \ U00S Y9T* V1@ V00S YT0S0SUTPT P @:T @U9T0{900t'0<?aCoc?`(?yPD?4L4?$@@@?@ t0@RC T  9PT w PL\  .PL l P P  %PP c L  PL \ @@ nHPTu0@T@T0  \0SP ,t UPPT = P T\PT 4 P  H X100l00l0 0x9S 000x0S ML\ P^ ^ELCTA 0lS00 H H(K -LMSp3D*MA Q00  A0S 00Ѝ -LM4 0 -[à`8  @4pKP4  8  8 8 8  8 8 8 8 8 8 8  0#2>;?C0C,  4K2 4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LMp8 Q04 Q@0 0Aό  D0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  0<04 80 Z\0 04  @\0(KD -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  -P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KD -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  ᢪP040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KD -L MP< @0 Q`40(@08 4  Vm@ 000 0Aό@ @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0@ @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0@ @0@\00 08 00 C< YP  4咽0 8卽@ 40aO0(KD -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  >R(00  p S$0 0    0 mY:<`V Ph@ 0R0@ UP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 T0AϠX0d  `Xl0l t P0tXpl|\ Vl d00 V`0d0 ],@P@ Wd00  W `0<U, d0P00@T d T 0  @Dp U  VD vd 00 000s03_V0S  W w$, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S `[A?E0CS 0d   6<>  X00S  0td  &`ZlRL  x\HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 D\ \0S  \02  d0D0RH0S `0 dKL 0>LQHP 㸄H L0SH0S\ dKL 0>P`dPKL D T 0 2J@P 0 * L``%PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\P@HP      0    ^*<`V @Pi 0R0@ UTP @PE Tp@ d ` Xp \@ H@ T P  P@ P d0D0 < 0 0D 80 0 0D 40 0 0D0 0  T04Y80<@x0 d0|  |pY00AϠ0 d@;d0 x[h P0d`Yx hP  Wh 0 W`0,@UP@ Z0  Z `0``ş`%U00 P@T d T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |帹d0 x峹d |0 pNhL 0S y\H@Q H0S dKL 01@PL00L0  ^H0Sj \Pd0 D\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP ΂H L0SH0S\妌@夌 adKL 0PPL D T0dK H@P0 dK@ LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\PRHPO@M L0 SL0S(KeEDR* M0-LM0 0 0@ P&~K0 -LMp`@ P@D`@0c%T -L M K** 0-LM 0KK ,0PS7 7 7 7 8 7 7 7 @  0$0%K@%"00@@ AK01 xB 02 #4xB 024=> 0&둸@-1@d4xB 02d @-M+Ѝ@4=> 0lM Ѝ@ -LM K= K -L MK  KjP K -L MK  K]P K -QLM@ 0K00#0  ~0p03T0S00#0KU* MЍ4 BI* 0-LM 0@PlP d0^P8p8 (0NP88C -LM 0P`APp h01P X0@+ <0 0 pC= -LMp `PP@P 0S@W P ~P @TP @ -LM 0 0PLTP4M<P81#8181:P02410!0 < 8#" Ѝ*\* -R00LM?@ D $R D R@00L$0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0l 0l 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S #0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KD -RQ3LM@`P :Q P*#W000@@00'@$ 0,` 0(p S,0K80 040 0p  0 R r 1S018K⚘80`0S V 0`@ Kp p-0L$M0PQ`0 AZP P<@Kh 0#20000 Q0 0@0K 0 S0KphxP -LMT0@K`P$0 p ᗩ$ 0R  Kh\ -MLM@lK, l p`ĩJP@ VKA p ;$U eXW 02lQ )K VV U PUo0 ONK@D@DV  U zpP"@ "W@lKV ,0 S (Khh 0-@ MPL 00K0 -- LM 0  -PLM\ p` PP@yU  00$傗  yᱍ뤽Hj\+|MЍL -LM@P4E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E d R0 0D<4= :"0 0 |[*W*- 0-Y+ ̌!0M0@  0ЍW=*Q9* --LM0  0  KZ'* -PLM `hM!00 0-LMPK@BlP@  R 0S0U Q@P P$l!PK0 -L M0 y K* -L M@S0 0 S00@ (0 0$0 00K 0 00 , h d0 R r 1S018 K⭖$0@0S T KpL|* -R00L MH /@ D H$Q D R@00f! 0< 8 0(3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 0?]0   0`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w` !000Z W070cH0PS\O4@T# 8 V<U < 0R8@T00 P00S !"<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(KD*=*<*U*:*: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ 0-LM@PTp PEp Tl = U` p@ T888`6***M3P3Q Q $Q 4Q DQ DQ XQ XQ XQ XQ XQ XQ XQ hQ hQ hQ hQ hQ hQ hQ |Q |Q |Q |Q |Q |Q |Q |Q |Q |Q |Q |Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q P Q A 10=009005001001,0010014#001001Hp0h00\00L00 <00 ,0(00L 0PЍz(  0-LM@P8P(008P008HPQM R P000SЍMЍ 0-PLMP@   01S S  R 0^0T0 0 ^  RR11:008-PM Ѝm.0S1 P P10:00Ѝ -PLM QT0 0 PM 0s3Ѝ -LM0S  0P ( 0 $ >0S@ !88S@ ::S  T00@ 0lA?0 B<R<00  -LM@\p`a0+QLp` RK \P %WP>0  P 0S 0S0 [ 0S0 X 4T00%0 P|3R`10 S?0 Q:Q0a) P6;@ S:0WP0 z -LMPP`&RZ 0S00S)0 R  d 0ypD pB P@ @@pT:6SR 0S00Sp@"T00#  00S d 0Fp00 p00 P @pT X1:00 -LM`P4 80  P00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T P804 q ZU1e@:0 10(K 0-LM@PPCAU@8/Y* -2LIM0TK(0 `@8P:KPP50z WeV? ᷯ 0P尫@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\喯/3@P*1 0R& 0R" Rd3"" u `5PP @1R <1R  81RK3 pFQK`45P@3 (0 S{$Kh@dX 0-LM@HHA/0PP PA/c@P P@8NMM ЍW-M 0LS\\ 񟗙X] |] ^ _ _ @_ t_ \Q00aQE 7Q 0Q,*$QM  QJ "QR!-QOMQ$ EQI;\Q ArQ# fQ0 nQ bQ<tQ& 3 03:vQ400G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000Ѝ -LM0p`@(K(0  0?P4` ` ` 4` @@00 PU( K0(P@Pg K -0LR M p`C@-K4K4  C  0 P a ` ` a T-0[505@ T-0[505@T00ĕPU-K4 K0PT-0[505@T00ĕg(K@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T l8@K04K 40 խ5`3 ͭZP 00 00C S`L  <` P`@ * 0K |00`0S>0S ᩀ "00hL0U@1:  v@PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y m\ 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  Hv@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 v@Pc @0f D0!PL `< H0X PH L0U:@  @ v@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  u@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ u@P [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -R00LM?`p$RW00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``i0 U 00D S t 000 W070 cRQ00\00 R00S,, "  @Q00 SlW QE (KDG-1M0 `p00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R`VC  R Q;r9 06 0mC10S%0n n m m m \)*0Š$\"*0S R<8\0SP R<84 Z ,< $8 #$,, ЍD -LMKyP KN*J* -QLMP`pPp`pe00 I@:)W1A)* -L M6 K *@-\QM@  HQ*Q?Q [Q#Q p @3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 "Q \Q@\0000S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00ЍD p-LMP`@0 0 S  e0x -LM@pP`T0PEU0 @U 00g0 -LMp@`l rPP@  @`PP` -LM`8 8!#1 " 0# 0@ @1 K Pp<0 D ]\Q  GQ*Q?Q [Q#Q q 000 <0 Q00S@0 Q00S&20# Q00S   0A QSq !000 "Q  \Q@ Rp#*\00Pp01K XD0pc@ T1K PHXHQ U:8\000 S@1pK08gP0S i(KDE*bA*=* --LM00  K p-LM@PP0` HHmT  ,, D xhlꤽHj\+| M0-LM0 0 0@ PmK0MЍMЍMЍ -LM K  Kvt -0-L MP0U0 @0 0 C0Q a00 4|P@T( ,K K$0K$ @, @CP 000(   K0OHj8W**=*a**pM L0000 P40 P000ЍDtx0 S0M00ЍW -@LM $$ R*00 C R00T0SQ00T0S  @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ p-LM0@S`x  qPP x` Px p-LM0@S`P 0S0?0 P  0 1 x -LM` R*P*0S0]SY`pPhJP0Sp@T U? 0-LM @R#3+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 8 8 -LM@ 0SP* P &  P ^000 `0 00Vp(@@ MpP> 0A0 CpP00Q0 1#"0"Q00g 0Q P V001LB"A2A` B,0V 0000@y0@0y0 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#L+00-S]SE R*q Ɵ000uj(P0S p@ T #0 000000Pp |@P@ PXy @  @  g>00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =X 0000 R!#+ R *0S*0=S0]S00/k pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  [0Sb 0 0h@Cp0 t 000 &P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o-}$t|D  p-L KM0P0^0 0K 00KS0`0K 0@0KP`Kp -LM0` @8P pw 0000 kP #0KP 0]0@ "0K0#pK!0Km@P 0S04  4KD -LM`RP@p P 0!C000 -LMP\`@ 0 q$0S0$0L0S0L0 Q   fA! BΏ 0p -LMP`@p0 ST TW0 W000St    0 ` x `  f00   fT  f+" K B a"  .@0 f|  f7  f" . B a  % HpG`@  f0W  fi5@DpG/@D`vi -LM0 \@0 :P(0^S00  (00(0 ,00,0\Qp0P!#c+0 0|4W$Wk[W! *W .WJW' 4W $W OWwt4W l$WpL00   i(f& a  70D  D 0DP U 1  R *0S*0\S0)S \) x U 1H  q R *0S*0\S0)S00% !<0`CQH0S  T H v K0 H U  - R*0*Q 0 0 hl  h'   h0`  hPSv*\Qt0{Sq00 `R*0,S0S0 *000C SVP \P 0V R *0S *0\S0}S00  R*Q*0\S0}S [ XP R*P*0 S0 SQ 0 0C0 (00(0 0000000 S(Ko0$W (K91)>{} - LM@0 8 R ?U pe +U*U`*$UM (U.U\^U7 [Ud \Ud{Uv |U|HR!#+0D  D 0DP U 1  Y R*0)S ) U 1H  H R*0)S T   : (00(0 ,00,0D , (00(0 000006 .00P '  "R!#+0<Q0 >Q&  R*000C S ~ R*P*0E0?US{U0S*000C S0Q0 a+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gm " B ad   `R*0,S00000C S\  VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0V 4 0   i04 aC0" 40 t4  a  i (Ko0 R (K -0LxMS` 倀0  PPa *)YPv@P % 00 0 iP  s 0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P uP<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0KJ0S p(KEe -LM l0R @T T0R000P|rPyrPvr<PsrhpreE -PLM 0@ 0 @ K0,K0 q P0@,0 (@ ,K --LM0 0 -H0LM@`P4 09cT = Rw뤽HjL*3H* -(LM"x H!X` P ~ hy HU -LM0K%2 2R ,0 S 00S20X_ lv2w" 890t2 oh (08@"#HH208#X/@ 2 @Ivr X`k @ T  X\!A 0S1p1 " tP"[<K{<Kp00@ $ S9001 1 Q1 0@ 0.00 !@I0 \ ( <@ 30B320 0 R0#@$@X0@@x KW/u$W,WyWWWW W"W -L8M\$ p`<@ |P @ PU@V@K 02R R @ RV@K 2 ` 2㒾᛿WP  $0 S i Kho *P*;**(MЍ -L M0 b K p-0LDM0PQ`0 sP P\@K܏h 0#20000@Q0 00城 0 SiKphL$ -LMT0@K`P$0 pԐ O$ 0R fi Kh0 -MLM@lK, l p`鵐P@ VKAOp /;$U eXW 0SQ )K V U PUo0 ONK@D@DV  U >bpP @  W@lKV ,0 S i(Kh< 0-@ MPL 00K0j**&*!** -L Mh,pPA 0S> ,K 8hP6,0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `5P0P00(@$K`wlz<0W --LM00  K 0-@0LM@P ,,w`T {  8hꤽHj-p0M0S 0 CR 0R0 SЍЍ00Ѝp -L M`Q0 8@ 4P `< @0 p8KApӽPዽP  ӽP!0,S@{P 00K C00S<  @0  0 0W00 (Kز -0LM0 Q0  0S0S $S02SP  K0 00 0 S g Khp@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :Ѝp -BML,M$ğ@ PK,@ TK @<T0$S0@2SaY bY0*K0HPH#K 0$S000C S000C S0$S50J0S0ʠ*K0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10D㖺K0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ g@TTKpP `0# #$# 0PUK 0!^:K0<@K K B K(@@嶋᳋㰋ᭋ00BMK(@D@DYKPK`p  @P 0 @P! 0 S fKhD -0LM0K0 K0K0  c0`t0l 00PS?@08 PS 0 SeKhX@B`T p-0LDMY`K =0P 1Ph@eT @P  00=ᴊ 0 S eKphh:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM hH0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  PД$H xhhHM Ѝs`@-@M0 0#@\LTЍ52* 0-LMP@ $Kε E0R$@ 0 0 004003200 $K0 K[P0K0$8 *[*QM  ;ЍKi*9*RM 0S0S0  R00ЍE*M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍX -LM(@Pj\00X -LM0@P ]]PX0 -LMC0SP S ZP  㙵P0t00CS00 Ӥ0; R r  r 0R#R S3 k0@S0 d0@S0\@2b P  㱵P  r 000 00T 㡵P  r 000 00 0] ㏵P  r 000 00 P  r 000 00 oP  r 000 00\ _P  r 000 00  OP  r 000 0 0 ?P =Q ߴP@pWyx00#S #W0 S SHP@0 S0ôP0  0 XDWhXXhGPV 0-LMP寴P @P8yn*H0M0S 00CS0Ѝ:Ѝ00Ѝp0M0CS 0Ѝ:00Ѝ 0-\0LM0@SE00CS00PӤ0u:P00S<8pMЍ(@-0@0@$0M00 00000Ѝ#EgvT2ܺ -LDM@ lK≒ pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P%L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -LMP`1>?0@@N10@j@Rp0@P:Z @  `phP[@P@pG?W W   oߏ -L(M< 1>?0@0c@ S80 D ,T`p@P  @00#:k0cS:UV@ 0`p -LpMoP0p U<0  ;PAeP@ 9 ፰P2>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@e0S@ Ss SV x < R =PK<֌0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$P( 800C 80 P80080 H:D0 08@KP 800(S P KĉPL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 冺 VH D 891H C d@ Py 0'H D X,\P)X@T T8HK؄1 PhX0\ʤHHK1 >X 0eA 9H D X0s`(X@0##HK X0f @TW  8HK1 H D 0 MSl p h d (8D0 0H0 lQ <cpah_l]d[꘧CbpH@K0p` @PV!H@ DP D056CD0 87HK1 H D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 貤H D DbB V60␦j0p0 H@K0` 谥@PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0=Pl Y d h l0Pp S l@  ! ʌHK0 K40K P< D +Ph ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ h+Ph  <喋PP <h 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!: -]M0P P0ЍM00P  R*Ѝ p-LM @R 0`Q0PS[`V*[000SP 01PSy[0Ut[00x -LMPq0  |   x00  x%`pHAP PP[ 0  0S 0S0E[@V`P =[00P 7[0 0 MQP  pR 0S '0SpZ 0p =  5QP  `R 0S &0S`ZZ`0 0 0l 0  R:0 0F@0l@]AP<  0 0l ~ 001  0 0S00 c0@00]`P 0 #P Z0 0a0 @0A 0  01S @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:up/0@@0BNK@D@D+P 0K@A (P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A , P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L++VP  0K@@@ $ P0Sm B^KPEPE+=Pb@0PY 0VW 0p@ ! ( = 0  d0S00p0/ 00 10.S0.S%@ 8T*0 S0 T:p @0vP  D8` pP (P 0@   ppp ,0 SWR(Kh01?, -LM:K M00 K~S4 G 0 D K@K@0^@`P.K0A@ Q p 0S /S000S PrP  K@@⫁P 0FV 0`SR*0S0>K0C0C K00nK`F`FKP8`?WPu [W *W0u@!TP0S ]HP!TpPEr!T#3@ 0p@[W:0:S7P:1P1 0]S.0e4c 0^^  R*0S `PU  Ÿ0l10 0p[W@0 0 ]W 000-S 0]S dŸ 00@0]Sp 08< 0P` 0< 0 *K 08 <V 0 V1R 10pWp1p(K0S KLL K.KK(@AK@A4 0 PO 0 P < SEK:K4 00 > P;Ipi - @Z`P0 AP 000000P  0  00 00@QP X 0 D0k (Kh[! :-]?**   -MLM0@{S0}S0Sv {>Pn >K0C0C@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIIB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -LPMh0K`p@00< 0p P@ Q< R9q7 r5 10aR1  K0\`2KS   0R\S0@0Q09 B0LP*0 S L000 KK  K4MЍfMЍap 0 M00ЍDp 0 M00ЍD P PMЍp 0 M00 ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00ЍDp 0 M00DЍDMPЍMЍM @ЍM ЍM QA 0SbЍG- Mp,0`SPP0`00b@070 S:!^ ^5*.000S0*.\ \\00S$*\00Q*0`0SZ0Y0? 04030#Q0#S 0Z RYh ЍM  R P*0SPlЍ0M p 0 0 00 P000ӑЍDt -SL,M D H0 8 <0 @0  H\H H @ < @ @00@0 @0S<  Dp BP \e H0J00 =0P04 / QN%0C0L0 .S+ \ST P@PTPL `0aS0S0S40l.SP0? 4`0 R0S4 l <0Y:Q8 PL*8!A4 =R#= B0,D",0 a = R @0PS 3p5 5@0 5 .X \XX 80R*X0gSXpB 0A>S\ < 00pXs80W:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ0M*S0.S S ЍЍ-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ0MЍ0 <8MЍ <M 0Ѝ <0 Ġ 8M0Ѝ -RLM$ r0 0 -LM@@uTT p-LM PR @T@eT <0S_T$0``PPUTSTQTvP LP:@6@x -LM$0`pPPVP@ 0(P004$0@L0000H0 L⽀ 0-LM @<Q *PT00?0 0 8WPPP PT P8 -LpM$s`Pc`LP0pKHp @  0 P  0 PP 0PC  0 P 00l ㏡ 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP(R``PP KePP4 0R, 0R0 0R \P00fPTW@-O@K -LM0@R`p ( jIPPPPFSPP0P0 0p 0^10 -L4M\ P"P \ Rt0400 0x\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  00404L ZH $000S/S$0L 0/  4 <0sD0 D 0 D Z0 P  pi0 8 T P $0  0.S0S 040. S  ]@P Q&: pvP T`R0 04$0 :0 $0t` W $0 04  80 8 0piD0<00000 S$0*jR0  $$0 :0 $0N?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 4j 0 0%@0Sڰ$0B8RS@  B@ 00  ST00@ @P T@  P `PUfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 01PP  $$0 :0 $0P0SX R00 04 0P SR0(KoH000  #8 R 0(KI -pQ00 W@@LMTP w0 0:`q@$0 3D T 0 T-P W$0p:$0<0pS00/S $0` 9 X@P.SP   0 0-LM@P՟UP10@S8 -LM`pV $0*0Q40#Q4 0C8S 0P$0=P4֡ 04ơ0 $04SFQ $@ 4 0R 4 P n0004P   :$0a000S  0BP 4 04  000 R P$0  `00Q0`V] P<0S($0@P$0`( L$  h/KP P0S @(P h(P04 00 :4S S 0{P$0 P4֡ 04ơZ0 $0040$  0R/S@/00(  Lh PPP<0sKP:``60$ `<0S$0$<4 $0  3P @ @   L0P $0P:$00`S004P`0I -0L M@p 04 0|(RPP4P v 4P p40$@4 0$0  P @P_ PW 0`<0(oP00F @P@ L000<0$  0P $W``Vp00`@0` 0@  ATWY J` ]P `0 $$0dP$00$0Y O  OOO040 4(Kz0 p-LMXP0@S$u0` 0lO0S$o0S$nbOxh,pMЍ -LpMKp<`P'0: S <P00(3RP PU80@100(RP 6OP 0@p$`0 @``0@PK 0-LM@pP  00R00S P 00PP 072  8 0-LM&p@P PP 8-SM " 0\0  0\0 Ѝ -LM`Pp@P PP@@ PP@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00  00@ @p@0TP< P40Z* @ p8 0R㖃' (R0B▃*8 1<0P  <0d{ d p<0 eu <0op00S 00  00L8 @0B▃*p P 00S 00  009p@T/< Pf 00S 00   00  fH  0TP<0P4 00  00Pf0hpgS08S㖉) c00 0j PefQ!Q 00 aWE <0$U ; e8 (0 R (K -0LM`P0p R p  屜P   @!R  000lRڌ0 0  0  00@ 0-LM8P0@S$K0S$K0p&*o*G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝ@ -`LM@pPUq ("000L=QN FP| UCd33384T P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-<5<5440000r 0  PR=R  r 0  PRTV*0SU `D@$* * p-LM`[PPp@R0S@ RPT  0Rxxdj* 0-LM@P PU0. @ Ӛ@P0/S P /U l0@P  Q0r/S0Pa U: @?00@ x008X ,* -?0$ LM0@S`0Slp0Sq00TrPZ 040 u$@ љ\\\ -?0$ LM0@S`0Slp0Sr00sPZ 040 D$@ ⠙eee(MЍ)*0 M!Ѝ|o -LM@R$  ,  `}0A XK00C 1 儠K─K0 h!0!S @PpP P " _ ! 00P !P L00L0 60[S0 60KQ Q , L0 0, L0 x00x0 00 0 \3 K0 > K> K>,K > K> K> K> K> K>T媙 A p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K <P  0[ S S00L0  G , cP  p0ST!X0S K i>K e>K a>K ]>K Y>K U>K Q>K M>K I>1S \1S ֧T4P@!TU!R i10 qQ P@p ,0 S(KC(Kh|oPj8DtxM 0ЍnP0M00ӑЍtP0M00ӑЍx MЍlt,@ 0-0L0M0P0 @ DK<00<0 D KQ Q QT LG@00 0 SBK0ht,t,t, !* -LM K'P Kwt@ -LM`P @0S 3pP PUP >P -LM 0Pp, 0-LMPP >00@I@@I @@8MЍ, -L M0`SPPS?P 0K4K>@P 4 R 0#S S 00S# S0B40 4 ZP0d40 4LPPk 4 v40AP@@0 S SPP hApPP  A00S ?R0Sp 0SKP PW@Pp)+ S S@" 0@1U V?P%@h! @00000c0P@L\AP p@T 0S0 0 (K0 -LMV0P, p 0-LM0@SP$$>&? 00 080MЍ, *(****#*'* *$MЍ --LM0 0  K p-`0LM@`PL H9T  ,嫇, Wv xh9ꤽHj\+|ﳨ* p-0LM0PS0@0S @T00SQx0 d0 0SXtU= `K ypPR0S ]Hu Kpp|p -L M@ 0< rSwS 0 S8 eS0S 000 'K, ,P 4KP 20S/pP P A10S&40,Hm1Q@0S0;@T@ P0rS$0KAP p ヽp    zp|<0  ! }p0S@ $0K@wT@@aT@@$ K0,0,0P0SlĖh, 000, S D8 0eS ;p  5 $Kp|p`&L -0LM  -BML M20PP ,0 T$ 0S /ΕPP0 L4 04 J\崕X2@P@00 c]0  ` 0| [BKJJLT `0SPa P 0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$ BNK@D@D`PL$R 00S00 ,0 S,?(Kh|0HT`L( 0M ЍA --0LM00  00  0  0S10 c] 00 00 0  0S0 0 S ? Kh0 --0LM00  00  0  0S10 c]u 0000 0  0S0 00  0 S L? Kh8 --0LM00  00  0  0S10 c]: 0000 0  0S000 R 0 S? Kh@! !z^ - PLMP@0$K<pP3  㟻`P- R $00R @00"J@P 8#$0 <0$0  z 40P$0,0@,0$0(0 0 0@KD -LMPQ`PPdp0S0 R r A0t03U0SQ0@S @pRM 0S0 0A R RЍ!￥*ﻥ*; -LaM ``0 pP@P@T iA \00 c 1   ^@P(K -L MDCDß`8 < 4 =@ D0 坓Ppfp0@P0H0 0 * P"ՓP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sm <0:Si  qdzO @ X B R00S 10S <0:S Y0|!S 00<00-0BS QP1 R408!,1 10S410S000S <0:S.0 S 0000  B < 0:S:?0S 4p0 L d00S <0:S\ H0? D R0 S(K@  -LMR0 4 80 m E0S5  0 s 50S 墒P -R d50S+RL-R+R0S858%00,% u0< 0S %00S`04V4$P4u0D @40 0@d0d0@t@0|$`0[40lA@-QPU+]P'<44,$Q0 4 `@  Pu` @t  40[0 e0b#0000003pw #0s`U l-U0SL0S@H3 t0  4010 g0b00`0"8Q# 204 1R -Q 00:Q P48 08p`N\rP@`:V@ -V0S֑P-V0Sw 0S!00010S 0:S1`?`e8 0R0WV0S" 0;S0Sh!000S4010d1 X1R0248 0`$!1 ;0:S 0S4 000/000S@0:S 000S04 100 0S0  0:Sp0`0:S:`?`(D 80  `(KD@zh -L Mm K -L Mb K -L M 0W K -LM@P 700t p-LpM`@T 8 lKIPP D @0  0: S O0 0 ]8 P Kpt,0 -AMLMt3B~KpG0`c,0 pGIJP3P 5@P <:PPC, P 0#S    P@ ĐP  @ᾐ2PŸ P 1 0DT` P 1 04S|0 P 0#S    P @ @@P 1 0DT| P 1 04St + 4 Q@0ᓐP'JP0  BP0  :P0  0Ph0 (PP< d ^@T4 ,0 SD:(Kh ttp0-04@$ 0-LM@P P8PP8 t 0-LM@P P8PP8 t -80LM0SP P t t@-PMP 0 S \S@0 0SS0D0@SЍ MЍ UPU 0ʟ (U00#U00U0|0U0h0U0T0 0, 0~ 0 -P0 Us4P )1@ው0p P Aဍ P0 40 4PUUR P 00 0'UJ4P <ɟ0h@b0p P 8@W P0 40 4P U U) P 00 000  0K4Kc0jP 4 d0d8 0K  0[P  00U 0K0U0K 0U0K 7>P 00C0000r 0K;00K 0(P 00C000UXp@0 0 P0 SP@ڌ ! P0 S S 0000 0 0K=0E 0K4K' 0K0P 0K4K 0P 4x000K4K "0 000 000C S0K4K 50 s0K4K5Pm 40%v>C 0C000z a0Kc0PZyU0@ }P0$(P00 h qPT0$00 (C 0C0!000x1@S 0v~ p d:P4p3 0S\10 2) 00C0040 0!4 004 0R0 0% PG@{G@@@eP0000 c 0 S 1X0 00(KlHtDt@tD ,8@Ln',4M0Ѝ* --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 0  PKⳀ0YnKⳀSKl0NFK|E E t d5 Cr@PiLP@$ 0R5 Khv@MЍP 0MЍMЍ -LM$0!  0-LM$@P;P;$;P;8h; p-LM$`4PK@.0FkFP fFP8d00000S4KKpt -L@M$@ 0PR/ 0`00dpKH` 8` 0LKrF P 4K/#40L0 d` `0 Pd@K0LKd0 `00S$K -LM`Z$P@K 0P||8J`Q9>PP`XP.JD;`E@1@! 0$P@ 0@rK"~K 0 oK . ء ԑ EKP 100@>PxIoK g 10S~K::` ,0 S3(KhL -0LbM0K 0 0p" @!@Kp,^K`㎉P|00 PNK0 0 ^0 K@Z 0 S3Kh\ -LM   K 0K NAp K 0-L MP@GP  HP FP  FP , 0PK0ԗ -LMp`@P P U@P -LMP`@FP< pW庆W0S1T0S S+W) P$=P@IP `P0P0UV @#3`:0S:PP -QLM ,0 (@ 0 0 @ 0$0 0 ,K KGϠ*MP,$ |xtplhd`\ X TPLHD@Ѝ 4T|$L,h+˙* -LpMK@P`  : SH  l0S4   K(<Tl -LMP: P -LM@P Pn9Pk9Ph9he9 -L$M@ Q< D0 R 0 @0 @0pB@@0iPI40 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  LJP 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@4 T:;PH 8 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  |Pn 0/SSj @  忆0 bpcZ_  嵆i pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@40Tj:HP00@P8 8 <H@U8(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN (0 @Tp  pG DKP (0 @Pp T0I0 S D @ @e0DK as#Pa0  0K+P`0 R 40R 0S 0S 0A 0 U0sr t0"S 4 0D4x64u6@P(K -LMp@PP``4` P[ 4 Kp p 4PQ O6O4PK6 80P 4PA6 0B+ @"0 P07%`4@P,6@Q* 0KH 0 PR` 40R 0S 0A 0 U0sr 0"S 4 0@ 4646@P(K -LM@P``4` P 4 K5p p 4P 54P5 4 0P 4P5  00"00w`4`Ppe5@Qh 0K 0 @RP 40R  1 T0sr 0"S 0T`500 YR00 0 MR DR" HR R SR) WRmR dR hR wR yR sR0 <0< >. 0| t0p h0d @P00p40 40SN5@P(KQ: 3 -LMpQ@ 劃1PpP /500T  0`P 0 <0{`P0Q. ,T@0T7PP  5  0S,S00SQ000S0S 1`Wp@TP 5PP8 X4V4(08| @L -QL M@P$ 0 (P (0 7PPhh!_0pQ0Tp00 0S4AP@!j04p8(0S5 (KP/ 0 0R ꈕ|0$(㯮`PI@̂?P00Sh \TL jb4`4pKXh|8  -L`PM ,  Qv`P ` Z60 S P LKd&0᷁PTlK H&0ᮁP8"KP= @P LK= TLK5lK= TlK5U* UO U~@K0 00@K0   00@K0   0LK0@K0 |  0lK0L@K0 00@K0   00@K0   0LK0@K0 |  0lK0%@K0 00;@K0   001@K0   0LK0'@K0 |  0lK0x t K$P0 0 00 pW> @P 00 `Pd i  @P 0@0뾬  YP  0O 7P 0 A P 6@  ЍP x0 : P3 Tp K,P2p@p0P#0,S \S S 0 ,S@Up =GPp 0PP p2u P@T:p2> 0p0 P= dp KP85PPHp: R \R R 0 S S S0 S S  00 R  0L@p22t-)pP ,0 S`y+(Kh@Hpx(D\zd | 0-LM@PP@ <0 @80M Ѝ@-@M0S :S 0^S^@S :RS:SS0@S0Ѝ0MS  0\ :S|S S S 0R:SS  |SЍ 0-LMP# P800S 0XSxS@a A00A  RA0A\ W0AR70AS4$@8 -LM= `Pd4P, @d p P0 Pdd4P  @0:SS`PPd 4P@T 1E@ -LMp= CPPd4P `d@ k^S0S:Sh 00PU\S0P R:R\ 00B0S 0R00CP  0/S7S7TRP# ER( BR CR)$NR RR FR"fR cR eR bRrR tR nR 00 0 00:000UP@T@fd`4P `d@0:SS00T@f O4P`V 1D` -LM4@P %00000Xt`tTt\t p-LM@PpPP0`0@@xH`003Px 0@ @u]xPtLtTt -ML M0ǟpd8  0 ^, \ ` h( l8 põ\VP h}PF 30P  `E]0 0Tx X P(  3P >KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  @(P U%~PD%0S@ d  0YP7 h< ~8 ( 0 p P D8 R@ <8 @80C88 RppF0~P-3`P1  \P.`(\8`%T%Pd p P |xHx PPH(W:|+d8:Plğ0Sd02@ d @P(Rd$T+0|8H p0 SU!0U@E\S 0X@ U:;Pf3PV/P^ d$0fP@`XX d @T0#SS hPl(R PP0:S@l~P@T80T8 T0S*.K B0 B0CL p( t8 x = =pPn @0S :S@DxptT(d8PPP uP(Rdp$/pvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f p2PVM/P^d3$ )f0f fpPXx `0H a@G40(G 3/ DP(Rd$X8f`S0A0 R2P`V / p 00 L\(p^p`/Ypp ,0 S,'(KhPtLt 0p(  -MLM,30(ß,0 $3$C0 <8 3R048 0@ S0$P 2X "0S00f  1P BnK`F`F⌢{8h PP8Q(: +0P`8 P"0S00#3@ @P@Te#1 @00P@Z I$PS8(0 S8( U0U E\S 0U:;@h1P= 0hpP000S#S 8(81f/0$1 h 1 KNK@D@D PZࠟ(K0pxC0`KA PA@0pt@T 0$@/l 40PS H0<( 3.T P,0 S, '(Kh`tLtXtPt0Ttp, 0-LM@P8h -LM 0  K/ K 0-LM,@0PS0@S8p 0-LM,@0PS 0@S $8p -RQ3LMP@ :Q @zP*W000@00R O @10S0 R r 1S010pS000 P$PU  $Ppʸ00SƱ e4Z000Y%Pp`e t00S f y `(V  Z 0f0 0 0Sp p-LM(0`SW@0P0-00Sぱb=0 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00SYxp -LMQpW0 0 -M 0 S S@nЍ -LHMX@K 0K YPK -LMP0P :4 80 @5{P> `P0K0 00pZS00@ % *,{PP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H Q낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ xzP@t(U@࣡0a08 PRP4\X00 S KB.KA BxA B;8 ZT`P@B0S`PwK@@0h(pn h<!PP@ @nK`FH`Fp) `zP p Zz0PY00CS00Ӥ0b PN pL p @OzPDt (0@P 4P t T@<$P PKt0C(0C8hp@ @<+8+@P08(0@ ,0 S $(Khdt@L0X0 -LM0 @R r 1S01W#P0 0C0  -p-1L]M0PC/0 `>KJK\1 0Q ,Q @K\@0C\\4H .P`|h@\ xpt X\ 00`Z `  ,0 SX(KhP@D@P`MЍeP0MЍp -0L M @ R R R0ᓗ0 PTxh h0t R@0@0@ 4t( 0000K@pht H -LMhU5 0-LM0@$K$ R10t!sp PLH1$ PL`R5LLh T 0 sp P# @`R01S 0 s |  0spP,T,ctPD@ sK0htp$<t8Lcu0| -LMh4P0 !MЍp|0(0MЍ -LM0P00MЍ0@-QM@ Q QP0P0P0PЍ0 0-LM@P0S phT00SP%8h% -LLM` l ps(P \\B\h4 00m00hd(PP BX4 00]00x0S l 0,@P^%\%k04,"400S0 ԩE1P P0 TA 00-00pD "00@0@@8K BP`` lh 04 X \ d@ /hK?/P0S! T0T0L0Stl0\0(.P 4@ 0000$$ (K@0"  -LXMP` t  x0 Q40d pP`l0 p   R0d R0h0 4 P0K| 0 P ( l 00C,̠Čl 0("Č#Pj,@K  WmP ,0 `@,  ,0!0S0  AmP 00pW0bdCQ C@P <`0S!K1@@ 0p $Khu -0LM`P@00 <  0S 0 S =S00SR 0 0[<fm 8 0 KlP T00K @Q04@K40  40!0S0  lP0 00Y0bpCQ @P) 0S!TK1@@0P 8p 0P@!P 00! 0S0 =S=00<0S< 0 (Khu -LM@$~m@P0 @~pu -LMp`~@T xP mP00 @ťP~U@l V*(~"J }~putu 0-LMX! 0Pr~P5!@PP@T)00P8tulu0@-LMP@P 0 0S 0Q0cЍ0x"p@-`RMP@ L 00S0\0cR ^Ѝpx" 0-LMPl@ 0P@ @J8 -R00LM?@ D $R D R@00˷0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0e 0g 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S ]0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KD -LMY K -LMKYK K0P M 0ЍMЍ8J0MЍ)J -LM0  :J K p-L M$@K`PRY0 ;iKpx# --LM0 0 K 0P M 0Ѝ 0-LMP$KaPU$0K$KK0K|* -LM0 0 K p-LM`P @T0. @Jk@P 0/S @P0/SP|0/T/ . @  @P0/S 0fP U:~@?00@ I00xu -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 媴P <0S D0K 0@D0 @@ DKM 0ЍQ0M  Ѝ -RL MP` ?R0Spb10S]>,00P @0P10 000 R r0 11@ppp NZ@ ,K0 K,V@,` XPp,0Vp `pX@ 000C 00 0 t00S ,0VKZ@0@`0  f00 `00S$Kp -LMp$K!P$`@@  PU 0SjP@ @TT00KMЍ -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0``A"p@z 0Q XPP}  0``0"p@o0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0 P\ X  h\0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 PG0P  ` vG0S0@@@@P 0 B 0R #P0 bG`00T QZP RL G 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q Eh ``  G`P U00L0p00X 0Wk:f\0HS:00\ ` `0@@\V(Koz* -2MLMD4@0TP,0 `1`0-V  ,  "P 0`< 0/S0000S BK@@+hp@P ,R `d+glhBK@@+gp,#XW00< >K0C< >K,BK0C0CI B< I0F, < /1hP PP"@iT  xF( K0Z (Cpd  #2,0 /S \2Xm/00  ,8[Sr (hPm h@P Xf<@/0f@]+h!PIKA@P 0STZR<0U<: SA, R~>01L!PP>( K0LC,<[/S@ X<@/0@fZ ( KP6 P1 PP) P="P+ P P "# PPP P2P /P 0P  1P 8P5P 3P  4P9P+\P+[PIP CP @P APFP DP EPBPP  NPMPKP LPXPRPYP ZPqPoPfP dPr. mPlPgP kPx|PvPtPsP 3P }Pj2P 0P 04 040 0DKOPDKpq QpDK>PDKpq} Qp W0dQo Pm: "|040 0[040 0W4 4K# K0K0 WpW PT Qꓰ @% 匰@ P UcJ,QA/O4 0 4K( K0K 0p0 (@K0 ?R%@f/K0 UϠ4K0K 4@ p!&040 0R 0000 K4K0Kp   H <  +!+K0i @-0@0@,0M0$00 00000 0Ѝ#EgÉܺvT2 -/LM0 @ lK,0 B1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTc?1 0 @?Rp0@`P@Pl@  H<@@P?0S@@:  eo4< -0L M0P@ 0 (`K  !>@Tx ~op` 0 P Qn/B(K 0 SJKh### 0-LMP@!1 1 !320QH8hA-0@-RM@P \4, 0L 0l51@PЍ0$MЍ --LM0 0 -LM@PpT0` LLT  0N0$Y=  '뤽Hj\+| --LM0 0 M Kho*o*0MS  0S0 0S Ѝ PM Q 10C0 Ѝ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @;8 0-PLM @:8 -LR0L0M@@P T@ lR0  0 R B0 0 \ -0LMS00 P@0Y.0D0TST' T%0 `ZPpp``UVZ W@@ W G00 [@0 0  00`(Kn*n*n* -LM@0Sp \P.0Q 0 \P"P 000P0 0\P 4`4P4协  @R00yyy{m*0@-RM@P \4, 0L 0lRQ@PЍ0Rm* 02 MЍmNA900 M Ѝy 000MЍy( -@0LM0S*  0 :900y(mNA p-LM0PPP $`@@PJ 0@@xyyy -LpMAP; aPPP5 Pll`P `10SKp8FLKQ  AP 0LK ~I0PP P)@开p@0#S/S SS#S0@ @ r 0#R RPpD *0P00 Kyy#0p4D -LM0y -LM(@0S{0P00y -LM@QPʞ00J,10SȐ0 R r 1S01D p00SYP W)0P+ ᳐'0`X@1@!  0P d  @f 0d  900 0 d09pX0000S p 0-LM,@0PSv0@Sx@8p.fl*Ibl*^l*6 -LM` P@0SV ~ZP 3pP @TP @ -LM 0 0PyT 0-LMPP 00@ @@ @@8MЍT -L M0`SpP 0K4K@P 4 R 0#S S 00S# S0B40 4 +P0d40 4PPz 4 Z840P@@0 S SPP P P  00S ?R0S`1P8#8 $#$(@"( @0S P PPP/ 00@% S S@! 0@1U PW@XS @00000c0P@H@P T 0S0 0 (K#0# -LME0PTy 0-LM0@SP$$W 00 08#0MЍT 0-LM0@SP 00400S'0 R r0 110 0PS PP೼0 00P @0P 0 00DP 0D0000000S8p 0-LMH0@SP:8D PDHP8 -1LM0S@֎0 R r 1S010SjPH  P Pe0 :0 a100P`PP f-D7GP `P 0`cpPD 70P0f00PD0P0DPS ᅎ 00S00Pp p-LMP K2`P@' @P$   n0P00ı@ S00"@000L0`$0D0@,0<0(080 0 0 04KpD 0-LM0PrS wS aS<? 0@00eR8 xR +R ; R 008 p-RQ3LMP@`:Q CVP:xh 꼣 00x -LM @(00S0`0000p 0-LM4P0@S͍0`000S 8hˍ8p -L|M@T P' ( R ~ 0Nu0SZ ZG ZE :0 PP` 0  pP`q0S  ᐍ 0 00 0PUoS <0PUo R 00cPo K  0 0 40Si. 00P`0S 30S 3\ 08CJK P0: S 0;00D ;L 0ZpK KPTpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0P0 000 00+L00cPo 0 pq# 00  P @0P000PW 00 MP R :0 e00 00S0 ᢌ-{P K 0 pq00S ጌ00P @0PZ0 000 0P080$0S u  (Kp0M/Ѝ 0-1LM0@S 0 P0X 000@0D #PG0P00P00000P @0P 00P<0S0 80080S 0 90T088  R0  $0X P  8 0080@000088G0M 0 SЍЍM SB0SPЍ -R00LM?`$RZ00~2p0 Pu 0-UP  +U000 P 0  v 3V00S 0U0XSxSP`p R 0U ``00SAASS0 @R Xf@h 00E S u4 000. W070 cR(Q$00S \ 00R00S b ,"  \00R00S,, "00PZ QG (KD p-0LDM \@K:PK`  3 0@K @0 40 L@K4 T0 H0 D0 L0 ?d〔h%$% -LM@LPpA 0 /T #R 0 1 T P@36:/0 T P`$*?XQPdP0@ !S0P@X P*0`@@ S0f SPP@D"@X-00@ :D% -LM0@!  0 K0L% -LM`p@`P0PP@0  pv@PTPPKH%`% -pLM@? 0 0P  D  -pLMP' 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ MbЍ -@LM%  n"H900D9 -LMD9@SD9 H 0D9 -1LdM0`P 0 冞1p4@K (Sx@ | 勔0 RS0t H@Kp S0l h0 0d0 `P SV\ X@ T`  0| QST h0K P0 0L0 RH0p0SI1 0 S(:Kh0(H0 -L LMQ080 000 0 BS S( 000p 0-LMP 0@Sl000C L{8:#:3 201 32 l80 1$1 -LM0PC@[ 0 0 b 00刡 0@ 0 `0D @1p0W00  P # 3TX0#0300 0 p (K<1 p-LM0P,  0%R@`@l90\ lN@1A.S R00SRPxT1 -LM 0`^0 4 ;~PrP 01@0鎐cpPI@  @Qp 1@T  0A !0S0@0pW:P 0 P0 000@C0  BP0!004  00C 0(Kl1 -t4LPMl$@0, 000(@pPlKX X X` ? |P( K0 `DCPCQ`3`<0C<Sw8\]\]]L\]]]]\\l\|\]\]]]]]\]\\]\]]]]]]]]]]]D\]]]]T\d\t\]\]]]]]\]\\]\]]\(00 S,(0( 7(00 P2p0P"p"$P*$(P&p$P"00PpPpP P$P@0(000 p$(P P p P p1 `V 0SyXZA P, pP` 1p`zbP@?  Q  Qi:B< 00 1p``bP 00 0 0R@\,0Z0$%Z Ul)0@ P p00S QD0 0SX 00 ,0 S0(Kht11h01pd0 -LM@`,$\p00 l90^ \U>0>0W <LeV'1Zf52(L%QU" V U1A S1a0j1 0S uP0S 0 R /% 0 ^ X& P,a 60 0S TP0S 00 0j01R0j1 0S+ 0S(  OO#V P1 S0Sx 00C0ZPh0P @0xa0PS HP( 000(KT111p ->0>0LMRP8 n1"( Y 8P8ce10cY cp`0 1S PT01Xa140a1!010`0 X 00( 0B0P40 A:i0( BaVp0S8  ) 0S  8O8011 010XAp@@(0X@A !(0R((Ko8(K1l111 2 - 3LMp@Pk *"*RP R B0RP Ub;$ 0b S:XWR U53;2 @T $a KOPXD R 0S R>0>$ 0+ bLN. . $ mr0SU :N0S  ;pd !9T I@TW PP\m @pG !0 1!08#(R!1 S1@10S00@@1S$ R00 1Sl0 0S N * 1S1100S00@@D2T2`2l2$2 -LM`Vp# P0SN0 @|0T 0SNdhCX@00S0 h0 0CR0NÙppx22 -L ML P8 < p`Z$8 0:CR*80>0N@ <0pPP 00q0 pP  A닙P$Q a ANPthe0S $ 0b S*0S bFM $0< c:b0PPB 0S?;%0S:<0S$0$ c h b., 0&Rl90Q 80@S08 R 800C10 @0P0U40 *0,p Y:3), 1 ""p  0 W0 3 @P0%_p0#  0@K 00S0@@00@P 1P R0000 L0U 0 *\Y# ᰑ01 R1J438#811  MP  u0S00PP`6:39 )8#8!1Ბ1 !2R0 B101!2 Q 4 @0S00P40P0  0PO 0Rt1Sd1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00t 00c0!2QB!RL0P<PU 8 R K(K`2T120h -LM`4 p0F80 V@@T0 P20SLtRt"0Sl2 PX"00S0  V W!1+@Y$0:CW.*>0~ Vp:X Ci0Vf  0pP^ 80 0f@T `P|+ePaPT"T 0PP   Y룗@ 000$Q a VLP 0S$  baK 0 0 BS vLT p0 0S xy 00u00P040@nPl000@(Kp22l1`2d -LMP`T(1p0S?L1!@1T PP9VU3:U IP *00S)L0 0S/P@0Q P e\ 0 0CRP0 LU 80 0S 4 00 pp2d p-LMP0`0SK0 @0T PP#@00S0 P #\ 0 0CRP0KU 80 0S 8=͖ 00ɖ`xp2d -L(MpṖ40@ SK4$@4T P+$0@T@ e@"TX4  @4P< \<@$ 0:CW:@ 00.0 N^@PU\$`VPd@ 40D@ 8P ED @P4@3D0P: PPPQ4!10b1Q@"(0V`:`@D8 2P`@JD`P@8@ l2P0%\@DPT ,20S8 I <`@pet6 8P1 `-*$Q a JPS$a JPJ e40 <@ < W0S$  b gI0P<0@P, WW !0S 0S00W0S gI W00S  @P WY Y 1 !D(@t`0 0 BS JT @0 0S X냕 00@``(Kp3$2T2l1`2d 0-PLM@8`GPP:G8 -LMl[h0Q\@\P\p`0@XPC/``IUEO,x0 hr[4\4$zMЍ P -T1LM0S @Z[ 000SL`K`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0qPҐ0SPPfʐ 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@4}0#S  ,0 Sf(Kh?B$3 -80LMQ< 0( MЍMЍMЍMЍ p-LM@PU@P" P<\04`Kx0 @ 0 0(00<000SKp0MS S. R > R 0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ 0-0LM0000PS@{P YP qP  lP 8hf8 0-LMP@@P 0S S RP 8hL8h+8 0-LMP@?P P 0S 0HK0M Ѝ  0-LMP@P  >K0h 8 0-LMP@P  P 0S S 88P 8h8-$$ M @ ЍMЍ-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0 f! 00 08 0-LM0@SP*80b0 Q! 00 08 -LM0@S0C0 ,<4("4!< K0 5! 00 0K 0-LM0@SP0C0  K!,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 嘫pR 8!+A[#BT081 4A `T041 081 `)9.005@81V0OK@  >KK<K?KU N/KFP@ ,0 S (KhT3MЍ 0-LM@PuP pP kP  8he8 -0LM (0 (K KMЍ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h8S 0 P U  0, 8S888 -LMP@p`P 0@S RV -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -LM0PS`p@ ST- (@$ $KP' $0S$ R :R T hP@XX\$0  $ h00Kd3M Ѝ -LMPp`@P( PU0S"0S :SU T &P@PP iT '003 M;Ѝ 0-LM @?x0 0$ S 0K,0 0(0 (u0 R r 1S01,K 0P0SuK0p -L M0S@ 0 0SWP ̊ 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:P 0 0b00P0P  UP! %0 0e P0 #0PW  000{P o W:,PP e 0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  0000P $V ,PP  0 0f 0 P000S00 P4 00eS0 pe0 @00 (K p-LM0@ `V  00Pf`0 ,Pʼ0@00x`P` Ux p-LM0`0PSs0@Ssxp 0-LM@P\8hT00Ss0P 00P00Ss8p -LML`p@P0X@SpPUZ`VT 0-0LM0@S 0P,  00P @0Pp00P0 $000 0000S0B< S @0  0 0c0 800088 p-LpM0@8CP`JK%P00 ; 04  Q00R0 ;0  Q L ( 0R   Kp蘫 p-L M0@ C 00  K$ K` P0C0  0$0 S P IPP000KpMЍp -LM@pq0:00PT:0 p-LM0@ `P 00: 0xh7s 0-LMPPP00OP0T@80:08 -LM .dRM 0S@  RЍ0@-RM@P \, 0L 0l4 @PЍ0 -LM@ ,0( P00 -LM(0 :1PX(0  XaAFpP+   d<Nq`AP 1!0 1!(u 0  P1D 1D , Z00  ,0oE -PLM@ 0At 00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 02( K 8C0SP0@ U T00SR`1S S S KNP 0S@@ -T`p@0S ]P@ 0S  R 00@ ,0 S(Kh3 -LM 0@jPM 0Ѝa0M Ѝ[M 0ЍU0M ЍP -LM 0@GpMЍ -'QLM`$rP@ 2P0Ep@  4pd1 @0 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0KHexpate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PT@(@( @000 ?00, 0R(Kh3 p-L,M`0 0R0 P 0SD@K(1p 0 0S((bp@DK(0\0+@M0 H0040 0S00e0 0 SZKphj3 p-LM`0SZ1P00S.`0 @0M@c K 0 00C00S?1 Kpp -0LM0@S`,1뤀夠p00S @VP1P!M@c  / p0`e0e00P V00S m1pMЍ 0-@LM P/8h -LMhp< W@ D0 }P0P@p z0 /p700S D00< 80  80080 0Q `70S 88 `@ &Q `@4 B0 R@60S`40 030 0R `60@s3080 @ 0S0SQ  0 SQ@H @00SQ0a10c40 4 0PS pS(0+S -S 00S SP C >"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S PP000'S S SQ  R0pbPP@@ D0P 0P @T0U 0g R#1 0@00Sʐ PP  0 0CP00@  q0Rh ^000Q@ @dDA@ `Q@hwP D21 03pQgPpp 40040 @a PP 4 d4 0 p04Q zz룠/4 RE40`cV) 0S S SVX H/PQ  R 0000D bP0@0Mz IzP"00`W@FpT p0 20 2p 0f40 W? 0S S S70 2 000, 0bS( `gPP* Z 00CX21 030S@ 1) 0dPW 40Q4 p D P4@0 (K0 10M0S0C0R:Ѝ 0-LM0 RR@\ y P  100P:R0 b320 8 0-LM0@10 0s00R: 0RI PP@  ! 2  @0 1 8 -LM8 <0 P4 K00K@b `P? 00 i40R040 0  R5Y0S @TT T  BR \ 0210 32@@0Q&0PppT( `P 0@0y0@1 @dR P p X0}40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC A 0T0 ,`P`p 0@0XPp  Q 00040 x "00p <K 0 m @000@I (K -LMoPpU 0 > PD-P@ <- ,P5-8?0@T0 P@ 0H0 80 Dp D 0 S S*S +S -S S  00 0D0 0S 0D0 D 00S0XS xS DKH0KaP8  P  D 0D0 00S S     D0  X0 QՒ<,Є 00@Q9)0D0 D/P00@9P0P M0SI RQ 0D0  @@ 6D @0D0 0P 10@Sࠃ 2D X @0P@  0 PP0Є R  \BS  0ӓ"Є R 0ӓ)@D 0D0 00@ S00 ᴀ @EPeP90 y Dp D 0+S -S```0D0 00@ SD 0D0 0P 10@SDP0@ <,D0D /P00@9P`+0e\SVlDp ZDQ:NP IP5iP nP0D@KP) D00CD0 PD0 0D0 0 80 D@KP 0 D0 80 0(S   8 080 Dp   h 0`  R080 00c0  R   r 3 Z ``Q  6 VT P ڤ91H C ^"@ Ps6 0!!T P 5^Z[`P 0TKF4`^ T  9RQL LK 5@`P06L0 @`` 8TK1 ,"T P 05\TK!Pj`0^(ʈHTK1 "` 0eA " `~L8 2#TK T P 0TK8K<P 80S?Q`  0f@T=  7TK1 !T P 0y GCb46 56,ʠP0 LLTK !T P `FVHǟPp4656P0 T@K0` !@PV >F@d  6TK1 T P 09 FCb46 56,ʠP0 LLTK !T P `FVHƟPp4656P0 T@K0` x!@PV 5T@ PP 0#:?C0C PPTK@ K<0KPH  <0@a@0T0@0 v@0 0< @0 @<0 Pn0Ug U0 P 0 4@lT H~P<0H 0<0  R< r H0  H0 P080 RH 0<0 00dH7 Q@  0S00 $4X 0Pt [ ``  t jPx L t0 ! RH0]P| ? H  ! E03U<U@@5 P 256 b42Uࠓ> M0S0Ѝ 0-LM@P 0 S8hjD0C05 `0 C>@0C01B@`@ K -LM@P`PwP00`?0P@``kP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zv@Pp  ! _Lp 1P  -LM@` 1 1`P@ Dq> APU0S"PUPP+ 000S" ?@P `p @T0S\"@T+P@ 0S u"P`T5pq p-R00P0LMS P?P*0SR *0S0,K  c00 0!00^0S0c 00 R L0Pl .a @0Q010C  P 0Q0Kp`5p5 -LM@K 0 0  j | `103*2PRM  Ѝ0M0Ѝ -- LM 0   K -LMğPP,  P, T, P#\3#0#P[%[ 0 S2 lL 0NK@DP@D0|#3 p3 PP ` ^H, [`  PEP``0 00RD< 300\ "0 PEP``0 rb0"PEP``0S UPEU:00 00PEBKHH{-%T'0mS@ P^ L "0 "L<PGp` %S00W0S 0@pG@@W@pG@TB.K@ B BT<vP~KEpG0pG @gb@DT0R S 0  D,K0gT00c8< 1AD4< A0 < 0< kK@@ p0  LPPHKgT0`0H8< At0A < 4< 0 kS ,0 S@(Kh5z55585-5 -LM00 K -@LM 3 -L]M@ PMKpKKC/` `4 0 [TAM_KPE@h0D@KX0 KQ | Q 1 0 0RYKh5M0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 Ѝ$ (0 SM0 RЍp@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍM0S SЍ0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P T00c08 -LM0@JS000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?mP 0/Sh00m  -L MPp@0  dP000 p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@GdpdPR @ N0 @bT  U0B0C@;0P S04 0 \@ B1Q \000 O0O(K,6Q 0-LMPP)dEA%`88 MR10bQ1bQP00Ѝ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 H` D @ !@ 9$0  Po0@0S@T SUQPRZ 004K40 \P04pß0Os/< PL$ `GPU`9@H6@`Uį0p Z0@ dAP;p3`1 Qʭ P,C! ,3 `?HD 0n00a<L lpz}HWzG}G2WPd00@P00p031T0K`PX U 0 dP00p030KAPndؑ`0@P  dPp31XP@PPPp0@`DP{D@PfPPP00P <@P0<8P 0@  dPp3 00 P00bP 0P0!0X0 00 0L$P P(KP@D@Qnm$6?Q,6 MR10bQ1bQP00Ѝ -LMP`Up@QL0c0h% 0RM 0R  0R  0R 0R 0cЍ -LM0 00  lK0S lK< PlPK`< P  P\PXpU   00`K0c\0 0p wPsrP mnPdh\ 00``RPPPp3 10`0 XEp`0 S\ 00RPPPp3 10c`0 3P/DĔp0K``dV ʨp` @0K0Pd tP n p 3\0`2"1Q c P` \ \` P 0K Pl00;Q X0 v># 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K0P <0S@0SKlKP- @ K R  S ZʐY@ < R S ppSʀR~@p < ZzYwP@ K pіL RKx0SH 1\11`Va  A=0K4 L0R. 0pB=0P L0\ @0K 0O0SO80 4@ 0PlK fPx L0R80K@0 <@  PEW 8KpGJHZ @ K PoSR ?!0 @K8P 4` @P <` P00@K(Kl$6n,6M@D -LMp@P`10S 0'K@-p0M@ 09H00 NS N0S: 0C"0\ZЍ@P@ -MLM`P8 <( e0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (KM@DL*H*P 0M 0ЍYL P0 0M ЍPL -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =0$p3H*L*T*X*P* -FMLM90@,0 9Kp&IPT 0T00 NP 0:S /P 4P/S .P I0:S@0/S % P)*B^KPEPE+s++.P@ @̈́PDp@ H(sP0LPUIK966,`fV @FFH`fg0`j6fK $ ( @ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"K0#"F0aS)KV`@v KPK`P@0V0 SH&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6Sz K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg,#qK0(A 000 00 0  0  0 P ``V FP*Y`6 -RLLM`@ ,6p@ P01h0 @000 0<S @>>0>Sv dp@ h &p@ @d h@ 0Si 0K~@Pd  RpP00PU& <U @>0 >SP dl@ d l@ @dd@ 0S,S ;S 4KVP;00>C40 0 s 3W4 R0;S,SHK VP& 0,S#\KMP PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K V4P@ ` \0KMU T  G0  G0@ P 0G G0`00 `dP`p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S pdQ h d0 l (K66$H*L*$6Q%X* -LM@ P  hN6 p-LM@P`& 0S00lh0PL&P0@0 V40T(0(0x=0(0xTLBD<6 MЍX -LM@  -3L(M\4p 0 H L 0S 0S0S 0S~ 0!0Sx0Su*67 -lLM0SX@0 0R@P (@ &P?h{H@B -@LM%h$P p-LM,@PxhQ0S P< YPP,P0SEP% PQ0  B B,p P` 0:S  BP xhxPHH@BP*6 p-@`LM@$  @P$xPM P0M 0Ѝ p-<`LMP@~$ @y$xP -@LMl$ohk$P -LM< 8 <@K0<Ke4`K@_4@ 0P ^<KpTR0@ Qp`4@K0@P4@ 0P H<KT R 0 @ QQR* 4KP'T"S `p4K4@K0@P4@ 0P $<KTZ 0 @YQR 04K@4K(K 0-L M  @K0 K T?K0 -L0M@@KaM K -LM(@, 0#P hPX8 -LM(@, 0#P h<X< -LMh p-QLM@P`p`S@rP`& 0V pKpp@-`M@Pb0 <250^@ 0<0Ѝp -LPM@P`p 4`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KᾂKSK@PK@\ ;3[S @0K@P\ 23[S*[ q3[Hl3[ gQ ` jH f$HxaH ]$Hh@0K@P0\0 \6Kll PIl l0 SP i00CJ K 00S BZ J0Kh X X X RX R\0l<\LX 7\0x @l d@ T P0`P p0 t l0d P0 RᴠX HddPd!PPE` 8Rp0t@\x 0  c a"88c !^@NLl00a#0\0 000#Q@DAJlPE000T h0 RT P\ X^ \l 0Bn0X 3><A0 Q@l0#[[[2[x h[$[[4[xh(K@ -QLM`p`ppW <0;@PP0 X0AAQM Q0!0a0PЍ-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 ЍM0 3# R02 R02 0ЍM bQ B2c00 Ѝ@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P&"xZ᐀ 4 K80Kf,@K0PK4 800<h0H0, Q02[Z $KP1#3P1 <2MЍL7PQMЍPM3:00QЍPM3:00Q#2ЍQPMЍ ;; ;SMЍp@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@x -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpQ@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M Ѝ ЍLD -LM, T"`@pt3Z00 P T  W TTV1("SU*0U,!00QsKPI T 0W0T0SWT  !0Vt0RU/u P ,08!0P,K0K 0e,0|X 0SZ0P W T T0SP0S 000P ,K 0,0K00000  000 00, 0P, 00$KHL -,1LM0( s3Xp@` S P SS``(8?S@!Q vZ)?45VC"QqP0P_a( K(0@Q T< 000(0@T  030? KHL p-LM`P@'@!axh -LMP`pZ00 T0 G  0sRq0P00 0G (K -L :@KDK T0Z@ D0 J)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0IH@ D0e (K -LM@p`U@0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, K~(01(0 ( ,0 cA@ KH -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KM!V\?DE% U2$0 n$$ K:U GU 1?"C   $0( 2 N$0 A A4@K -顏OLMX`p P$K -顏OLMX`p Pp$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ  !  0$Z @tP0P 0DK4 K@0K00S 8<0 hT@KlXPK\`K8< d0@ P` HXLH @\ D@ P`T 0RX\@ ;#;SL 1lK D@h0KpK lX@Kp\PK``KX\ h0@ P` @\D` L @ P`X0LQL`0\ 00 00L0 HKLKHL 0PK-PH L0I(K -LPM` \ \h d0 (JJX@ Xd@ʠP`X $Jㄪ\X@p8RToOP&`@X<@ h@㪪0 8 D@ @ 4 `` XZ 0 0  AZ c0XZ  0X R  0 `ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@h*+ --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A l0F`KppX0 peKQ Q < Z1@0 0R"Kh=-R0 0c BSR48 R p-@P`x BRpR0 BRRRRM0S0  R0S 00a@Ѝ@-pPM`P 0@T00 S R B \0dC10 P  =\Ѝ -0LM0 0S=S` K KM0P P0Ѝ 0RR! B -@LM\:0S@d0d S0!*'R0 B\0` -LMp@W P`@P P P@DM 0SbЍR B 0\R#R! BJl*Sh*Od*`*x\*eX*ΠT* 0-LM 0@0 @P'K0MЍMЍMЍMЍMЍMЍMЍMЍ`#**c*MЍMЍMЍ2*L *1**>** 0 0C0S2M-S0!1!Ѝ0 00M100 00 Ѝ -LMAPTpm%& R0 W 0 0PX@ P  U印 00 凰AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1U0P  P P 1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 IPZD< 081  01 0ā0P(K -LMPp Q0`@\ Q QVPP P0S -L M@pQ 4  P n0 %`PC.P> Z) 0(10S$1 0 ! 0S 0P * 0P$1 0$10 0S0P  0 `P0 8#R H`00 4 0 P`(K -LMP@`QiPPq  Q0 Q000a0UP^ 0 8ᲀ#xP`=0 R  0S0 ` p=P(E000Y0n0@ 0S$10 (!$1 50S 0!P ) 0(10P%$10$1  0h8(#h"x 0 /p 0S sH00  10 -LM@pAQ 4  n`0 PPXCP- 0 PP #0 0S0P  0PP0 8#R "HP00 4 0 vP(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 {@KPtP 0@ kPJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@6PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00   8#8 @@0 0@ 0@00 DP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X 0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$HIX 8#8 B @0 00@ 00 DmP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd0P pP(`PP  0 0b8#H0T ʲ0S T0 P P -LMpP`@LQ\QQW@pT0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00WW800C80 -LM` pP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ ./P\$PPBnK`F`F08"o P:E?0xBNK@DBK @DA0A 04 pT_ 1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W @00%BT  @ F : : 8$P0@<P|/p 8$P UEO00 ,0 S <(Kh`? == -LM`pyQ 0P40 00 0 ? Q< R m@00%BT _@ H : : ᇼ4 P0@ Pp G P 40P DO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP 奭aP8 0,0ZP8 8妪Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0xh -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 i.CR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 .C008#8#H! 04 40P 00P00 00000P0C0@P0 40(K0= -LMP0@0P@cH$HX`p %X0@@bH$HPX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @^0H @cH$H4 @T000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0dPU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D  P040 0400D Q808(D40P4D(Ko(K -LtM@ 0  PP` > 0Ph 6 `(0P 00h"0  0@ `p| 00S`@d 0h 0C 8xp hp#X`p 00C8Sl   0\K)PXX \p0W T`V @p d` (^#x0`0C8#8 I 00l0ἐ 0`P~ dPP @a8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t aP0S H @00 0S DKZP; 0DKL K\000p 0S @0H 0 0SpDK<pP 0DKp0 L K>00008#X0S0S UH:dP dDB4 00c 00  0f P4K< K8|#8  08# l  ࿿0 0b00屐 00<0 00l80 08#x`0X0g8#8 I! 000ഐ`000h 000(K -LM@0pP\oR 0080S#80l G8U#h 0  bh000 R C CCC0^(1U0E(10 00G000 000B800C80000 -L@P/ 0`p( 0A 0P-L 0- L@0@P P $000A -@LT 0A -OL@ PO -0LM7@ -LUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlping6datemount_nfsfdiskgrepegrepfgrepumountmount_msdosfsckmorelesssignifymknodpwd_mkdbreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownchrootfsck_ffsnewfsrmmtejectmkdirksh-shencryptbioctlsleepmvdmesghostnameЏX8@@ ̆$Ў(܆ )@@,،40 <Dunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of input(4@DHP\dlt|usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbin(4@DHP\dlt|usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDx@@|@h pp p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 p  4  ,:  #3#$3,243<3D#L@T@\g@\@dlt|  @@ (08@AHPX`hpx  t(4<DLT@\@h@p@|    @@  C$CC$C ,8DPX`hpx  @@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPs`&&$&0&<&D&L&\&d&l&t&|&&&&|&&&&zzzzzzzx?zzz@zz|zz@@%%%%%%%%%&& &&@% @ @%%$@%&(@,@(@\msF@VT%Ŋ\UdbY^NIC`H"Hf*?m3D[Vzfz~]דg{qrkjUԨsשGa4z9ϣыFie&27M*Rh# Y\iƪH*uf&ި&\et@"xgiڿ΢L%7V_1|D*j*ʮ~ _E77s<`M. / ~tm JWWQB-oƇ<>_F/-Eg/4zИF;$. 8B,eSyLk5U,Wf{M s0>y\IIl M fU@x5YV 8n0 %0[ QTH2 6<չ>f-.gTSμ\y #*{N!a{͛:%QŰ?DZla)v9N'9[b{w,]E')}~ G^ԉ|}3J %;B:C{d %)Ss)װ*Y (Nֆ3 Xb|u=L76UnЉ h!ě\Vj=$-"G HrAMUeAh8i^@\UG8ǡX+071D:"ؐ!%xQ-j.+`D<멗Qs 4oq&`&9R ,zw&)+⬿0sjpdѢ8蟣E%ֲcKޥKPIJbMG:`L)cpS]&dUP JV%EA[R8Zk ,CUˆI46g,B?;׍MINY`ӉUqcCr,8JN!\S@p_! eB~$vSaDM=fa,LdD5ܜyƲ!-䳤6d%e3ʰElF3&䪷:WcRf50ݮn"fR\)ɢl*8=̮܂ 502hO۬l,6lyvxVe9rn1 O؄YY*tc4p}ɷ.3w‹/6@py%Np 䤙 E36xda좣5@B*AU6: [E3Z tp1batMÝXΣQaԼ$qP>t$&'UN 8k#Yn7&s뱝HU#?㪬tp"˪t?.9p*NJ f݄v KBۉ1 Hs*G?3 f-I`ƺ4ujK^ӗOKAB_' "Ֆ+*ô6)$q&-ij 7BtنDhj唏DЭ  ڠۓiYSf)E\ k lQY;Xף j[Nz)./ppLQQ\ OޕRU0w8FYSY ON/r}} 0vҁ%!욀m"UT\ ȕlV'ViTXxɦ]h4Q𳾧Op/aXU͆=VUXMUa-bs0e?2&?S;Y7X( 9 Raպvs2#2=Zb:P{rzq*N,RpzW/61z*׳1Jbfb)) XFf\؋Uy[Y!`J5XSL?Q8!&;ӯSaTuer/Pqaީܗ bcJR,Ս*;E r=YPǽJB u z'7Pyl=R4빮zI\˥l}xW5Z9efz76a61X, k x2ĻF7 A2vQ[?TUD'1Ko.4"*g.Ja$[+,$>%ybp  1B}0׮xylFy/ȮZC GGF]Yswa` yنRH9w(Uo_1fI ~ F5uι,qEAkȑlu[FniɄm|̀ݴSd6#p?N3/Gp jur*I'#@ċJ-ioyJ|1,K f)J'xPPaǣ yQŌ:zuޞ(L"y#1f^/ɮ8ffmyX7ZZ`mz$MfQœP &}K~ʇd.uB z6Iِ"Té[ Q~@v˅KDw S!̌\q:yђu䠯Uȸa3Atc>Xnm;#G*+4o/Tshz)AЏ s]½D?[UYXgSڄl־/?Ս(LPTZLVY.v \tKSU 6-m\>o!ď&躵Vv(#IL Р*Z._Zq2׶Yv虗*F6/} OBW,Rch 0mjIJ>9j:40tZ19? @H`3C v.Ĥ)=mډ~'!$rB@Q%AL)+oUDr1y1K ~ &-@-Q-/,RWLJoBy N;(ρG"JIhⲩ'Cu!џ/ ~Dk9G|WLc بcكT~_.!!)A# U ؂SBuJ-~,SW%6[Eˮhh\j yF*;q-p$t>Xy`FI:9#Zi{gۉQqPum({#bdW5Z{@_ }m!hW#q#cŷ5/!''@NzЌ!_ZqpGxH:;ijXZ9ɱ<)N`*u`]٘zݕ]¥rY6R͕oSo32~+5HSp=b+6 aKaҺ 0vl~[F49,!hc#Q)!^Ss|$s۲HS̫A4(57mei^\ΊH?; 9uL{zt %va\fzD[h ¹rRD bұ/G6ѩ>Kpt%۴q06 |g"Q}p:! O`NaHKۛ EjOy͞HCXAncmG/ӓ+H|VGlxF=*l]"ưK ({|c0 @Ģe^@P|GQ?SHSEީ‚joL-4D)<EsPNŶs Gt攤 cWq9"x~K%`lݬ?mACC%a'x=$tmF bV١]b3gW.i\/j鏔̮evUrjf{dD:@ɷk>)5E :xEQDVomYGN]$h!!~=_E2Z2lmՀp=sG_Q޳xCx#rm]uYg3!Qy?pึ= Yެ7TN}&_}+a 'p"D<>Tpj6}-h7^ +\eҔxI,?mQF'A˖GB[=(?6C}ʗtC{%_t6zNە#Tx>`a 9|1t͸n w_vbp $䟴Mzxxp8KGK&y9kǩ}\d*m qAq;wz(8Zf}amJ ĝ =HEoBnQm!ɮDmԚҞ9 m'<`hV^SM-aLbH5i(l5^bdJc2%FJ;IwfJ).c8,x?VWL%0Q瞺 m[҂^9<ɶCy4ZV)6kSԃv#]'w9rDA/ ` n4֥Y':mjo7lm⥍ &O`RO?xۊ0ɨOr`3ՙVBsEX[={Auk//>p4;wÍۃ y|>{TFɫiB, *9ej'vc/^v;D[Wܱg^S)Lr"T1=@JLhoUPjA8SPt6/,gإX퓷ӕil;D.(ЧoL} V\Z@MIe85/G&=3΁wphrEWusage: disklabel [-Acdtv] [-h | -p unit] [-T file] disk (read) disklabel -w [-Acdnv] [-T file] disk disktype [packid] (write) disklabel -e [-Acdnv] [-T file] disk (edit) disklabel -E [-Acdnv] [-F|-f file] [-T file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %sbckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tT:vwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cparse percent %s: %s%s: parse error on line %u%s: min size > max size on line %u%s: sum of extra space allocation > 100%%Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions can't get mem sizeYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to restore mode and times for directory: %sUnable to stat directory: %sDirectory vanished before restoring mode and times: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %sUnable to create %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open file '%s' for readProblem with file '%s'-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms clock_gettime(CLOCK_MONOTONIC)packet too short (%d bytes) from %ssignature mismatch!%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom&$&0&<&D&L&\&d&l&t&|&&&&|&&&&NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvtY-YYYY$Y,h4h<hDRL\dPlgXlg` hh hpx(Y(YT@|Ī_̪_ _ԪS0HTxpwoЕ ee$Ho0n<mHhSPhS\hShhS0z zt\|WWhUhUhUhUhUȫhUЫhUثVVhUhUhUhUZYY Y Y(@Y0Y8{@~LX~xzXcdclVlR,Stsai i@rLr\li`i irpu | `H#Ĭ#̬#Ԭ#ج$$$$%%% %&&$','8(@(L)T)`*h*t+|+,,,---..̭/ԭ/0000112$20283D3P3X4d4p4x5566677Įc̮cخdܮdeԬe  (08@HPX`dlp|   (4 ܯ < D`L`X\dlt İ԰G԰ܯܯܯt- $,Ԫ8 $,Ԫ8@LT\drandommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufound|ܷ@musage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap???Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)\%03oNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %d --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: invalid peernamefailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lusendmsgping6: wrote %s %d chars, ret=%d invalid socket buffer sizeMust be superuser to flood pinghoplimit is %s: %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadinvalid source address: %sdatalen value is %s: %sa:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error(4@DHP\dltt| (4 @<DH P@XL`lxusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [s6;Jt%~o;ixZ𻹘"Ddy|\,(MJEIZtUs+n؍(>Z\{?/ (D;?B/b+6`*SOE4TS" CSb!K~%?*xl1S90Tac{F"XAC"^ӹW 6{).?O8(p'pj&M"d,UwTYrEMW\t.ifK2̃*L.4  Pwy&,7:JD8M"T4kD(wN ..FR(dw ̮8(!,,z2OLcp,ȇ$$Rg0_]8UiP^)ʼJl3lRXi0Ӌ(1R?ȉR~R u my#1,n^>sA߫ ZC$p-zӁg!Hb&,h.3XHnEYr+~Tj0k ֊W^KԐDh^Җk8Jd0DZl8\ڻ&4KZ'nI2 PP?܉G UL@ؕGEXWF+2kMs z\ J:V ׄJA>oU<1<$"x6vNZl.u4pt[{p&ØgY Tx*$2kMh)N/XsJ$y= 4YD):w낑2x؞gMby)BbZ}l`: )۱CP DoO)Dqݵ>;B>h="dӇ͛N]rܴ|p15)AߊsKiD偶զJ('Ϭ8u-mhR$ m8AJϗ,c'>e9dRQt`8WK|"Xhq>;}PMf7* M)e,oQ~R u(bf}=5|چa/AXz'~};‹q,TPz]h88$xPuloʍ9|*#sa=tⳍs9Ao8lt< Qʠ/ݰ:ĭ9] Fz'x.Wo|!ݍ-?-s7ًcG?3~@Dp(97w/v׷4Z"Q=?'|1vchIl2R)5LsM\\ xz%|+ِ"42mt ;+%ϯ,4Kzjv)LtXXڠŇ*%2:F$bE.rJKcM>$@9r^g!֮Bvz͆8l}SD&yok(;:@AgYm֗rKyx{ۻ=")ș885FZڂ~xvWx8`KM}f΁iF>@sL$]kW4˰x[֪(Qhr(VIe&sDH["7X%W:N׮H/:5GT~P$5NgR%wR=7Ur,T<K>l i~fGEղT5_?쟝#["˗CHr?>0n%Y `mh8r#FITZ@iF1249LIdt8uf0>=O%p||<0AIy;E ht6_ t<NLt L˻EF^N/(q:W~ 0dt]|3 @Cs?9 FAeMek&2(1[As6v35x[\QY`s kdOBoetzMukp7Iv3fjكs+MYkNg&FJKʄ)O a5Y=y3;%6s).o{p%(xjTakoq7P0f__PS*=N/QG.պEޤcյ(uUY$!B _`",K,48SHj- IC&GK4"^[Tv'T[ r`v_*I! \P;D+{nLd@`sS%_A9Ner^"QNS԰ %rEQZCV,: ǚ[ZӨ*ȃCJ^s S=$xTB$SUk8aǒyW< %P;E %K{Y>[;Ru<8B90= FpC-i}(lŢ%tns]\ <"XV &XX? }-igE<dkUk|^oz#nq8pG;SVØq ҉av&Ֆ[1.uK4c \I_'/eaԓ~9qT+GȆ$:וyvm!zEԧEn2H{5H}q#&5ZH|Jpe4ozN0Q|&tN+Q1:.:2M &rv: ᫱ܢg4;,MU}﯒+cx S`fLCətWE"TkVLzHg#Hm>皔q؟OOX4WFt ;*56OLRBr,i/O%yFQO,2o;󷎂?UF4I*=]R xLɩZi[(YVC8=.x ^({ԜUsāϿſ.]dpLCA7뿗b YFB3E{p5s!#JR gt:&|B}SDv*=ٿÅNg:/B2?TOmT Ⱦ`N8x%ɾ$!˂r/si4usage: %s [-i|-u] [-egy] [-c # -h # -s #] [-f mbrfile] [-l blocks] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions -g: initialize disk with EFI/GPT partition, requires -i `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].ieguf:c:h:s:l:y-g specified without -iPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBR from '%s'Unable to read complete MBR from '%s'Do you wish to write new MBR and partition table?Do you wish to write new MBR?Unable to close diskEnter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.helpCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesTerabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Offset: %lld Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12llu:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %lld. error writing MBRPartition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %lld. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyPABZCD$E4FDGTH\U|VtadbcpedfxhiLlnqqrsvwxuinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:v(4@DHP\dlt|P@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %suser is %s: %sgroup is %s: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnxssosgulospccmcdbcti ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.]exec failed can't fork ------------------------ [Use q or Q to quit]Line too long!%sNo previous regular expression...skipping Pattern not found Pattern not found"%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** +%lld%s %s %s[Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** MORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- , )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGSVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.dbat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readable__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwd԰G԰ܯܯܯt-0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface table128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %smust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missing: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): (4@DHP\dltP@|`/tusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'5,LO"TOdO8lOtO,|gOOO'O BH O&8OO\O#O$OOOPP P (P!4PTzT&TTTTTTTTTTTTTUTUT$UT@ULUXUdUpU&|UUU\U\UUUU%VTV0V4VDV\XV&lV\V\V\V&VUV\VTW\W%(WT@W\XWdWTpWT|W<WTWTW%WWTWT X&$XT4X%LX%`X&xXXXXXTXTXY<Y<$Y<0Y@YTPYdYtYTYTYTYTYTYTYTYTYTZ Z<,Z<8Z<DZ<PZ<hZ<tZ<ZTZ<Z<Z<Z<Z<Z<Z<Z<Z<Z<[<[< [<,[<8[<D[<P[<\[<h[<t[<[<[<[<[<[<[<[<[<[<[<[<\<\<\<(\<4\L\P\<\\<h\<t\<\<\<\<\<\<\<\<\<\<\<\<]<]<]<(]<4]<@]<L]<X]l]<x]<]<]<]<]T]<]<]<]<]<^< ^<^<$^<0^<<^<H^<T^<`^<l^<x^<^<^<^<^<^<^<^<^<^<^<^<_<_< _<,_<8_<D_<P_<\_<h_<t_<_<_<_<_<_<_<_<_<_<_<_<`<`<`<(`<4`<@`<L`<X`<d`<p`<|`<`<`<`<`<`<`<`<`<`<`<a< a<a<$a<0a< n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScslz|zzzzzzzzzVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %susage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuid&$&0&<&D&L&\&d&l&t&|&&&&|&&&& @ ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvT& \h= `6 t6 lh+ xd+ |H #   $ @,6  < h+ h+ % Ĵ2 ̴" д" u\ ԴܴL[ A i M ȶA ԶM T C N A N L |\ J $tS ,Z 4@U <i DA Lm TO \K |DB dA T-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$x(4 ĸtظfcd sl0m@n-p  t  L Х  Ժ,   $  ( ,  80 x$ Hp X 0X h tl   t  t l Ի   L  P ( < D Pة ` |    ļx м |0  ̧    $( 4x @ H`P,N++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():`dp|IFS= ${PS2=> } ${PS3=#? } ${PS4=+ } ,xac&eiklXmCnf 4bu$08pTr`xfsDhPvX`l|x LT\dh p   x H{}4  IN?SV]]<>!let||&&() X`  8 0 `@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATHLINES nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --blowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] rounds is %s: %spb:c:Enter string: getpassInvalid keyInvalid saltToo few rounds: %dinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMdisabledalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial patrol %d%% done%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s'%s%s stainvalid patrol function: %sPatrol %s: %sBIOCPATROL interval=%d next=%dabortedreadypatrol mode: %s%s patrol status: %s target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-t patrol-function] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:st:u:vneed deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::1/etc/hosts/etc/group/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES#;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2pw_write_entrypw_copy`&uid is %sroot uid should be 0gid is %swarning, unknown root shell%s:%s:%s:%s:%s:%lld:%lld:%s:%s:%s %s is zero length-d-s-p-u/usr/sbin/pwd_mkdb%s: unchangedre-edit the password file? [y]: %s: line too long%s: corrupted entry%s: inconsistent entry/etc/ptmplogout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfszzzzzzzx?zzz@zz|zz@@%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefSipHashinet_ntop4inet_ntop%u.%u.%u.%ub0b1ncdtscsbpxbxfxoxtxdxInfinityNaNlongjmp botch. SHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread(08^[Yy]^[Nn]yesUS-ASCIINONEUTF8ttyname_r/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpassblowfish,8blowfishbcryptbcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhashbcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy/etc/ttyssecurertsctssoftcarwindowMD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefglob2ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattr       ,4@Tdp|0H`x       ,4@Tdp|0H`xSignal 0HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread AST/etc/protocols pt x|  #$HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRexecvpeexeclpexecleexeclexecvp: : path too long unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sfstabscanxxsw`&  (4DP\dp ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueX\`dhlpt%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT(,048<@DLT\ht| $( L@SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Yvdprintfauthunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory xdr_array: out of memory argument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownsetusercontextcannot stat %s: %m%s: not a regular file%s: not owned by root%s: writable by non-root%s: getting capability %s: %m%s: unexpected error with capability %sinfinity%s:%s=%s: invalid size%s:%s=%s: invalid number%s:%s=%s: invalid times/keyskeyauthmalloc: %mstrdup: %m/etc/login.conf%s:%d malloc: %m/usr/src/lib/libc/gen/login_cap.c%s:%d strdup: %m%s: couldn't resolve 'tc'%s: unknown class%s: getting class information: %m%s: 'tc' reference loop%s: unexpected cgetent error%s-curcurrent resource limit name too large%s-maxmax resource limit name too largegetting resource limit: %m%s: setting resource limit %s: %m%s: setpriority: %mumasksetresgid(%u,%u,%u): %minitgroups(%s,%u): %msetlogin(%s) failure: %msetresuid(%u,%u,%u): %msetenvcould not set user environment: %mcould not set PATH: %mcputimefilesizedatasizestacksizememoryusememorylockedmaxprocopenfilescoredumpsizegetentcgetnext%s.dbtc|:getgrouplistunix.%u@%s/etc/netidnetid.bynameasprintft"d"too smallyp_next: clnt_callyp_match: clnt_call_yp_dobind/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD  , < ` |       !(!H!`!t!!!!!!"RPC: (unknown error code)RPC: Port mapper failure%s: %s - %s RPC: Remote system error; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Unknown hostRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory xdrrec_create: out of memory perror  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%h %e %T realpathinet6_rth_reverseSHA1TransformSHA1Pad/etc/shells/bin/csh/bin/ksh/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %slibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG`'t'''''''(((<(P(l(((((((( )),)@)`)t)))))))d*(*<*`*|*****+(+@+\+t+++++ ,$,H,l,,,,,, -4-H-l--------.,.@.T.h......//8/L/d/t//////Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedCannot allocate memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported       ,4@Tdp|0H`xwrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS (%d) in recursive callchunk info corruptedmodified chunk-pointerchunk is already freeregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmap roundmalloc cachemunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectdouble freefree():free() called before allocationpp & bitsposix_memalign():mapalign bad alignmentmapalign roundcalloc():malloc():realloc():<clntudp_callclntudp_create: out of memory bindresvport_saxdr_string: out of memory xdr_bytes: out of memory %$sniglet^&mktemp_internal_rs_rekey_rs_stir_if_needed !#&(*-/14ABCDEF7yACnF?O8M20HwZ[%ld]Error %dvsnprintfzzzzzzz0zztzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt(,048<@DLT\ht|L < $|-0%2d%03d%e-%b-%Y+%04d%a %b %e %T %Ysnprintf__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size  zl\|ܬD,  ȌdH`R@ $"((90Tj8Tj@TjHP\dltX|l%(p;'X,l`;LLL-@ep D\  ` $ ( 0 8 @ D L4 Lunblock and -DNO_CON 08`4U<  4U Q`[~ [~4U`@@<@TU 5U b 5U?A 4Ud* 4UQ 4UQ ~A4Uɛ 4Uɛ 4Uɛ a C4U-;4U-;4U-;b tӍA4U 4Uyl64Uyl6c qA4U 4U 4U d %\A4Uwl4Uwl4Uwle Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUPH*<w@$ D P^       <(d ,  4 < @-LPt\BT\dPVlx !L"D#D$%& '0-()0*+,-./01234567 89:z  <`x8X$ priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP `(x*\& (&HzpE( 0(EHC P E(  0(EHDHC Hz0y ... ...}}}~{\yoxunext f8fv(4@DHP\dltP@|t@@@......x  ĜȜ̜Ԝܜ4%{}abcdDgGhHilnNpPqrs tw xy !:#=H P ,( 4h ( (8DL,,<LX,lp,&0t|@`  0 ` |    @,< l 8    _ xx:xx:xx:xx:xx:xx0000000000000000 T/etc%%%%%%%%%&& &&&$&0&<&D&L&\&d&l&t&|&&&&|&&&&khRuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~<@, 8@R R S S R @U 4T V XT X Ozzzzz zz@,zz8 z(zDzz\`dhlpNtx           p& $8 (!<"L#X$d%t&'()*+,--..//01 234 5(6,748<9H:D;P<`=l>?@[\\]^^__ `0{<{P|`}l}~ (4LiXd   ( @d LX|z455 0 ` |    @,< l 8    ?zGMTUTCxvvy x$w|  $d( L###\LDlD DdLd\t4T @`p̓8Plxܒ̓8Pl56<< .shstrtab.note.openbsd.ident.init.text.fini.rodata.eh_frame.openbsd.randomdata.jcr.got.ctors.dtors.data.bss TTpp%tK+M1NPo9d=dChhWll\p=p$a=h=oDuTTTz#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 usb0 usb1 R usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap vscsi0 ch0 audio0 R audio1 audio2 fuse pppx hotplug ptm local wscons pci0 pci1 R pci2 pci3 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 R rmidi6 rmidi7 tuner0 radio0 video0 video1 uk0 random tty00 R tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty0a R tty0b apm pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi @ . ..GMAKEDEVHconsoleI ttyJ memKkmemsLnullsMzerosNstdinsOstdoutPstderrQksymssRklogsSbpf0sTwd0asUrwd0asVwd0bsWrwd0bsXwd0csYrwd0csZwd0ds[rwd0ds\wd0es]rwd0es^wd0fs_rwd0fs`wd0gsarwd0gsbwd0hscrwd0hsdwd0iserwd0isfwd0jsgrwd0jshwd0ksirwd0ksjwd0lskrwd0lslwd0msmrwd0msnwd0nsorwd0nspwd0osqrwd0osrwd0pssrwd0pstwd1asurwd1asvwd1bswrwd1bsxwd1csyrwd1cszwd1ds{rwd1ds|wd1es}rwd1es~wd1fsrwd1fs؀wd1gs؁rwd1gs؂wd1hs؃rwd1hs؄wd1is؅rwd1is؆wd1js؇rwd1js؈wd1ks؉rwd1ks؊wd1ls؋rwd1ls،wd1ms؍rwd1ms؎wd1ns؏rwd1nsؐwd1osؑrwd1osؒwd1psؓrwd1psؔsd0asؕrsd0asؖsd0bsؗrsd0bsؘsd0csؙrsd0csؚsd0ds؛rsd0ds؜sd0es؝rsd0es؞sd0fs؟rsd0fsؠsd0gsءrsd0gsآsd0hsأrsd0hsؤsd0isإrsd0is@ . ..GMAKEDEVHconsoleI ttyJ memKkmemsLnullsMzerosNstdinsOstdoutPstderrQksymssRklogsSbpf0sTwd0asUrwd0asVwd0bsWrwd0bsXwd0csYrwd0csZwd0ds[rwd0ds\wd0es]rwd0es^wd0fs_rwd0fs`wd0gsarwd0gsbwd0hscrwd0hsdwd0iserwd0isfwd0jsgrwd0jshwd0ksirwd0ksjwd0lskrwd0lslwd0msmrwd0msnwd0nsorwd0nspwd0osqrwd0osrwd0pssrwd0pstwd1asurwd1asvwd1bswrwd1bsxwd1csyrwd1cszwd1ds{rwd1ds|wd1es}rwd1es~wd1fsrwd1fs؀wd1gs؁rwd1gs؂wd1hs؃rwd1hs؄wd1is؅rwd1is؆wd1js؇rwd1js؈wd1ks؉rwd1ks؊wd1ls؋rwd1ls،wd1ms؍rwd1ms؎wd1ns؏rwd1nsؐwd1osؑrwd1osؒwd1psؓrwd1psؔsd0asؕrsd0asؖsd0bsؗrsd0bsؘsd0csؙrsd0csؚsd0ds؛rsd0ds؜sd0es؝rsd0es؞sd0fs؟rsd0fsؠsd0gsءrsd0gsآsd0hsأrsd0hsؤsd0isإrsd0isئsd0jsاrsd0jsبsd0ksةrsd0ksتsd0lsثrsd0lsجsd0msحrsd0msخsd0nsدrsd0nsذsd0osرrsd0osزsd0psسrsd0psشtty00sصcua00sضrd0asطrrd0asظrd0csعrrd0csغwsmousewskbdsؼ st0rst0sؾnst0sؿnrst0sest0serst0senst0senrst0ttyC0swskbd0 apmapmctl biodiskmaprandomsrandomurandomarandomAfrica/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08`4U<  4U Q`[~ [~4U`@@<@TU 5Uv b 5UvvA4U_r 4U)4U)`' A4U_r 4Uv 4Uv anҮA4U-;4Uwl4U bRK-A4U-;4U-24U-2cr$A4U 4U 4U d81A4Uwl4Uq+4Uq+e.4U>Տ4UpU(4UpU(fbS+h4Uv 4Ux!4Ux!h864U4U84U~pxP\M`A4UQH4U~4U~P+k4UQH4U~4U~iQ1?)4U"4U?B#4U?B#jx6)4U+#4UYs$4UYs$km:4U%4U%4U%/tmp/fstab.shadow=`4U(4U(4U(/tmp/resolv.conf.shadow  4U)4U)4U)/tmp/hosts$L4Uq+ 5U2 5U2 l`QUuQV9@@6.~7FG5f[5 hj/Uj:=iu*o\c+in}ݽúa-XEϒ@`ɣ{*`1~ #z_ G-s4ri\AAkn& DtxfE?[F&}֨t=*)Ƭ@K$~j듄fMϻ堣MzGSHKr TuX +We߆wYrw<ZRA"qmPIΩI8B`(Ar>7nd?E-g} [}֚)wLF;!ɹK2LzF· ʗ^n 65SY kjvDJ+0|x=ӨewYAU"]6_QB)<ċo3чZtA]˧(@ 'keMSJ+.0)Z1\8_Պw]NfA /US|Vp . ..firmware@signifygroup@ protocols>dpasswdtmpspwd.db services>asswd.origpwd.db fstab@ resolv.conf$ hosts@ . ..openbsd-58-base.pub . .. binmdec=iCsbin=iDsharei . ..encrypt ftpgrep@egrep@fgrep@gzip@gunzipgzcat@more@less@ sed@signify ... .D ..termcapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _unbound:*:53: _dpb:*:54: _pbuild:*:55: _pfetch:*:56: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: _file:*:104: _radiusd:*:105: dialer:*:117: nogroup:*:32766: nobody:*:32767: untrusted comment: openbsd 5.8 base public key RWQNNZXtC/MqP3Eiu+6FBz/qrxiWQwDhd+9Yljzp62UP4KzFmmvzVk60 root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $AUTO && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup ask_root_sshd set_timezone /var/tzlist echo get_rootinfo DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK=; continue; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK=; echo "'/' must be configured!"; continue; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK; DISK=; break; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user sed -i -e "s@^wheel:.:0:root\$@wheel:\*:0:root,${user}@" \ /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") sed -i -e "s@^root::@root:${_encr}:@" /mnt/etc/master.passwd 2>/dev/null fi pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) finish_up do lock if test -e /tmp/update && [[ "$(dmesg)" != "$(/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } getdevname() { local _dev=$1 if [[ ${#_dev} == 18 && $_dev == +([0-9a-f]).[a-p] || ${#_dev} == 16 && $_dev == +([0-9a-f]) ]]; then sysctl -n hw.disknames | sed -nE "s/^(.*,)*(.*):${_dev%.?}.*/\\2/p" else _dev=${_dev#/dev/} print -r -- "${_dev%[a-p]}" fi } disklabel_autolayout() { local _disk=$1 _f=$2 _dl=/disklabel.auto _op [[ $_disk != $ROOTDISK ]] && return while $AUTO; do ask "URL to autopartitioning template for disklabel?" none [[ $resp == none ]] && break echo "Fetching $resp" if ftp -Vo $_dl "$resp" && [[ -s $_dl ]]; then disklabel -T $_dl -F $_f -w -A $_disk && return echo "Autopartitioning failed" exit 1 else echo "No autopartitioning template found." exit 1 fi done while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in [aA]*) _op=-w;; [eE]*) _op=-E;; [cC]*) return 0;; *) continue;; esac disklabel -F $_f $_op -A $_disk return done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- get_responsefile() { local _rf _ifdev _mac _mode _lf _hn _path action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev export AI_SERVER=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "(.*\/)?auto_(install|upgrade)";$/!d;s//\2/;q' $_lf) _path=$(sed -E '/^ *filename "(.*\/)[^/]+";$/!d;s//\1/;q' $_lf) _hn=$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf) hostname "$_hn" done if [[ -n $AI_SERVER && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,${_hn:+$_hn-,}}$_mode; do _url="http://$AI_SERVER/$_path$_rf.conf?path=$HTTP_SETDIR" echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $AI_SERVER ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${AI_SERVER:+http://$AI_SERVER/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- dhclient() { local _i=0 while makedev bpf$_i && ! /dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_info() { ifconfig $1 inet6 | sed -n ' 1s/.*/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | cat -n | more -c ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]] && isin ${_f%${VERSION}.tgz} xbase xshare xfont xserv && continue isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi [[ $MODE == upgrade ]] && rm -rf /mnt/var/tmp for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/usr/share/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi ;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc" ;; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return ;; "?") [[ -s $HTTP_LIST ]] || continue cat -n < $HTTP_LIST | more -c ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/%c/packages/%a/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { local _drive=$1 makedev $_drive && mount_mnt2 $_drive || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then ask_which "disk" "contains the $MODE media" \ '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' [[ $resp == done ]] && return 1 makedev $resp && mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in [lL\?]) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } donetconfig() { local _dn _ns _n configure_ifs v4_defroute if [[ -f /tmp/resolv.conf.shadow ]]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf for _n in $(grep '^nameserver ' /tmp/resolv.conf); do [[ $_n == nameserver ]] || _ns="$_ns$_n " done set -- $_ns _ns=$* _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi resp="${_dn:=$(get_fqdn)}" if [[ ! -f /tmp/dhclient.conf || $NIFS != 1 ]]; then ask "DNS domain name? (e.g. 'bar.com')" "$resp" else echo "Using DNS domainname $resp" fi hostname "$(hostname -s).$resp" resp="${_ns:=none}" if [[ ! -f /tmp/dhclient.conf || $NIFS != 1 || $resp == none ]]; then ask "DNS nameservers? (IP address list or 'none')" "$resp" else echo "Using DNS nameservers at $resp" fi if [[ $resp != none ]]; then echo "lookup file bind" >/tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp aperture= resp= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM && $resp != n ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp } ask_root_sshd() { typeset -l _resp [[ $sshd == y ]] || return if [[ -z $user ]]; then echo "Since no user was setup, root logins via sshd(8) might be useful." fi echo "WARNING: root is targeted by password guessing attacks, pubkeys are safer." while :; do ask "Allow root ssh login? (yes, no, prohibit-password)" no _resp=$resp case $_resp in y|yes) sshd_enableroot=yes ;; n|no) sshd_enableroot=no ;; w|p|without-password|prohibit-password) sshd_enableroot=without-password ;; *) echo "'$resp' is not a valid choice." $AUTO && exit 1 continue ;; esac break done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" $(<$_zonefile) && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(<$_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(<$_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } get_rootinfo() { while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs) ;; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk" ;; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [[ -f /mnt/etc/$_f ]]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn";; svlan) _svlans="$_svlans $hn";; vlan) _vlans="$_vlans $hn";; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') if [[ $_fstype == ffs ]]; then _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') else _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') fi echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } check_fs() { local _dev _dn _mp _fstype _rest _fail _f _passno ask_yn "Force checking of clean non-root filesystems?" && _f=f while read _dev _mp _fstype _rest _rest _passno _rest; do _dn=$(getdevname "$_dev") [[ $ROOTDEV == @(${_dev#/dev/}|$_dn${_dev##*.}) ]] && continue [[ -f /sbin/fsck_$_fstype ]] || continue makedev "$_dn" || continue ((_passno > 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } install_sets() { local _cddevs=$(get_cddevs) _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $_cddevs ]] && : ${_d:=cd0} [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_cddevs $_locs; then for a in http $_cddevs nfs disk; do isin $a $_cddevs $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do _cddevs=$(get_cddevs) umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? (${_cddevs:+$_cddevs }$_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; [cC]*) if [[ -n $_cddevs ]]; then set -- $_cddevs [[ $resp == @(c|C|cd|CD|Cd|cD) ]] && resp=$1 install_cdrom $resp && METHOD=$resp fi ;; [dD]*) install_disk && METHOD=disk ;; [hH]*) isin http $_locs && install_http && METHOD=http ;; [nN]*) isin nfs $_locs && install_nfs && METHOD=nfs ;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1 ;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local elif [[ -n $sshd_enableroot ]]; then if ! grep -q "^#PermitRootLogin $sshd_enableroot\$" \ /mnt/etc/ssh/sshd_config; then sed -i "s/^#\(PermitRootLogin\) .*/\1 $sshd_enableroot/" \ /mnt/etc/ssh/sshd_config fi fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) (($# == 0)) || usage . install.md rm -df /tmp/lock rm -f /tmp/update if ! $AUTO; then ( while :; 6%\<%,<%@ HZ%LZ%HZ%lZ% a%ERd%CE%ST\|%SL%RR %CE%ST\|%NML%%CL%0PL%0RED|%@RR %CE%ST\|%PX`%%TFT%H%PN %RR %CE%ST\|%H%,%̣%X)%(i% Y)̢%((%v%Ԣ%%k%(Ģ%%ܢ%ܣ%%T%%v%((Y)((%%`%(H%,%̣%D *% *W) Y)X*D **%v%\ *D *tX)D ****ܣ%*D *D *v%D *D *Y)D *D *%*D *D*0*H%i4l%inativeXr4Ki%a4%%8t4Lt4nativeXr4KiD2&a48t4Lt4>>>&Q&_& ( ( )&Xe%_&)) J&) ) )) T)(1(%&x&))|&d>hihii '@B>hiܪi$iliiiDiiԬiii > i> ĭid z>>>iܚ'p'i4>''p''0'''' C% >?>@> @>?>@>0?>4@>(> ??>X?>0?>@> >,Q@> >$>(>z>z>|"( #(|"(#(d(((+(X!(&("(,%(8((d6(06(L4(2(ܬ(1(1(ttyclsttyopnttybgttyinttyout8>(f(=(=(`t(T(a(0M(t(V(6(S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(((((t((( S(  $0@>4i )4i )4i ):+7+7+7+$>$)(di4ip(ԫ(p((((PX)X)i4iii +i^^3333d>++#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ i|i Dq+v+7+m+,o+7+`g+\>_+Hi|id,2ܼi,0,,(,ܼiC|--$,-d--ܼil@-x-Й-t----ܼi---,-ܼi,--,-л,,ܼiT---,-t-ܼi)T---,-ܼip,--,-~,{,@{,x,ܼi---,--l>iܼil=+ dXiii ii<8Q @X,iiiiiiiiiTiiXi\i`idihilitipixi|iii}n(@AAA==(A* dd%(i @@@@@@@@@@ ii8o(oiii i$ii$̿iԿiпi>ء.ȡ.L.>.\..>8H.ܠ..>... > ...>$ . ...>$ . ..H.>$> @..L.Ȟ. $> p>`.d.X.,> X@- .L-8> \@...D> \@-,..T> @d9.̜.L7.d>00(0..p4.t>@@ 7..5.>4ش.x..ܳ..>4ش.x..ܳ..>$4ش.x..ܳ.. >X- .L->\...>Z.t.>Zh.h.4<4<4<4<5/F/x..//M//ĵ//X)/г// Y)/X/v/(//X/L///Ы/t/`/l/t////tu//x/Y)\/(/0/l//`x///ĵ//D */ *W) Y)/D *v/(//\ *D *tX)D ****l/T/D *D *tu/D *D *Y)D *D *0/*D *(((((((((((P't'T'('('(4' %(((((((((((((((|&((((((((|&((((((((((((((((J!I!d(!(!F!(((((((((((((((((((((((((4[6Z6]6|]6PX6(((|&((((((((x;%;%p6%<6%7%(((|&((((((((|&((((((((((((((((ȭ***4**(*(*((((((((555Ļ5$5(((|&((((((((|&55L5545(((|&(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((Y%Z%e%a%Z%((( Z%((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((=%=%((@%((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((6(66(6(,6(((((((((Ȫ66Ф6(6(6(h66((ܴ6((((]7\7\\7xZ7pY7( W7( V7((((((((((((((((77<77777g((>(((((((((,70,7)7|$797(7($7(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((|&(((((((((((((((((`G%hG%pG%xG%G%(((|&(((((((((ahGH@>>D?@>G?<\5Hw5lu58w5?D5$555D?\5 555>4|5 5t? /HNPWT660?8 6 6h? 6p 6?066?+6d?l026L16@?<686??ii?iv ?i2!ii i0L6XL6?M64M6L6M6M6L6_4M6\4\4\4_4\4\40`4@`4]4`4`4`4\4\4\4`4D]4l]4p`4`4`4`4`4a4a4 a40a4@a4Pa4`a4pa4a4a4a4a4a4HO6dO6?t0P6d6c6d6>z>ȸ??? ??,?H?\?t??? ??,???6666d2dH6p6$6l6++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy6\66t6<>h?l?p?t?x?|??d??H7|7H77H7X&?<=<=<d'.symtab.strtab.shstrtab.start.text.data.openbsd.randomdata.bss "  ! (A !(.jI$B)jIlBIGDI@  K=  Aj)j1x 07"p(t-'T8z)4Ne%\Y<[p4pji 7(9<)9P6!,xH9Tib[4,o<#}8y*@&\D6L"f!dZ+|1($x.f.D&9# ;(,K05LUl=+c:xt)| )PB<93fi8|o|,38"$7`/ L%@5hi$18%JV$,\W!qH h  4d!H8t2L(,p1:8060L8 ԁ6,%@&i0+@`z.dP{$(gl]4}x+)(T.3#9hT8P(`28&8j |{!|3<@'i8"Or9h\t le^=ni~ *)4H;Xd)fn]64=5`07yn\)p", ! i yn1 0F'X7 HAB ($J 6V 8ik X& x H75L \' &! x8t )h ԇ,$ j m4 1T A 8. $8d V50 $i: (&N Ķ%`X d$Tg 1l| l0 O,\ i lI)L 38 \4 |,D 4Z3 ;+4 n x#1 7.L< +pO ܤ4hV ,l "t   <5 i  $ .0 |?%8 6 c! ?: L=`/ = < i$J l0^ in  0} 6p DYp w-X i4 x= 7t @c,X 6D آ9  :h/ .? -J }nX 6e )<o 06(4y bp  p+ č(8 =: P( LLAjh7r8<76$i+h9,8l/(0ī60o,%&p?6t,*3" :\& J_'dVX#mu&vdE3Xti$0T67H*\ȯ*(&l8X4Ai& $>5Lqn'r!$<<G,(",X4Xsox, )@4 %|$9tbpa4*([%X$9 6XT:0 ,|OiP[87 e6q `L6Hj"d"|6PXpp"p(7t6o$4/6Xa,TQ'T]\W$l.|pn8[$T'n&0jDnܳ.Lu$t<#' N)i+l%?6(Qx10az&Ln&5voiiiT+&\C:,,+5l#5@i5"% d1l;9@TnOynP]snf'<wiJ98?5)9s7xtii46< H4 T1+ 'n5 +L |i(V kpg ,5s ,x 0X ^/ 88 H6 ,L )X \.4 }n v* !H&:l!*&!$'2!5?!9M!0a!64n!Jpx v!8!6 !p1d!Tn!{9!X 'h!026H!(H!" " +"H:2"d8E"7U"ik"Фo0t"/n"h="ԡ8`"i"T4"\p"'"&"&"0D"8",6@ #0# gn(# $l<#9M#j.T]#/<@l#(L9z#s78#t,$#+#7#D%# Z%<#8A$8$Di$tB6T7$L5@$'S$i\$0Vng$T&s$|*&t~$D2&$Z%8$R$$đA$!$P6$8C'$T%$8$D$'%&L %" #%$i-%d,8%d)(E%9(P%0`4c%؛(ls%/n{%8%%{,l%;$%an(%Č $%7%#%B:,%`!&6:h*&88&I84C&!X&6p&4p&P}&(&#&x )&-D&#&&&25&D0H&6 '\p'`4*'o2'8X=='8M'i\'oj'gpw'u2h'6'-';P'}8'tm4'DY8')$'+<'Ԉ=(P4 (D10+(T&-8<($&(L(iS(,xi( &8t(4(_4(f-("(8/L(l8(M5(@]:( i )L3)7()6P<)m9H)-,R)"ta)*j)diy)_'H)838t)ܾ'h)1)=<@)\1l)t+)*4) ?%8)'H)( *%*X6)$*&2*@n=*D#`K*4*X*70h*l&xx* 2*Tyn*$p*@D$*4i*C%*?"D*_4*`/ *4%*4 +v*+4t3+ء.@++R+06Pi+"X+D)h+i+'+;!+5,+S0t+`++FY>+7+$9 ,",i#,&L,,|$H8,i@,48`J, }nX,L4n, #h~,t ,8\,i,Ԣ%,M;x,H,,j1,.-,'X-P#0-0;3-tsn?-1R-0a-p)dh-jr-Au-p9\-38-w%-&#-p"-Pf!-M l-&0-P)-I(.i.v"'.!7.\pK.о1$_.Ъop.38{.h>+.'.h)H.8\. 4T.v7<.". .v9`/g!D/E9*/L44 6/5$>/LX)(S/(t^/&lj/% 3\"3Ȩ1<3#;3T3d4#44;74<04F4 ) P4t7^4D0s4d7!,~4\p4/4o.T464`p4#4{n4qn4#5,A 5)L58!T/5/l<5_>T558\`5,in5&H5lq 5(5#5$#45"L5,7L565hp45.5L1 6t8@697 6036 *D6 Y)W6P'T`6Af6xr5`r6 )d >pyn>28&>$05>8|B> 8M>iT>dO0e>|'Tr>A>)(>L84>̭7>i>/H><(>\"<>h$>\/?*?=<-?@6h>?D9 L?H7X? =e?@D)l?##4?5?'8?v+?t)T?| ?gp?4,d?P)t?D:\@!8@<9'$@|"3@3LA@F5T@lc=\@(0.Lg@ |7hv@(}@Ē$@bp@6@n@`6@n@#l@OA'@A@8Ak0AF.4"Aԁ&.Á4XJA ^AL 7qA.+,zA`%,AحiA,~"A2dA$)ATO1$A0A#A &<BZ%B Un&B̹( 0B, P9B8'`BBĀALBf5^B<`8DmB0G,pB# Bp.Bt+<B7PBt3< BH3pB!HBiBM24Cw(C6(Cl+,:C +\DC*dNC*`YC&<gCd*rC7<Ch6$CliCN'CP)(CD%0C"PC;C<4C( D`,t Dx+HD,*4#D$IZiTIhZ'fI2"lvIiIa,XI0(I(I*IiIdiI4 I!Id= IiJ-)Ją&6J.X?J6 NJ[#dJ9vJa8J11JV:J86DJ6!J PJda!tJ54J<0J)K4S8K&  K0+5K8*,DKl"hXKH8peKؽ6xK-K#HK 5=xKQ5K(z*HKiK8:8K̂:K6<K)tK&KiL19LlnL,i +LXi 8L(@L(|KL )!HVLi_LS0(oLdX= Ltgp`Lx4HL/L=!(L$nLx)(L;LL9L1L'M"My!$Mp&X,Mȑ8l=M6OMf,XM)gMt#0MPX6DMdL0ML6<M\R:`Mi M@+hMXq<M|8Mly4MHb8=Hc)cp#'c*x7c%Ic$ ZcT@8hlcp4.Hxc0cm4c(g& cX0c8i(cT:c,cLb!pc&`d|x$d# ,d /<>dH9Id\pZd5dd!kdi xd&LdLG8dh%8d#Hdܛ9xd6)Dd@%xd<dج)d&d,(< e,%(e3"eD.1e) :el_$Pe9 _e`a7$reX)@{eps= e,eieș)e",te0eAe"2eHnexi$em+p ft"@f@&D&fD?%8/fX8@fP6\OfHw6`f \plfH7~fz&,fhif#8fJ6 f"f.*fd4f\p&Xf%@f(Af$,g@F7 g6x-gPi$$0h1hv+lh|,PhR&PhPy&h4p;iii,(1i*L?iT(IiiZiR1,eil;:LziX7pi<iԫ(0it'ti$\pie,i1iC*iTi i1i,4x ją$!j+l2j06,Ij;`jH6|xj$g1,jH(j'Dj@ij'jXz&,j %\j,pj̯"kyn k&kT %ki$.k7h9kkpEk3Rk|v5\dk0:hvk(H~kF;Lk1;kL.klqnkl&k?'Pk\<kh7\k4'hl2D l'tl&'l,20li;l06Ql%`l!ll*DxlHO/ ldy& l%lH"l%l*lt7lȪ6l' n)DndA,nT,8?n"SnTU <dn,ixn(+nH9ln$%dn!nnntin$in$n7(Xn."4oN9o,*oX+Bo4NoiXox1go|},po.o/noB$oi(oTnox/(o%Xo$5o'oؖ" p=<p&+pTi9p;:LNp89[p(<mp|J' |pC.$p&p pd.pop{npXppipd:p7\q[+pq5D q1/qS(8q` $DFq160Pq`=YqneqԤ)oq})q<&`q)<q"4qx.`qp'(q4,qI20q)< r#r8A@,r+6 ?r|$7IrD&Wr$$ir1{rHh*r'TrXpr7( rT7|r0 r&rh'$rЭir4nrD4sQ;ls41X2s@b+,@sy&Ls(e1L`sP1wsp;hs4:0s7 sc2sm0s;sis<94tHt7Pt-(&t'(0t)@;t:dKt$5Tt9bt`0st2tL&Dt$.t4O'dt9t*<tot|itxT$4tx6ukpubp &u U+$=ul$KuAQu0iWuL1@du,quiu+4u &u;u/\u0i$u9u'u(\pu\00 vH8v}7(v|.84v|snEv8tXvkpcv\4rv<zv&4v5OwO58_w)kwl$w84w 8,wiwXiw8dw@"2dwx1dw)0wd><wХo x(hx0*#<#xԗ"d2xW3d@xl*#HQxm0cx49oxܫ&`|x"x 8|xp xx9(xd4pxd*Pxx"xa7x2yغ1y(U0,y065y*FyC$\Vy"\hyx sy%y*yanyjy0:\yP14yL"$yfnykpyH0Lz,4z8D.%z`#5zl7dAz<0lVz cz(a:,vz ^4zl{4zy%4zhp4zX44z,z9lz7dz`*{+H{i'{ 9 3{x5:{0b4>{6O{H-t^{.1(l{#Py{9p{6{S1{A{/5{43{G.{tqn{/n{_'t{:X|:p"|,= 5|s;E|X;]|m8h|,6Tt|"Ujn^6pTb,Lt4(!T+l&$Ǔa4ړ+X+ !x8,kp+T4:`4MLI.][1hXp~4c&p#<618ɔxO5,ڔD5 `1DO*D(, ~= ('80|38D%x;)@D7PQs0\_Vnhؖ$xHZ%144<igpĕ !ҕtn4 {n`u+Xi +!@8*M66L 'C8nJ*W "i)ti8T548<4864oҖ}&$ٖC%`Y7\2l#|;=l7)~-L4kp<'DJ!YPB:l 9 i V6'T1 {!ɗD$( ԗ1<1a>xE0(6"L7 9\D%0S%[49(fT0tA|5-70<86xit1PH$Θi՘u7<0|$p&8"lm7+lo4AF*0Npe$[hr=ekpnPZ+D8i6d,h7tn4Ι(iؙP-,p#4# x' #P3D+&8 1dW0ll*vl8`~88 ',{;+4ȚHjϚ;\4Di(3<*D/(08Ȥ"HF7Y6pd%Tp<6%4xH"n@+,X!(/&ϛO9ݛ6$l4h%@(*H"007lB 5OVn\#pX*"'!tx5 #`Ȓ7<885P֜"'t0  '< iXL3:p,"/6BiQ|i _L+ i0 Dw (~8b&L<"A+8|)# kpƝ$i$ӝi۝F"86p)Dl*!`"n#L0X"pGf 4X6dm:5pi27X>0hn.J,4՞8n4i&|09( 9 9/)x;%0o3p:W*GVnO|:*Vt#9cO4\tx$3D%t9H;0Ÿ/Οn3ptn`Ԏ%h VnAH645&@A"tO'd0/@rxn3x|B$4LY>\4AD4ƠM/Ӡ<0ޠH68 y*0&% %$,#;<;],U+HXX(ex'LqL;ipT\6(B)<94¨2Xͨ z&<Өx&05$W9 %9 )&6D\4T gn[ igH:vK*lZ% T$@c$< ,Pĩxj̩@ $̤(H;05< 4@64`3$?@<d 5li{:X3PO0Hi #HŪx)Ϫ8۪t'\$X; 6!-*4I<@T`:P~0](pi0X.$ uu7@Lg- 946<6pʫ@0<ثla+d-,78d66k/'`)l/* ?0)@I$T^ *j js+ U7'@)&<(8Ƭx3;Ь/<'Z%n 701l9"7Gܕ+cix('['4=8=T8*()Hǭ2$Dѭh+5DD50pi\ p,X%@"(i2h( :&@z&N9%XY,ia5l424|*P%<:s=7'D®6$|ͮ"X߮P0, (9(4o8l7<lq9`$/4P1P)@<%KLF+a`6hv*v6:0|8`s!i3*)4Ư$߯& 0= 6li4LI9t/$4G +d]r&f!@w"P 6Hi'6+ΰ7ڰm0@,7+4N9X Pd7XY5%tm0<*p<x:Llic fnm0vb8X:DLK+h0*\}-,ɱ,t%ݱHF9Hto+d+4+6;9`?+F-) MS$pYp4qtiyz6i`([" f91 IJ rnβ5Lزi2M+46H̜. -$;-EiT #^=<@o';,z+hX5P05i0DT)<d> xt1\"x@;lkp,%2M130&LA70V+B8(Nt-ZPa4m|)yl&(, ,d X'86(s8,o*lj4h (t)(!h.,?#4Q#Db0+Dyp%L(<(4i'0",|2<05T/`)-)8P`4(<  86H81iB)lPG"e "w`iW= 6Ț: j8lHXpid'n"45T(<(L1,i?,AP0_p0|ot\;A*$30h#9D98\pdi!+x&T 045$ pi*d$(X3ȗ7DH)nN88Y7b@-$m (w!@K9L]4i650\a$Tlp83 |g%\C%#$o,R,<H&(Q;^W>|l8R6z0) )4p"`\!0D|5P_4`44#,n43 i!H\:1s=:_5E`)ND+DV)dch8'<sAv7<n4ؾiķ%E7|kpo4w0@~-t*Н#+T.!;::HO5X.g!yp95 ȕ7\L54!\4^!` *$<9$0i06 (i#̲i3T&>ij8H8U[2`cTI1pivLn`;X8X}8\T$X2xiTn\< x!$S6l,(%98Cb%P<n\6xX0i5il6ynpi1:$(u5D4i1 .0o1n0<*|F iP(tY9en.s|,\[2(d|0t{nix&8#0Pi66H"!@T; i8<`i3|'?04O3p\(g An"$6\n41Li(*@H7H`6" Le+)`Ը:-=AiL"\b $p)v$ H\pL{-\&\6T@5/,v3|00 T 7p,4 "n*i6T^)xB6:PPܭi d8ri~(rnX:+ ($L(!h$i D{$3d%54,(8T?*C 8xKl{6V~)XaĄ$`tt7~]/<14|5%L&<Tn>%86`\*l,i unt(0",P6Ȗ4C;=K$3Q-n`2m"-L{0)*&t}$L+*<6PYA .xi t5((2Zp#| 49:Xp4,(=,%K5:4_imhc9wة"9DB'T*W'L<#8"l!`ܿ9D ,p'H6P!*7p-P6?0(MjYij#6\)7pd'|(Pa5$M Lm4)l(! !&l/0T8;Q7I9p\870g$yV"A0i p0X):Lm4)@h<)pX=  q9P#00v*A nI4n W\=<4i`*u,786p%U(:(H$0<0 $j"*9@((N5(/9.!+4)l?8tLxiY$e0Pu0Un`6PL6b`?)889p+0*P% "d "XA!t7DȞ.A#l"5 A=kpM02Z`0@o> ~o(+ (dv4<x),H;P8`4 ,DxH. }&Lc9d!Z6)Yp@<)GU9PY&0gA',r 1i\u7d,rnF&h 0 =D4&85l0X P,gn44[6 ;04F!N/4d[L08q.~kppD(%b=@30v%iP94t8i(P8P!& 0#TEo<M<)DVk#hX/r.2xdyne'|&HH68j64%I i<6`@6-,/D Lh(PS$eD% w`L:$R)<@%d7Pj1T $P-X3+$ 7 0U29L, #B78KiY9'hAmHD:X`iiA5H(M5x̤4%P`$l]/8&dt-X  |LiԿi,<%x2V$ ?(0H<6H]%pe8(-wi@&0w"kplr2H*iw2X& C:40/!8(*a=4P9<C+R(+(]Ta.JD&`W:n5,XD"S9@5rn$$];8 `Q*)D ('L!T+xn;*8P49[}3dhD*w%N h#0`"#X`"Un8*<(8 H)8 H#ȭ*`%50 zn<g;U<:|dP 4TqhiWp0pti$r7<( ,2|4"H (!D8 sn.̌&8)TCi(Z5b )(m$L||n +LL,8"nXi88>(_!}nxZ7p(4$)ܑA2Xi<:Hi4Bصi@Qi\#!eX1qd:h4,4hynh: 4@9$d8$7=PG<09(4o!X8p3\ *>P/8GD&LU!k0$tynPS/Q),$(C:435}40x7+` H( T0\! t*,. "@ 7I *dY W4c 8o 2Lz D~# `4 0D =( ('( pM p B7 ,L l*:h @' D** i? @<F 7pR 8d_ `s78r m1 7  7 4 1  L    p 3l Pi$ p&8 % i" 0,. 06% 5 - I T&p\ #|i #" 8  2h Y+ )j 8 {n j Њ" ^> H18   . \)<! ~= - P17 . H 6|R (a H'0p iv ԙ& 0: DO/ ğ' :$0 x*$ pY>t 8 3 d|. $(p /  ",$3 m&: t\$F T24U q8^ d6Dg Dx9 | &28 ,< ! L1h t( $6$ ,8t & % \7|}= 7 l#5D +LK9(WL'Tc"0r7l}%0l8x+:tH904,О+D-84"!t|  t!14*:;6`O,HZ@ida4wv81(j.iDt",8|)%$:|8X. >+$p$/35 @.Ld;=ZW!jp ly<:8`(8b$$30 C:\4'@T'"n$|)l3c!C<#M"``0j%Xubp"A#88>% W7(,-n%`+ ,d 6pm00L[)? T$Ry*Hd"oZ)\{,< 78\ 5Ĩ., 5 w/<|='(L4d9.D\-$p8 $=65< 6| W8( np& D80x/ ;xa=B,oP$]"qj8P}0L]$`6ts+d6(8 U# (0 d>:X/Ы/8)Gl48V%6l܏(r" $6t"0<90P)<8w%W 87'1$5i=t7@PHO9^L.j)Dq.'\i& Lp4a20 X)x\\p1X $I6x x01DG1'Sp6%4Z|&dg"5,p@'83'#HL4D5|Ԏ5W0#h`\pH"0$)r9Ti&W65 3 //D4|&`%8 +`)4(i088=D]4M2_ k8l{h/&9$Alp"D9l80hH8Ti/ 4< 86' 8p5 t=+D@ .\O T8[ L8e *s 6$ 1 $/ yn \&8  !T D6D )D T"!R/ !i!}n,!6h:! 0J!X*4U!̢%b!P#1r!8;H!,0P!(t!C%8!lC$l!k:!'L!n!(x!.;"['\"Ti"x}( ""Di -"D:@"0z<W"\4)|b"6r"&P"5"i"l$4"i"F'"56l"#"!l#|9#0( #k7x.#LN hA#b>X#in#\O/#,#(0#i#6,#$#i#i#H#H#,h $p6!$xu2\8$l*E$$-xV$7j$it$86l$/$H5$̺2$6$*<$f($~&$ #t$:! %1p%I)0$%70%7%8%#D%:V%-j%"x%te1%'%8%`4%d7|%-%6%+&+#L&8 '&72&i;&ܷ(E&:XS&;=@c&n$s&(7d&h'& 18&x76t&'&$)&L6X&Ti&I!&|i '@9'<&$'P 5'8`='(I'6['(]7d')p'Xiw'9D'sn`'<30'ܯ)'tU7X'Pc$'@+X'v-l'x3 '090(2(yn(i#(hi*(81G(&4Y((}= e(d*hu(I/($ ( 7 (6(1$(`o(&'(4j({= (8((ԍ2 )d&x)Ъ0P) /'')C8x9)86C)XpS)p=+_)|6l)P|9t)46-)$zn)K(,)+<)DX))\I")Lo)()4A*##*Z:"*40,*(/46*9A*,U*d\pi*m4}*l3 *$4*`#*2T*Q'x*{n*A:*8*tk7\* =(+Ĕo+4 "$+$68+|0O+C.\d+\7\n+8'd+i+ (+T18+x/l+6T+<01+(8+";t+ >+@+dwn ,lyn,R8<),{)l=,ԉ#8K,PAR,L/,[,& k,)@v,6,44,PT9 ,%2,,p#24,@+d,xi, <,5,03,yn,8)4,di -F2p-&$-+6<$- ::-̽5B-P2XT-(]-+r-6d-35-L_$ -.!L-z4-)D-6T-D1`-|(\-A.`=$.88%.L/+.5$6. B.1N.nZ. k.h%$y. .7=.(x9.7+.+1.&d.̿i.di.8X.T(.18/O/4!/`!,83/-,D/# XN/xi]/H7Tn/2p{/O1/o88/ԓA/dZ!$/lu5(/Tt'l/l6/5D/2 0i0hg,|08d$0|7@70')<A0Q!L0+c0 7pl0G9}0_40* 0Ln0`9P09 0z=x0z$40"d0b6(1P "1'<!1681nC18t4K1:X1-c14o1N,|1(!1)1&01$1T6T1n41=(10d1$i 2$>< 25,2 *n72xd!XN2>.`2=%Dm2~,w2x92Xp2\F)2-H2h%;|2 62ԥo2p4\34<43c&\3 *3',;3&>+ ->8i6>ľ4M>45@Z>t-xe>d.Xq>+>IJ5> 1|>0n0>->+(>=+(><4>1?0(?*P?*/?ܬ(:C|m4Ct1`Ci C)<C%C=0C )DC8lC8iT D"#D 6(0D58Dt%BDX)@YD'jDi wD)|D6DnD#LDL5#PDа;|D#0D|8Dh8EP7"E.H1El`$@EiJE5VE .cEa DpE@Q#EiE& E,"EAE$*nEiE4$ En4Eإ8 ExO1h F(6F`A1F7-F\3@3F`G%?F4(QFL)|^FtniFt7@|F#0F}nF(70F 9F,1FhG%F#FS#F ;Gg=G"1G,<?Gx ,|VG07<fG#}G0,G4DG,GJ5|GiG1GTiG^,Hl:,Hp\p=H~)LH07VHj\H7hH-@vH$'0H5.HH\7Hz4H1lH75`H|6$H4DH.I#0IA&I&:`6I9CI@m7LMI`>+UI 58t]IH5<iI<~I+ITnI I2Ip5)I'IdiI8TIt$J\4+J4i5J*P>J$UnGJ5<0YJ)hJTy,8uJ+HJ4j6|Ji|JiJ$ Jt"lJT(|JW=JiK",K|0H%K`'`>K-nKK#0\K!:mK,"'{KLB7K&K K05<K$KH0<K@2\K0~= K@g7K+,LL6x&L,9LJ8\DL`snQL48bL̹9pLo{L@+ L]4L@<L(L0:L`7dLX)@L0%La4pM8u8 M(dM%|"M\Z)*M7|7Mg=>M48XIMF%QM i`MiiMH, tM M9M!2M<MznM0nM@8Mx6 M1@M$\M*NE1hNh30(Ni8$Ni&H.N4%@N%\Nm3lNixN8(N+Nh;=N,<NoN|,NpG+lNQ1N#Nu<OZ%"O0h7O(!$LOXb=SOicO8ilOp(vO %OAO*O&Olx:LO)POL&LOĹ&O0#P"""P+4PxG%APPj;DQPkpeP0sP 1xP$iP(V(P`6dP 7PPiPܲiP(8P6'PiP82Q\)QtnQM6&Qhn 1Q:HIQF9ZQPg1xhQ@.6TwQp#,QX8Q6,Qs9DQ,Q)Q>0(QXnQ85Q AQ88LR\7<R&8R31Ri8RJ'TFRp*XR9eR$wR5R\nRjR`<;`R6R 3R`iR()RiR%R=<S+SL'"+S%8\8S(<ISiaS\A iSTa:{S܂5S@4S81SU$S<4S%,Sp.PSx'-St(S1 Tz,T`]5$Tkp0Tq7 FT(o4bTS,yT'Tdv9T8`TDnTr.T\4T,i$T(T^$TT@q5 Uv40*U'3U@(?U!)JU|&PU3@UU}= aUL+uU%0U#0U(iUl3 U`4U$5U`(U0B%pUL:dU iVF6VL)xV$1(V\"n;V$y7dIVkp\ViuVXpVdf$V6(8VD: V&V%ViV;V&8V1WDi %Wz:|9W9(EW6,TW_$xhWApW8p{W,W6W W8W(<3DW@7<W8oW+PWu(W 4 X1X#5@$XA.X j7Xi(TXPX=]Xt:;nX^4~Xh_)8X)X S(X#HX #XtiXl*|Xz&XiY<#Yh+ /Yu'7Y T@YiFYz<[Y)eYLC;8uYG5\Yh$HY4`YXiY%HYw7@Yi78YM'$Y9Z70 Z+4%Z(`/Z@i9Z`M8EZe.UZ|- _ZhilZ3( ^6^$(,^t%$<^"PI^&tU^8-a^@&l^)w^.^`&l^-n^ 'x^'^Xp0^4^'^0K'`^._,9<_L5x_|189_lwnD_(*nP_!__`X4h_(0{_<c`icicu<c',cbpc}&c-Xc r'c9 d !8d(#-d((d=dnFd.Pd6H`dtnld(Pudu$d\9d<d&d1dp5hd\m4ddsnd `4dh2d,|d2+ei e5e2,-e"\;e< 2Ce6QeP*$beD)me#Le$ieD)4e0%ekpe9peiei>@e 9Te9Pef:fn4$fv5l9f0 Lf /LZfxqndfPq4rf*#f@(8fl:$0fC5lf\ifDifDif8,8 f%f7tf)gtngP%)g\s&T!g"5gi>gm4Ogcp_g,4pg i |g|q1g#gkpgHf$g, $g$;g.g = hlj4lh\!&hM)Ch 6Wh܄<ghnsh*Lh8hH,8hD`,hl$hT# h0h,{nh<3ib,(iX%(:iW!Hih9L\il(ci>'8ni&lzi1lid$+<idc1liR$hi:i+<i4+ i<9iH+ j pj`i5j.lAj!Uj:kjDT5@~jq4Ljp>*j("jjj6jx\pj)jL9TkC(Pk2+k'x(kU$h;k8d>`Ok,zn[k7jk'}k6& k:`k,v:@k&kp&dkpt"kظ!$k45$k"|k*Pl&l'4l,!,lD'<=lh#Tl 4$il i}lDxnld(!Dl}1lX$4l/lD. l%ld2lp'lp,mK&m\""mT&+m&@7mi?mc&8Nm(6Wmd((Dam#vm0m* m4)m60m@3Pm-m(|mK6tm6m|\pn8(hn& n*9L)n\7@3n0/?n.RnidnT'kn\psninܞ3n.nQ&$nȴ:(nh<n7`n(nL7Xn\.nU8@n7oL!oh $oi -oi3o ;o5Co.So *'doP7oo+-Lo@.ỏ.o@8(o :o:ot0;(oH9Do7o(i pd#p)x+pԶ97p6Np\p_p$3<kpxpDm4p3q&"q,8<!qD54x*ql.\8qA=q+Nqx.\q@<fq8qq6dq)<qr5q$q2q9)qr"qiq. |r.r5r 8"rPo-rn3r[4`Ar(8Nr 7xZr)8grt'wrAY>rX',rؤ$`rг/lrл,4r:r\pr1trx,rp)dr,4sxA!s:<0sx: IsT8Ts\k+\sAus +(s<9s,ts$s4\48sis,#s@8s1&(s''xtpit P*t,+|?t)Ft(#h\t(9 jt5ttitT&t{&t)t$t*tHE6t\5`t{nu%u0(u30|8ul3Pu3_u)ju`9wu0)1u+u$uxw8u\;=uiu(,u'tu=%u u*vt6\vؚ&H'v9 5vp:<@Dv<1TPv)Zv(evy#pv"4~vs#vh4vtX)v`<vT'$vxiv*Lva,Pvȉ"T w owep'wyn8w#'Fw%Qw48\wifw7lxw)wv9wX7Hw<`'w((w8wh/w:w ; xB%tx!4'xz7=x,Hx(TPxO$xfx )rxc3x)x#4x.xxP;,x38x<xix<(x(xi xܶi yH_%y/(y|6:y_/`FyiOy)xZy)eynpyt y1Tyn,y% y~5`y'{i{PR*{X&0{35H{9T{-`{u<|H ||j|5#|42|0-?|p(M|41W|.e|̾*$o|$)||%|\(|HY"|!|t6|4D$|>$|ȓ+h }]5x}Du-X'}4*0}Ȳi;}&DI}t5DT} f:f}i(}7@}0<}%}6} i}+-H6=6 M`x/Wp+4m(l|l=3iTi &$H)x# !$0unHJ$x+ '"9P/5=@m4L\x%\s=dPx90s$;9H8\̊6`5i;=Ā؋8рiY%p< hj<)$8t&ep 11=EiTn[:(fiy*A<tS*%L3Ӂl38k0iji$0)x,*n  $|8|(5`47tBd1_*nj p4lm4-.`iD4Ăi%Ђ7 k7'P! 4n~=  dO60P/ @E#0 TLo#de'n}= {84$4(4^43(d"&l҃A8AL'p+'!d6,Ti44-nFT lSi\1( e!xyXB96TYp0u,0nń"X҄+<4F0h%  -d-69,0 O 6dd4t)~DW;0h<4&8;D= Ņ *4х(6\pD) 5l+T&0,3&Bb&@M&6`WD/`ll#v%Ѝ)x*#78ņo0Ά ؆$ l/m; H* 8. Lb +n>(;6LI)(R !`>+V(.&gA|(h=i$Љ(Lt",%"@P7<Ȏ|U:$ڎ1t`89( 9p\4$`3t/H+@<l)8J,Z$ [ 6lh's0%9x|8آ,(ij*4)@ŏ4L׏h&D( $&- i8,T52C`iY4%i$w!#0in::Lϐ,ݐ-; x5:0 )D)T v"2kp:iBiKJ7X' lut2<0i# 8,)DP"̑08ؑ,x028Hx&<'i3 )X<08hF1Uw-a`1'4q8`{" 6H5+ 5x*8ʒl9 ֒di X74k7@)5&ep /K'Hȳ2dY+o)y1;X:L$n;&̓49ߓD6h1((Pm  8hi&(D10ԩ8<`Q7dL\p`isA }9:$ A/3,P˔i$B58TW=\n>`IT-xS@-%]i+nx['@v0i+8HP,x-tԒ dɞ$3 Ԟ7Lq6s906\>4(-5l\8G$'XY=$r,{j)T TT9Ti\~2 ̟iן8e&\3@ 44(@J'8 B$$[/`-A(;1\Jn_DE%g8!t/0~_&xU$\"l'P_5p(|Ƞ,nԠ(ܠ"@ (+X3  \%pHnl* + >\.]ip I$~8`'x')0\"̦04DݦC0| %X#_7`" +/5d> L(X,,i&tof)z8(D9h6D0f&=66ɧ,)ԧ ݧdA.0p1'XPD$#+j508C)lSAj,i t$y&8dT8pHl7L58(/ƨ`!`ܨ^8P^7_4 ؂(i%4X83z1Ȃo<M (X\.k"i>$ͩ|n%ةH=)l_: 1#4g:4iswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imlongjmpwi_usb_rx_list_initproc_freefd_getfile_modesr_crypto_discipline_initvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregsys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptsrp_v_gc_startsys_ppollcomdefaultrateclock_gettimeieee80211_watchdogdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachfilt_msdosfswritesys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1sys_pipe2ffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encap__ashldi3rtable_attachartisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breaktcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrsr_raid5_discipline_initsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authsiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachcd9660_vgetpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautobwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifbuf_flip_highem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprt2860_set_ledsrt2661_wakeupifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachnd6_dad_startrtable_setidexec_maxhdrszuhci_device_ctrl_doneSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstratu_caaxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswcalctsruumodem_matchbaddynamicportsohci_root_ctrl_closeural_ack_rateuvm_mk_pclusterbswap16domainnametame_dns_checkehci_endpduvm_pmr_addr_RB_REMOVElockinitttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busyhidkbd_belltcp_pulloutofbandsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdaxen_capci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stallsetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainhid_locateicmp6_errornd6_rs_attachVOP_MKDIRtame_nameipool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureif_congestedpdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansbrgphy_reset_bnxin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statusif_getkcopysiop_modechangeext2fs_initext4_ext_put_cachertfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneusbd_get_hub_ss_descriptoruaddr_hint_selectem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlif_inputwi_usb_attachurl_rx_list_initdopipeusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managein_delmultirt3090_rf_setuptame_bind_checkdisk_lookupuhci_device_intr_abortuid_findnd6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readbrgphy_loopphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputre_miibus_statchgobio_matchacphy_cdbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_sccpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completeohci_setaddrntp_update_secondcache_enteri80321intc_attachedexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listip6_maxifprefixesthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readrn_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readugl_initscsi_xs_get_doneatu_external_firmwareuslhcom_openipsec_exp_timeoutip_directedbcasti80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_systicks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6statuplcom_set_line_statewsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchsys_accept4bwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1ugenread_isoc_filtopsipipstatsecureleveluftdi_caurl_matcharpt_keepsavectxpte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuiduao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotmax_protohdrehci_free_itd_chainatu_tx_list_initdes_is_weak_keyohci_pci_matchural_rf_writeuslhcom_set_configieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdpool_countprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssr_scsi_wu_puttsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimoehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_stateohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lnusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuslhcom_cauvscom_readstatdma_constraintuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapugl_intrcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusural_attachip_outputbwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVrt_sendaddrmsgbpfreadbio_errorpool_putm_copym2sr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopuhci_poll_hubunhandled_afaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexsysctl_disklockcnkqfilterrt2860_alloc_tx_poolbs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapsnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlrdcide_udmatimumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsys_dup3sr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initin_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferem_k1_workaround_lpt_lpbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliasttyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changepool_p_alloclf_initwi_ioctl_usbcpu_attachuslhcom_get_versionbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuidcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createsensor_detachbwi_led_blink_endbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_statepiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreadsr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackicmp6_mtudisc_timeout_qcrypto_initem_k1_workaround_lvpci_resumevm_nphysseguhidev_get_report_async_cbip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXem_read_pcie_cap_regnd6_rs_detachbwi_rf_clear_stateem_setup_receive_structuresuvm_uarea_freesys_mkdiraxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashtargetpagesohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessingle_thread_waitsiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopenusbd_request_async_cbi80321intc_imaskffs_cgreaduvm_mmapanonwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdscsi_detachufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_countugl_cdhidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectmsdosfswrite_filtopssensor_task_registersis_south_matchusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handlerumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangesensor_attachbrelvpre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headsys_utracencpusfoundehci_root_intr_startwi_stopsync_fsyncsetstatclockratecd9660_strategyem_iffuserconf_parserrw_inittiocm_to_ucomext2fs_allocif_input_processpmap_cachevivtwskbd_deliver_eventcom_fifo_probertable_walkbread_cluster_callbackfdcopy_bwi_txeofin6_proto_cksum_outbuf_acquire_nomapatu_send_mibAES_GMAC_Finalrtable_matchb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapugl_startobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initaxen_iffbs_notimpl_bs_sr_2netintrpool_wait_freecd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDbrgphy_cd_bss_end__ext2fs_blkprefbwi_encapwi_alloc_nicmem_ioicsphyattachscsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4in_remove_prefixvfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_noderaw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscancbwi_pci_conf_writeumsm_matchukbd_consopsbiodonedehashkeyicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodepool_requestehci_device_intr_methodssys_chflagsatcue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREVbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysusbd_desc_iter_nexttcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrtame_socket_checkrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefif_enqueueucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachif_rxr_getaue_unlock_miiwsmux_getmuxipsec_exp_bytesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachif_deactivatesr_crypto_free_resourcesugl_capciaddr_ioaddrsys_setrtablesr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdiic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputpdc203xx_read_regudav_initconfig_deactivateVOP_REVOKESHA256Finalclallocbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORsccstqphy_caehci_check_intrral_pci_activatepmap_updateccpuehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputprocess_zapsr_raid6_wu_donenexttickeventrtable_allocfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapenxiosys___getcwdcd9660_specvopsusb_cdpmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcomcnattachwdc_xfer_putrt2560_set_bssidsdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findnet_livelockedbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeohci_free_stdsd_patternsscsi_initmsdosfs_advlockswcr_idkue_attachpdcsata_chip_mapusbd_free_xfersys_utimensatfalloclxtphy_cdatu_joinisohashkeydeadproc_mutexumsm_methodsml_initpfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_initi80321intc_attacharpproxyvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearurl_ioctlpage0setrunnableaxen_miibus_statchguvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapehcixferieee80211_tree_RB_FINDi80321_bs_tag_templateucomioctlmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfottyinohci_root_ctrl_donegetnulldevispidtakenpciide_dma_initsr_meta_save_callbackbufcache_getcleanbufextent_destroyenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcrt2860_gp_intrsr_raid6_intrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvuvm_mapent_mkfreeunp_disconnectsys_listensys_mountehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcbwi_constraintuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachucom_do_openinetdomainehci_abort_xferscsi_devid_wwnmemcpywdc_enable_intrkthread_exitscsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdtame_recvfrom_checkkq_timeoutmaxin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2dosigsuspendaue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configin_pcbresizewdc_default_read_raw_multi_2axen_rx_list_initcurrent_ipl_levellogclosesd_vpd_block_limitsieee80211_kdftame_checkgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesiop_adapterpipe_wfiltops__lshldi3purge_detachedpfxrtr_addsrp_initem_disable_aspmcd_load_unloadipq_pooluaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_krunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachuslhcom_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0wd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initsr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabelehci_device_isoc_doneuhidreadufs_creatend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunksmsdosfs_unmountpool_gc_tickelf32_load_psectionuftdi_writenamecache_rb_cache_RB_MINMAXtaskq_create_threaduhci_device_bulk_transferarm_pcache_unifieduhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrrgephy_statusiophyattachdisk_attach_callbackselrecordehci_setaddrffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxohci_free_seduserconf_pdevsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblksrt_ifa_addlocalwdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32pipe_createpdc202xx_setup_channeliodatand6_sysctlnd6_rs_output_timersyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usbpte_l1_s_prot_kw__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvuserretsys_recvmsgpipe_statnd6_prefix_addHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainiq80321_pci_init2bwi_set_gainsdetrunccopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startrt2560_initrw_enter_readvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsii3114_dmactl_writeaxen_stopkp_nonefilt_solistenvsnprintfpte_l2_s_prot_urarplookupuvm_map_pageablechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnameip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortem_82547_move_tail_lockedem_get_bufcast_encryptunp_inocanonpathtaskq_threadbwi_default_led_acthidkbd_attach_wskbdlogkqfilterip6_init2uprintfsensordev_installrandomidmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrif_rxr_initsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedonboard_powerdowncputypefc_lookup__bss_start__if_downndqbtaskq_sleepVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswip6_mtudisc_timeoutieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initgf_logeephy_cdinphy_cdehci_isoc_idonettytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwirepool_lockuvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortcdattachuserconf_devicebwi_rf_off_11abwi_pci_wakeupsys_sigaltstacki80321_i2c_casii3114_dmatbl_writebrgphy_resetsoisdisconnectingdevice_mainbusBlowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectsoftintr_inituvm_pmr_pnaddrttymodemehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionem_lookup_gcubwi_rf_tssi2dbmAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiduvm_objtree_RB_FINDsw_reg_iodone_internalem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkexphy_resetuslhcom_set_breakipip_outputpipecloseVOP_REMOVEpci_mapreg_typeconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printuhub_port_connectsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinituplcom_intrumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddruvm_pagezero_threadvgonelpciide_jmicron_productscrypto_taskqsofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdownsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_capci_disable_legacy_vgauvm_page_unbusybwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVwdc_xfer_getpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstampi80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachcddumpastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_donesr_crypto_dev_rwehci_detachsensordev_getufs_diremptySipHashreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_buguao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeuphidkbd_attachip_dosourceroutesoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupperfpolicydisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituhidev_get_report_asyncuvm_mapent_isjoinableem_get_speed_and_duplexuvmVOP_MKNODnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduslhcom_paramuvm_vnp_syncem_transmit_checksum_setuppool_allocator_large_niieee80211_get_disassociopxs_cdtame_ioctl_checkarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivesiop_resetbusurl_memip_srcrouteuhidioctlpte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockbufcache_getdirtybufumodem_ioctlurl_stoptcp_timer_inittuagg_unlockedsii3114_dmactl_readnd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopycomconsrateauth_hash_hmac_sha1_96fork1vfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetrt2661_tx_intraxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusin_pcblhasharm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptdevice_mpathsched_idle_cpusugl_newbufscsi_activate_lunuvm_atopgmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopshfsc_dequeueatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdpciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestrrw_enterkernel_mapuhci_device_isoc_enterwi_init_iodumpdevtame_connect_checkcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituslhcom_intruhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startrt2560_encryption_introhci_device_bulk_starttcp_mss_advSHA512Update_intnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencugl_detachbadaddr_read_4bzerouslhcom_create_configumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEpci_subclass_daspscsi_devidin6_addmultirn_newpairbiossys_obreak__udivdi3blf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchaxe_rxeofcd9660_vget_internalrt2560_decryption_intrwi_intrvgetrd_attachkd_nowaitugenpollbrgphy_jumbo_settingswinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initrt2560_wakeupSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createem_local_timerwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writescsi_pending_startuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_allocsrp_finalizecpu_idle_leavewi_intr_ackpciide_dma_table_setupscsi_iopool_getbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writeip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushsr_bio_handlerurl_cduslhcom_get_uart_statusuvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusterallocsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeleteif_input_taskwskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilluvm_map_addr_RB_NEXTbpfattachuftdi_openugl_openpipesitimerdecrem_valid_nvm_bank_detect_ich8lanether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5inflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32rnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32axen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizeuhci_device_ctrl_startumass_lookupsmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwakeupuao_growgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifawi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsvfsconfrt2860_free_tx_ringusbd_detachVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedmallocarraybrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_ballocin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskrdcide_udmaclkgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespfilt_msdosfsreaddohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrsiop_sdppool_p_freeif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showconfig_suspend_allbwi_next_scanip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpitimer_mtxgetvnodefilt_ufsvnodecrypto_get_driveridin6_pcbhashbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpseltrue_filtopssys_sigprocmaskrt2661_select_bandsysctl_mqfilt_pipereadenc_xform_aes_gmacsoreservert2560_reset_rx_ringusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifybrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinocfrootschrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownattimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsinflateInit_SHA384Update_intvwaitforiomii_phy_tickcd_read_subchanneluao_shrink_flushflsextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachwdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatbrgphy_reset_bgei80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecordinitconsbufem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsusertame_cmsg_senddiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplcy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeyuslhcom_uart_endistcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatert_ifa_dellocaltcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppumodem_paramem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategysystemsbcopy_pageip6_freepcboptsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintmsdosfs_dehashsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_deviceinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanbwi_enable_intrswskbd_do_ioctl_scdead_vopsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmdastpendingifnewlladdrphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffrdc_chip_mapifa_ifwithroutespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeedrtflushclonegetblksr_raid_turxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_inituvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirmsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockufs_checkpathSipHash_Finalem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreadm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotcd9660_setattrbwi_rf_set_nrssi_thr_11busbd_get_configuaddr_kbootstrapufs_quota_initallocpidkqread_filtopsbrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireatu_attachubsa_get_statusdolinkatbioopscpu_classesbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plausbd_open_pipe_intrusbd_request_asyncaes_gcm_reinitsyncerprocrt2560_set_macaddrufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatert2661_enable_tsf_syncether_ifdetachsr_meta_native_readuhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpyE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsbs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_paritydovchflagssigacts0findblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctlugenreaduvm_pagealloc_multihidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsuhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2em_camsdosfs_roottqphyattachbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updatesb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesrebootswapdev_vpre_miibus_writeregpool_gc_taskuipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readkv_execufs_pathconffile_poolohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updateehci_alloc_itd_chaincdce_stopbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptrtable_lookupbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarybwi_phy_init_11b_rev5ciphyattachin_losinguslhcom_cdsis_chip_mapaxen_rxeofVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_vn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptbwi_startukphy_caitimerfixip_stripoptionsbwi_init_statechgsyn_cache_countieee80211_add_xratesnd6_timer_chugl_rxeofuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlihashkeybdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuvmspace_dusedudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatpool_get_doneuihashrijndaelEncryptscsi_ioh_deltcp_keepintvluvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskeephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepciide_ite_productssys_chownpciide_rdc_productsuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockinflateBackuvm_anfreeuhci_bus_methodsrt_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmappool_runqueuebwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssimq_dequeuenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdatechillbufsudp_sysctlsys_openatbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlenbufcache_initrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaituvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arrayuvm_uarea_allocem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsrn_link_dupedkeysysctl_cptime2scsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scanural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__ip6_insertfraghdrresume_randomnesscnstopihashtblieee80211_set_shortslottimesys_dup2em_phy_resetsiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cadevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authSipHash_Updatert2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_startwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcuvm_mmaplockrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadugl_watchdogsr_ccb_putin6_pcbsetportnd6_rs_output_timeoutalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_maprdc_setup_channeliic_printgetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetuhci_pci_cascsi_ioh_addext4_ext_find_extentbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimern_del_radix_masksr_raid6_initrt2661_rxratecd_buf_donescsi_devid_pg80rtable_insertbreadntcp_hdrszscsi_devid_pg83tcbtablei80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initsrp_update_lockedpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatcpu_kcore_hdrexec_elf32_fixupvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_match_nrssi_thresholduvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEcrypto_freesessioncnbellm_copydatabufq_nscan_requeueuvmfault_initatu_stopcd_setchanieee80211_get_probe_reqpool_p_removemtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachicmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctlumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterugen_do_closefilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectfs_sysctlukbd_cnattachboot_filepte_l1_s_prot_uwfilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192uvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_explorebufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimebwi_set_clock_modeuhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addmq_delistrt2860_mcu_bbp_writezeropageipsec_def_encrtable_deletebrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadaxen_ifmedia_stsflslbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypendin6addr_linklocal_allroutersuvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6uvm_iosbcheckreservepreemptbioattachieee80211_begin_scanunixdomainbwi_led_attachbwi_tbl_write_2smdscsibusattachugl_devsumct_rtsem_get_flash_presence_i210syn_hash1ulminwihap_data_inputi80321intc_do_pendingproc0paddrrn_addmaskuvm_vnode_poolpciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgwskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoversowrite_filtopssr_chunks_unwindstrncpysdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stoprrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolmq_dechainieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusyusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokscsi_minphyssiop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofufs_ihashumct_paramuhidev_attachfrag6_nfragpacketsaxen_startsr_raid0_assemblert2860_wakeupbwi_cdpool_allocator_largeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsmii_submatchohci_root_intr_transfermsdosfs_pathconfoldpidstimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepuvm_pauseehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closepool_wait_gcsr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachsys_dupmcllowatmii_printuslhcom_setupieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordmq_enlistscsi_xs_syncsoftdep_initializeunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initwdreadlastdaycheck_execwi_usb_cdtcp_initpte_l2_s_cache_mode_ptpool_request_initdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtricsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsiguvm_mmapfilesys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxthrsleepumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readrt2860_select_chan_groupfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachurl_tick_taskbufcache_releasecue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applySipHash_Endgeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopebwi_pa_modebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_clonetame_failatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startbwi_get_card_flagsbwi_rf_get_gainscomstartuslhcom_setaes_xts_reinitcfroots_sizebwi_mac_gpio_finitickadjiq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchieee80211_alloc_nodeblf_ecb_decryptcrcopyural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsuslhcom_closebufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_iottylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputsr_raid5_wu_donekue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutumodem_detachcpuset_add_alluhci_root_intr_abortsystqmpVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptbufq_fifo_destroyacer_dma_initcluster_writesr_raid5_createhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timerrn_add_radix_masksr_raid1_rwucomwritein6_recoverscopensphy_servicebwi_dma_mbuf_create30aue_ticki80321intc_cdtimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cascsi_pending_finishscsi_preventmmclosecd9660_accesssr_wu_getffs_statfscpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacefdropsr_block_putkm_alloci80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setaxen_devsrgephy_serviceif_attachsetuppipe_writesr_set_chunk_stateuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofaxen_lock_miiugenkqfilterural_amrr_startnlineswohci_rem_edether_ifattachinflateSync__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatewsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrpool_gc_schedgetnanouptimeohci_pci_detachuhci_pci_detachi80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkip6_savecontroldevice_registerpciide_chan_candisablebufcache_getanycleanbufsr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bmountrootsyn_cache_resetuhci_device_intr_doneuhidev_openundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2rootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulluslhcom_writem_extfree_poolip6_pullexthdrcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readprocess0niq_enlistieee80211_send_eapol_key_reqrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondspci_probe_devicewi_get_txpowerural_plcp_signaludav_stopusbd_error_strslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallsffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadlbwi_mac_gpio_initucomstopfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1uvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readsrp_startupbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_pooluplcom_resetuslhcom_get_statusuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncprocess_initializebwi_newbuf30rt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_casys_tameixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startniq_initpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionphysiosr_ccb_donein6_selecthlimupl_sendwdattachmii_phy_delete_mediain6_unlink_ifaicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixbwi_read_spromaxen_matchsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errorwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32rt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninguao_shrinksvwsata_read_regpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhidpollmq_initsched_wasidlesr_raid5_initieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anykue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intrdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkmainbusmatchin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremtaskq_destroycttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11gwdc_scrub_xferuvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachtqphy_statuscluster_collectbufskp_dma_contigcd9660_isohashsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodepte_l1_s_prot_kruvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3srp_get_lockedntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freesd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registeruvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4dead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregspec_fsync__wdcwait_resetdoacceptuvm_map_deallocateicmp_reflectieee80211_parse_wpascsi_xsh_iohext2fs_reclaimpciide_acer_productsnd6_rs_output_set_timoffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbrgphy_mii_phy_autoohci_devd__end__bwi_start_tx32nsphy_reseturl_sendcdce_encapnd6_rs_timeout_countufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockrtable_getaes_ctr_setkeyumct_attachurl_resetp2p_rtrequestusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesm_gethdrem_dma_mallocconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdsr_raid1_initxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledssiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskpcaled_cdipforwardingohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlsyn_cache_lookupaxen_miibus_readregprtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescif_link_state_change_taskfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopscomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodecleancachestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlentcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolsys_adjfreqpci_caqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdirrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergem_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchzcallocural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminnet_tick_tosys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartip6_hopopts_inputselfalseieee80211_media_initricohrtc_gettimescsi_default_putsr_free_resourcescom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncehci_resetwi_setmultiuvn_clusterinitprocessre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4ml_dechainuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusarptfreeubsa_detachfilt_ugenread_intrbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodehpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2comttybuf_undirtysysctl_tstringsr_meta_clearusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchallprocessrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchcrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicecd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachnd6_rs_dev_statein6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intraxen_tickuhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printukbd_apple_mba_mungeext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authsrp_gc_inituhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimedisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053wdc_ioc_ata_cmdcd_get_parmspmap_extractrt2860_set_chanin_purgeaddrnd6_ifptomacamap_unaddural_watchdogmsdosfsread_filtopsuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachpipe_kqfilterdowait4em_configure_k1_ich8lannforce_pci_intrext2fs_openehci_alloc_sitd_chainpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validateuslhcom_readstopprofclockbufq_nscan_destroybwi_rf_on_11bgnullioctlcertance_irq_mapsys_getentropypte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbwi_regwin_selectbreadem_intrieee80211_node_copynd6_rs_outputamap_lookupipctl_varsapollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyaxen_ax88179_initproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keyieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapif_getgroupmemberssoo_kqfilterml_enqueuecpu_startupusbd_set_hub_depthamap_refehci_device_bulk_transferuhci_device_isoc_transferwdc_ioctlamphyattachrt2661_updateslotfdexpandcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_getext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setscsi_iopool_puttask_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuilduvmspace_freetcp_rscalettwakeupext2fs_inode_poolffs_ino_poolpci_detach_devicestame_setsockopt_checkmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpif_input_queueVOP_PRINTfdsharepci_subclass_memoryuipc_setaddrugl_tx_list_initicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatuvisor_cdsd_cmd_rw16ghash_updatesiop_cmd_putbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockallwskbdcloseuvm_sysctlucom_do_closegetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_pooluslhcom_clear_fifouhci_device_intr_transferarp_poolsmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardieee80211_clean_cachedsmsc_unlock_miiohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mappte_l1_s_prot_urvfs_getnewfsidaue_rxeofem_cducom_attachudp6_ctlinputitimerroundSHA512Finalaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrrtioctlkue_ctlscsi_xs_putuaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidehci_pci_activatespeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getbwi_rf_clear_tssim_getptrukbd_caufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerovfsinituvisor_closeupl_caubsa_paramcnclosetcp_do_rfc1323ip_fragsin_addhostwdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutsr_raid0_rwif_downallsys_kbindext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocml_filterstart_reaperehci_root_ctrl_methodsif_rxr_info_ioctlsys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutttyclosewdrestartugen_isoc_rintrcomp_algo_deflatemaxvfsconfml_dequeuetimeout_addcpu_cdip6_forwardbufcache_adjustnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downin_pcbhashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delnd6_rs_output_timottyoutdevice_lookupbpf_sysctl_lockedwi_usb_txeofsr_crypto_preparecdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basesr_raid5_rwpci_subclass_displaylooutputrt3090_rf_readcue_setmultisoisdisconnectedxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsuvn_putigmp_checktimerscsi_add_linkpci_vga_taguslhcom_set_baud_ratexscale_cache_clean_minidataieee80211_proto_detachpool_gc_pagesmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2enc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcluphy_funcsieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowuslhcom_matchhidkbd_bell_fn_argtcp_ackdrop_ppslim_countarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readcd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgeaxen_unlock_miitcp_keepidleif_attachheadnextcwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96umass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cdieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportuslhcom_detachukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mifq_congestionresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_starttame_sysctl_checkpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatsuspend_randomnessmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimevm_min_kernel_addressuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4prefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timersys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecountersys_sendsyslograwin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORvnode_poolzombprocessrt2661_rx_intrin_cksumuao_shrink_convertvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setbucketkqueue_writesys_syncieee80211_reset_scancominitaxen_resetrt2560_newassocenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumfintek_fullspeedi80321_mem_bs_allocrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachernd_event_idxhaltpciide_sis_productseephy_cainphy_caieee80211_std_rateset_11akputcharbootargssys_getsidRMD160Initdisk_gonewi_write_record_usbcue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcrn_add_dupedkeymsgscpu_exitip6_initpktoptsbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statussii3114_chansetupxscale_cache_purgeDscsi_activate_targetuvm_km_valloc_waitufs_ihashinitunp_defersys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsr_raid5_openingsaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closeem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodesosendtaskq_initdosetrlimituvm_pmemrange_addr_RB_PREVrn_inituvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachsiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finalrt2661_set_slottimepci_get_ht_capabilityscsi_cmd_rw_decodeprocess_read_regschainlengthbwi_mac_startwdc_pdc203xx_vtblusb_fill_udc_taskpte_l1_s_prot_masksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbspciide_ati_productsrtmask_poolsmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_donert2860_set_bssidchkvnlockhw_sysctltc_ticktockrt2560_newstatephtree_RB_MINMAXuhci_device_bulk_abortpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuein6_pcbbindpool_large_allocicmp_do_exthdrreaperbwi_bus_initcoredumpfilt_kqueueugen_cdmalloc_roundupusbd_strpipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_statemq_enqueueureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadnd6_rs_initcast5_encryptsys_exitpciide_chanfreesbtryuvisor_matchm_applyaxen_ifmedia_updswcr_processudav_startaxe_lock_miirt2560_detachwdc_exec_commandudv_lockbufqswdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedochflagsatdcphy_reseti80321intc_read_intsrcpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflateehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initbuf_flip_dmauserconf_changerdcide_holduserconf_helpsr_ioctl_setstateufs_advlockicmp_initsii3112_chip_mapcdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrugl_attachrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtesr_crypto_get_kdfmainbusattacharc4_taskbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctltame_aftersyscallsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devhfsc_purgestartniq_enqueueusbd_devinfotame_sendto_checksiop_wdtr_negral_pci_wakeupuvm_mapanonvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupin6addr_intfacelocal_allnodeslogreadumsm_cddead_lockieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapem_initialize_transmit_unitcnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutehci_device_bulk_doneuipc_usrreqnd6_na_inputvflush_vnode_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96coldunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidtame_syscallspciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddodup3userconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeyscsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroyusbd_get_cdescnd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapconsbufpwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_regchar_typeohci_free_sitdusbctlprintvn_closeuftdi_readudav_csr_writeuhid_do_readdoclusterwritert_timer_queue_countusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragsm_extref_mtxlimfreedoutimensatuhci_reset__wdccommand_intrrt2661_startuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctluserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cduhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0ciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamesr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initnaptimedcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrsensor_task_workinitialvnodesuhci_cdconfig_suspendieee80211_parse_rsn_cipherpool_page_freewdactivatecopystrsched_nmigrationswdc_do_resetiftxlistsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateether_inputuvm_vsunlocktame_cmsg_recvlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunlineswmsdosfs_symlinksys_symlinkicmp6_sysctlpool_p_insertclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleaseehci_disownuvm_swapout_threadsural_bbp_writetask_addknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertnd6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqtaskq_next_workrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqubsa_methodsehci_check_itd_intrscsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORauth_hash_gmac_aes_256crypto_driverssysctl_int_loweriftovt_tabtcp_backoffsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufre_set_jumbopci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autobpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startrdcide_setupifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmml_joinbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statgeneric_bs_w_4inflateEndrt_checkgatebufcache_takesr_set_vol_statewsevent_pollsys_profilvmcmd_map_pagedvnciphy_serviceugl_stopin6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmsys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachural_detachuslhcom_methodsaxe_ax88772b_nodeidukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configusb_fill_udf_tasksoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupin_insert_prefixieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregionrt2661_node_allocneedbufferin6_ifattachtame_adjtime_checktcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4SipHash_Initohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freescsi_io_get_donexscale_cache_clean_sizebuf_objectip6_rr_pruneuao_grow_convertjmicron_setup_channelusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyuiomoveiohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensoftnettqsd_thin_pagesnclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockrt_timer_adduvmspace_shareentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashsyncer_delaynore_tickre_resetin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolehci_rem_itd_chainunix2winfnmsleephfsc_enqueuepiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwsohasoutofbandieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrmii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupwdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEndmq_filterdevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getbwi_mac_fw_load_ivpool_primedevid_allocm_extrefpgrphashtbldoppollrt2860_read_eepromifmedia_matchget_crc_tablestatclockuhcixfersiop_ppr_msgrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_findrt2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitatu_switch_radiomsdosfs_readdirdead_ebadfextent_do_allocbrgphy_attachnd6_timer_taskobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readnet_ticksicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64ohci_rhsc_ablesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierffs1_compat_writepdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaitufs_reclaimdorefreshcredskv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrfilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodsmbstatmtxsys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconnufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca